Images.pcmac.org



34136865715WHOLE NUMBERS00WHOLE NUMBERS4th Grade – Math – SingaporeCh 1 – 6 days, Ch 2 – 3 days48863252303780Vocabularypatternrounddigitsplace valueexpanded formsumcomparerepresentamountcomposecount by 100sdecomposeroundingskip-countvaluebase-ten numeralcomparisonexpanded notationfront-end digitten thousands placehundred thousands placemillions placeexpanded formtens placehundreds placeones placemissing number00Vocabularypatternrounddigitsplace valueexpanded formsumcomparerepresentamountcomposecount by 100sdecomposeroundingskip-countvaluebase-ten numeralcomparisonexpanded notationfront-end digitten thousands placehundred thousands placemillions placeexpanded formtens placehundreds placeones placemissing number-653142315746MaterialsNumber discsPlace value chart00MaterialsNumber discsPlace value chartLearner Goals:Singapore Page CitationsUse place-value models to represent numbers to 100,000.TB-A: Unit 1, 8-21WB-A: 7-18Read, write in words, standard, and expanded notation, identify place values of digits, and compare and order numbers within 100,plete or extend regular number patterns for numbers within 100,000.Use place-value models to represent numbers to 1,000,000.Use place-value models to represent numbers to 1,000,000,000.Read, write in words, standard, and expanded notation, identify place values of digits, and compare and order numbers within 1,000,000,plete or extend regular number patterns for numbers within 1,000,000,000.Round numbers within 1,000,000,000 to the nearest 10, 100 or 1000.TB-A: Unit 1, 22-25WB-A: 19-204886325153670Suggested LiteratureOne Hundred Hungry Ants by Elinor J. PinczesAmanda Bean’s Amazing Dream by Cindy Neuschwander00Suggested LiteratureOne Hundred Hungry Ants by Elinor J. PinczesAmanda Bean’s Amazing Dream by Cindy Neuschwander29133328255FACTORS AND MULTIPLES0FACTORS AND MULTIPLES4th Grade – Math – Singapore Ch 3 – 2 days, Ch 4 – 3 daysLearner Goals:Singapore Page CitationsFind the factors and common factors of whole numbers within 100.TB-A: Unit 1, 26-37WB-A: 21-27Identify prime numbers.Find multiples and common multiples of whole numbers within plete or extend regular number patterns for numbers within 100,000.TB-A: Unit 1, 33WB-A: 15-654051223010Operations and Algebraic Thinking 4.OAGain familiarity with factors and multiples.4. Find all factor pairs for a whole number in the range 1–100. Recognize that a whole number is a multiple of each of its factors. Determine whether a given whole number in the range 1–100 is a multiple of a given one-digit number. Determine whether a given whole number in the range 1–100 is prime or composite. Generate and analyze patterns.5. Generate a number or shape pattern that follows a given rule. Identify apparent features of the pattern that were not explicit in the rule itself. For example, given the rule “Add 3” and the starting number 1, generate terms in the resulting sequence and observe that the terms appear to alternate between odd and even numbers. Explain informally why the numbers will continue to alternate in this way.00Operations and Algebraic Thinking 4.OAGain familiarity with factors and multiples.4. Find all factor pairs for a whole number in the range 1–100. Recognize that a whole number is a multiple of each of its factors. Determine whether a given whole number in the range 1–100 is a multiple of a given one-digit number. Determine whether a given whole number in the range 1–100 is prime or composite. Generate and analyze patterns.5. Generate a number or shape pattern that follows a given rule. Identify apparent features of the pattern that were not explicit in the rule itself. For example, given the rule “Add 3” and the starting number 1, generate terms in the resulting sequence and observe that the terms appear to alternate between odd and even numbers. Explain informally why the numbers will continue to alternate in this way.48882301223010Vocabularyproductfactorcompositeprimecommon factormultiplecommon multipleterm (of a sequence)patternrulewhole numberfactor pairgreatest common factorleast common multiple00Vocabularyproductfactorcompositeprimecommon factormultiplecommon multipleterm (of a sequence)patternrulewhole numberfactor pairgreatest common factorleast common multiple4886696145984Suggested LiteratureThe Best of Times by Greg Tang00Suggested LiteratureThe Best of Times by Greg Tang488669738587Grade 3 Learner Goals:00Grade 3 Learner Goals:-6531444582MaterialsConnect-a-cubesSome square grid paperLaminated hundreds boardsTransparent counters or a dry-erase markerOpaque counters Materials for each group of about 4 students:Counters, a different color for each studentNumber cards 1-10, 4 sets per group (or a 10 sided number cube)00MaterialsConnect-a-cubesSome square grid paperLaminated hundreds boardsTransparent counters or a dry-erase markerOpaque counters Materials for each group of about 4 students:Counters, a different color for each studentNumber cards 1-10, 4 sets per group (or a 10 sided number cube)488632526035Grade 5 Learner Goals:Find the factors and common factors of whole numbers within 100.Find the greatest common factor of up to 3 numbers within 100.Identify prime numbers.Determine the prime factors of numbers within 100 and write the numbers as products of prime numbers, using exponents. Find multiples and common multiples of whole numbers within 100.Find the lowest common multiple of up to 3 numbers within 100.00Grade 5 Learner Goals:Find the factors and common factors of whole numbers within 100.Find the greatest common factor of up to 3 numbers within 100.Identify prime numbers.Determine the prime factors of numbers within 100 and write the numbers as products of prime numbers, using exponents. Find multiples and common multiples of whole numbers within 100.Find the lowest common multiple of up to 3 numbers within 100.-65314352301Teacher Notes00Teacher Notes29133328255ORDER OF OPERATIONS0ORDER OF OPERATIONS4th Grade – Math – Singapore Ch 5 – 3 daysLearner Goals:Singapore Page CitationsUse order of operations to solve mathematical expressions with or without parentheses.TB-A: Unit 1, 38-41WB-A: 28-334886696712576Vocabularyequationexpressionorder of operationsadditionsubtractionmultiplicationdivisionparentheses00Vocabularyequationexpressionorder of operationsadditionsubtractionmultiplicationdivisionparentheses-65405711835Operations and Algebraic Thinking 4.OA00Operations and Algebraic Thinking 4.OA-67945306070MaterialsOperation cards +, -, x, and ÷, =, and parentheses cards ( and ), eight sets per groupNumber cards 0-9, four sets per group00MaterialsOperation cards +, -, x, and ÷, =, and parentheses cards ( and ), eight sets per groupNumber cards 0-9, four sets per group-65405320040Teacher Notes00Teacher Notes488632522860Suggested Literature00Suggested Literature488632542545Grade 3 Learner Goals:00Grade 3 Learner Goals:4886696788159Grade 5 Learner Goals:Use order of operations to solve mathematical expressions with or without parentheses.00Grade 5 Learner Goals:Use order of operations to solve mathematical expressions with or without parentheses.29133328255NEGATIVE NUMBERS0NEGATIVE NUMBERS4th Grade – Math – SingaporeCh 6 – 3 days, R – 1-2 daysLearner Goals:Singapore Page CitationsUnderstand and interpret negative numbers, locate negative numbers on a number line, compare and order integers.TB-A: Unit 1, 42-47WB-A: 34-37Recognize and extend regular number patterns that include negative numbers.4886325866775Vocabularypositive numbersnegative numbers00Vocabularypositive numbersnegative numbers-66040868045Operations and Algebraic Thinking 4.OA00Operations and Algebraic Thinking 4.OA-67310267970MaterialsA set of 10 number cards for each group with random numbers between -100 and +10000MaterialsA set of 10 number cards for each group with random numbers between -100 and +100488669620781Suggested Literature00Suggested Literature-65405168275Teacher Notes00Teacher Notes4885055179705Grade 3 Learner Goals:00Grade 3 Learner Goals:4886325476885Grade 5 Learner Goals:Understand and interpret negative numbers, locate negative numbers on a number line, compare and order integers.Find the numerical value of negative numbers.Add and subtract positive and negative integers.00Grade 5 Learner Goals:Understand and interpret negative numbers, locate negative numbers on a number line, compare and order integers.Find the numerical value of negative numbers.Add and subtract positive and negative integers.291539259384 OPERATIONS OF WHOLE NUMBERSADDITION AND SUBTRACTION004 OPERATIONS OF WHOLE NUMBERSADDITION AND SUBTRACTION4th Grade – Math – SingaporeCh 1 – 4 daysLearner Goals:Singapore Page CitationsAdd/Subtract numbers within 10,000.TB-A: Unit 2, 51-58WB-A: 40-50Use estimation to verify the reasonableness of calculated results in addition and subtraction, check subtraction problems using addition.TB-A: Unit 2, 55-56WB-A: 47-48Determine whether an estimate is sufficient for a specific problem situation.Use the commutative and associative properties to perform mental calculations and check results.TB-A: Unit 2, 54-55WB-A: 44-46Mentally subtract from 1000.Mentally add/subtract a number close to 1000 (e.g. 998).Solve 2-step word problems which involve the four operations on whole numbers.TB-A: Unit 2, 51, 57-58WB-A: 49-50Use boxes and other symbols to stand for unknown numbers in expressions and equations.ThroughoutRepresent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams.TB-A: Unit 2, 51-53, 57WB-A: 49-5048866963337024Vocabularysumdifferenceadditionrounddigitequationplace valuesubtractionaddendcomposedecomposeminuendrepresentoperation2-step problem morereasonableestimationestimatelessaltogethermental calculationsreasonableexact number00Vocabularysumdifferenceadditionrounddigitequationplace valuesubtractionaddendcomposedecomposeminuendrepresentoperation2-step problem morereasonableestimationestimatelessaltogethermental calculationsreasonableexact number-654053340711Operations and Algebraic Thinking 4.OAUse the four operations with whole numbers to solve problems.3. Solve multistep word problems posed with whole numbers and having whole-number answers using the four operations, including problems in which remainders must be interpreted. Represent these problems using equations with a letter standing for the unknown quantity. Assess the reasonableness of answers using mental computation and estimation strategies including rounding. Number and Operations in Base Ten 4.NBTUse place value understanding and properties of operations to perform multi-digit arithmetic.4. Fluently add and subtract multi-digit whole numbers using the standard algorithm. 00Operations and Algebraic Thinking 4.OAUse the four operations with whole numbers to solve problems.3. Solve multistep word problems posed with whole numbers and having whole-number answers using the four operations, including problems in which remainders must be interpreted. Represent these problems using equations with a letter standing for the unknown quantity. Assess the reasonableness of answers using mental computation and estimation strategies including rounding. Number and Operations in Base Ten 4.NBTUse place value understanding and properties of operations to perform multi-digit arithmetic.4. Fluently add and subtract multi-digit whole numbers using the standard algorithm. 4886696144418MaterialsNumber discs (discs with 1, 10, and 100 written on them)00MaterialsNumber discs (discs with 1, 10, and 100 written on them)-6531472646Suggested Literature00Suggested Literature-158753519805Teacher Notes00Teacher Notes4886696273189Grade 5 Learner Goals:Use estimation to verify the reasonableness of calculated results in addition and subtraction, check subtraction problems using addition.Add/subtract numbers in the billions.Use letters to stand for unknown numbers in equations and solve for the unknown numbers using properties of the four operations. Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams. Solve multi-step word problems involving all four operations on whole numbers, fractions, decimals, percentage, and ratios. Use the commutative and associative properties to perform mental calculations and check results.Add/subtract a number close to a multiple of 100 (e.g. 498).00Grade 5 Learner Goals:Use estimation to verify the reasonableness of calculated results in addition and subtraction, check subtraction problems using addition.Add/subtract numbers in the billions.Use letters to stand for unknown numbers in equations and solve for the unknown numbers using properties of the four operations. Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams. Solve multi-step word problems involving all four operations on whole numbers, fractions, decimals, percentage, and ratios. Use the commutative and associative properties to perform mental calculations and check results.Add/subtract a number close to a multiple of 100 (e.g. 498).-17813273190Grade 3 Learner Goals:Add/Subtract numbers within 10,000.Use estimation to verify the reasonableness of calculated results in addition and subtraction, check subtraction problems using addition.Solve 2-step word problems which involve the four operations on whole numbers.Solve problems involving numeric equations or inequalities.Select appropriate operational symbol to make an expression true.Use boxes and other symbols to stand for unknown numbers in expressions and equations.Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams.00Grade 3 Learner Goals:Add/Subtract numbers within 10,000.Use estimation to verify the reasonableness of calculated results in addition and subtraction, check subtraction problems using addition.Solve 2-step word problems which involve the four operations on whole numbers.Solve problems involving numeric equations or inequalities.Select appropriate operational symbol to make an expression true.Use boxes and other symbols to stand for unknown numbers in expressions and equations.Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams.2916621157664 OPERATIONS OF WHOLE NUMBERSMULTIPLICATION AND DIVISION004 OPERATIONS OF WHOLE NUMBERSMULTIPLICATION AND DIVISION4th Grade – Math – Singapore Ch 2 – 4 days-863602781935MaterialsNumber discs (discs with 1, 10, and 100 written on them)Place value cards00MaterialsNumber discs (discs with 1, 10, and 100 written on them)Place value cards49377602780775Vocabularymultipleproductdivisionmultiplicationquotientequationpatternruledivisorestimaterounddividendfactorremaindercomparedivide00VocabularymultipleproductdivisionmultiplicationquotientequationpatternruledivisorestimaterounddividendfactorremaindercomparedivideLearner Goals:Singapore Page CitationsMultiply numbers within 10,000 by a 1-digit number.TB-A: Unit 2, 59-67WB-A: 51-55Divide numbers within 10,000 by a 1-digit number, including situations where there is a remainder.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.TB-A: Unit 2, 61, 63-64, 66-67WB-A: 51-55Check division problems using multiplication.throughoutSolve 2-step word problems which involve the four operations on whole numbers.TB-A: Unit 2, 65-67WB-A: 54-55Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams. Use the distributive property to perform mental calculations and check results.TB-A: Unit 2, 62-63WB-A: Use divisibility rules for 2, 3, 5, 6, 9, and 10.throughout4948555123190Suggested LiteratureThe Best of Times by Greg TangDivide and Ride by Stuart J MurphyA Remainder of One by Elinor J PinczesMinnie’s Diner: A Multiplying Menu by Dayle Ann Dodds00Suggested LiteratureThe Best of Times by Greg TangDivide and Ride by Stuart J MurphyA Remainder of One by Elinor J PinczesMinnie’s Diner: A Multiplying Menu by Dayle Ann Dodds-136525635Operations and Algebraic Thinking 4.OAUse the four operations with whole numbers to solve problems.1. Interpret a multiplication equation as a comparison, e.g., interpret 35 = 5 × 7 as a statement that 35 is 5 times as many as 7 and 7 times as many as 5. Represent verbal statements of multiplicative comparisons as multiplication equations. 2. Multiply or divide to solve word problems involving multiplicative comparison, e.g., by using drawings and equations with a symbol for the unknown number to represent the problem, distinguishing multiplicative comparison from additive comparison. 3. Solve multistep word problems posed with whole numbers and having whole-number answers using the four operations, including problems in which remainders must be interpreted. Represent these problems using equations with a letter standing for the unknown quantity. Assess the reasonableness of answers using mental computation and estimation strategies including rounding. Number and Operations in Base Ten 4.NBT Generalize place value understanding for multi-digit whole numbers.1. Recognize that in a multi-digit whole number, a digit in one place represents ten times what it represents in the place to its right. For example, recognize that 700 ÷ 70 = 10 by applying concepts of place value and division. Use place value understanding and properties of operations to perform multi-digit arithmetic.5. Multiply a whole number of up to four digits by a one-digit whole number, and multiply two two-digit numbers, using strategies based on place value and the properties of operations. Illustrate and explain the calculation by using equations, rectangular arrays, and/or area models.6. Find whole-number quotients and remainders with up to four-digit dividends and one-digit divisors, using strategies based on place value, the properties of operations, and/or the relationship between multiplication and division. Illustrate and explain the calculation by using equations, rectangular arrays, and/or area models. 00Operations and Algebraic Thinking 4.OAUse the four operations with whole numbers to solve problems.1. Interpret a multiplication equation as a comparison, e.g., interpret 35 = 5 × 7 as a statement that 35 is 5 times as many as 7 and 7 times as many as 5. Represent verbal statements of multiplicative comparisons as multiplication equations. 2. Multiply or divide to solve word problems involving multiplicative comparison, e.g., by using drawings and equations with a symbol for the unknown number to represent the problem, distinguishing multiplicative comparison from additive comparison. 3. Solve multistep word problems posed with whole numbers and having whole-number answers using the four operations, including problems in which remainders must be interpreted. Represent these problems using equations with a letter standing for the unknown quantity. Assess the reasonableness of answers using mental computation and estimation strategies including rounding. Number and Operations in Base Ten 4.NBT Generalize place value understanding for multi-digit whole numbers.1. Recognize that in a multi-digit whole number, a digit in one place represents ten times what it represents in the place to its right. For example, recognize that 700 ÷ 70 = 10 by applying concepts of place value and division. Use place value understanding and properties of operations to perform multi-digit arithmetic.5. Multiply a whole number of up to four digits by a one-digit whole number, and multiply two two-digit numbers, using strategies based on place value and the properties of operations. Illustrate and explain the calculation by using equations, rectangular arrays, and/or area models.6. Find whole-number quotients and remainders with up to four-digit dividends and one-digit divisors, using strategies based on place value, the properties of operations, and/or the relationship between multiplication and division. Illustrate and explain the calculation by using equations, rectangular arrays, and/or area models. 47927170Grade 3 Learner Goals:Relate division to multiplication.Recognize and extend regular linear patterns.Understand quotient and remainder.Understand the properties of 0 and 1 in multiplication and division.Multiply numbers within 1000 by a 1-digit number. Multiply numbers within 10,000 by a 1-digit number.Divide numbers within 1000 by a 1-digit number, including situations where there is a remainder. Divide numbers within 10,000 by a 1-digit number, including situations where there is a remainder.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Solve 2-step word problems which involve the four operations on whole numbers.Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams. 00Grade 3 Learner Goals:Relate division to multiplication.Recognize and extend regular linear patterns.Understand quotient and remainder.Understand the properties of 0 and 1 in multiplication and division.Multiply numbers within 1000 by a 1-digit number. Multiply numbers within 10,000 by a 1-digit number.Divide numbers within 1000 by a 1-digit number, including situations where there is a remainder. Divide numbers within 10,000 by a 1-digit number, including situations where there is a remainder.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Solve 2-step word problems which involve the four operations on whole numbers.Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams. -1418903256806Teacher Notes00Teacher Notes47927171191523Grade 5 Learner Goals:Multiply numbers within 10,000 by a 2-digit number.Divide numbers within 10,000 by a 2-digit number.Multiply/divide numbers within 1,000,000 by tens, hundreds, or thousands.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Use divisibility rules for 2, 3, 5, 6, 9, and 10.Understand the distributive property.Use the distributive property to perform mental calculations and check results.Multiply by 99 or by 25Multiply by a number one less than a multiple of 10 or 100 (e.g. 49, 499).Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams. 00Grade 5 Learner Goals:Multiply numbers within 10,000 by a 2-digit number.Divide numbers within 10,000 by a 2-digit number.Multiply/divide numbers within 1,000,000 by tens, hundreds, or thousands.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Use divisibility rules for 2, 3, 5, 6, 9, and 10.Understand the distributive property.Use the distributive property to perform mental calculations and check results.Multiply by 99 or by 25Multiply by a number one less than a multiple of 10 or 100 (e.g. 49, 499).Represent unknown quantities with bar diagrams and solve word problems involving whole numbers using bar diagrams. 291539259384 OPERATIONS OF WHOLE NUMBERSMULTIPLICATION by a 2-DIGIT NUMBER004 OPERATIONS OF WHOLE NUMBERSMULTIPLICATION by a 2-DIGIT NUMBER4th Grade – Math – Singapore Ch 3 – 4 days, R – 1-2 days49460151292860Vocabularymultipleproductdivisionmultiplicationquotientequationpatternruledivisorestimaterounddividendfactorremaindercompare00Vocabularymultipleproductdivisionmultiplicationquotientequationpatternruledivisorestimaterounddividendfactorremaindercompare-647701257935Number and Operations in Base Ten 4.NBT Generalize place value understanding for multi-digit whole numbers.1. Recognize that in a multi-digit whole number, a digit in one place represents ten times what it represents in the place to its right. For example, recognize that 700 ÷ 70 = 10 by applying concepts of place value and division. Use place value understanding and properties of operations to perform multi-digit arithmetic.5. Multiply a whole number of up to four digits by a one-digit whole number, and multiply two two-digit numbers, using strategies based on place value and the properties of operations. Illustrate and explain the calculation by using equations, rectangular arrays, and/or area models. 00Number and Operations in Base Ten 4.NBT Generalize place value understanding for multi-digit whole numbers.1. Recognize that in a multi-digit whole number, a digit in one place represents ten times what it represents in the place to its right. For example, recognize that 700 ÷ 70 = 10 by applying concepts of place value and division. Use place value understanding and properties of operations to perform multi-digit arithmetic.5. Multiply a whole number of up to four digits by a one-digit whole number, and multiply two two-digit numbers, using strategies based on place value and the properties of operations. Illustrate and explain the calculation by using equations, rectangular arrays, and/or area models. Learner Goals:Singapore Page CitationsMultiply numbers within 10,000 by a 2-digit number.TB-A: Unit 2, 68-73WB-A: 56-62Multiply by 99 or by 25.Multiply 10's by 10's or 100's.Use the distributive property to perform mental calculations and check results.4946015192405Suggested LiteratureThe Best of Times by Greg TangDivide and Ride by Stuart J MurphyA Remainder of One by Elinor J PinczesMinnie’s Diner: A Multiplying Menu by Dayle Ann Dodds00Suggested LiteratureThe Best of Times by Greg TangDivide and Ride by Stuart J MurphyA Remainder of One by Elinor J PinczesMinnie’s Diner: A Multiplying Menu by Dayle Ann Dodds-64770286831MaterialsNumber discs (discs with 1, 10, and 100 written on them)Appendix 2.r00MaterialsNumber discs (discs with 1, 10, and 100 written on them)Appendix 2.r4946073238397Teacher Notes00Teacher Notes5029200184068Grade 5 Learner Goals:Multiply numbers within 10,000 by a 2-digit number.Divide numbers within 10,000 by a 2-digit number.Multiply/divide numbers within 1,000,000 by tens, hundreds, or thousands.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Use divisibility rules for 2, 3, 5, 6, 9, and 10.Understand the distributive property.Use the distributive property to perform mental calculations and check results.Multiply by 99 or by 25Multiply by a number one less than a multiple of 10 or 100 (e.g. 49, 499).00Grade 5 Learner Goals:Multiply numbers within 10,000 by a 2-digit number.Divide numbers within 10,000 by a 2-digit number.Multiply/divide numbers within 1,000,000 by tens, hundreds, or thousands.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Use divisibility rules for 2, 3, 5, 6, 9, and 10.Understand the distributive property.Use the distributive property to perform mental calculations and check results.Multiply by 99 or by 25Multiply by a number one less than a multiple of 10 or 100 (e.g. 49, 499).-53439184068Grade 3 Learner Goals:Relate division to multiplication.Recognize and extend regular linear patterns.Understand quotient and remainder.Understand the properties of 0 and 1 in multiplication and division.Multiply numbers within 1000 by a 1-digit number. Multiply numbers within 10,000 by a 1-digit number.Divide numbers within 1000 by a 1-digit number, including situations where there is a remainder. Divide numbers within 10,000 by a 1-digit number, including situations where there is a remainder.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Solve 2-step word problems which involve the four operations on whole numbers.00Grade 3 Learner Goals:Relate division to multiplication.Recognize and extend regular linear patterns.Understand quotient and remainder.Understand the properties of 0 and 1 in multiplication and division.Multiply numbers within 1000 by a 1-digit number. Multiply numbers within 10,000 by a 1-digit number.Divide numbers within 1000 by a 1-digit number, including situations where there is a remainder. Divide numbers within 10,000 by a 1-digit number, including situations where there is a remainder.Use estimation to verify the reasonableness of calculated results in multiplication and division problems.Check division problems using multiplication.Solve 2-step word problems which involve the four operations on whole numbers.29235405715FRACTIONS0FRACTIONS4th Grade – Math – Singapore Ch 1 – 3 days, Ch 2 – 3 days, Ch 3 – 1 day, Ch 4 – 4 daysCh 5 – 2 days, Ch 6 – 9 days, R – 1-2 daysLearner Goals:Singapore Page CitationsUnderstand mixed numbers and improper fractions, convert between them, locate them on a number line.TB–A: Unit 3, 88-93 WB–A: 77-87Find equivalent fractions and simplest form of a fraction.TB–A: Unit 3, 77–80 WB–A: 67–70Find the fraction of a set where the answer is a whole number.TB–A: Unit 3, 98-104 WB–A: 90-109Find fraction of a set for measurements (e.g. 10 minutes as a fraction of one hour).Add/Subtract related fractions.TB–A: Unit 3, 81–82, 87, 88-89, 92-93WB–A: 75–76, 77-78, 83-85Compare and order fractions with different denominators.TB–A: Unit 3, 79–80 WB–A: 70, 87 Relate division to fractions.TB–A: Unit 3, 94-96 WB–A: 88-89Multiply a fraction by a whole number.TB–A: Unit 3, 98-100 WB–A: 91-97Solve 2-step word problems which involve fraction of a set.TB–A: Unit 3, 101–105 WB–A: 98–109Solve 2-step word problems which involve decimals and fractions.Use bar diagrams to solve word problems involving fractions.-614153845142MaterialsFraction bars and circlesRulers in cm and inchesApples or other objects20 cards with improper fractions and 20 cards with corresponding mixed numbers, per groupPaper platesCoinsMeter stickRuler (12 in.)00MaterialsFraction bars and circlesRulers in cm and inchesApples or other objects20 cards with improper fractions and 20 cards with corresponding mixed numbers, per groupPaper platesCoinsMeter stickRuler (12 in.)45529503843020Vocabularycommon ___ comparisondenominatorequivalentestimation productfractionmixed numbermultiplicationimproper number linenumeratorsimplest formimproper fraction00Vocabularycommon ___ comparisondenominatorequivalentestimation productfractionmixed numbermultiplicationimproper number linenumeratorsimplest formimproper fraction45515289999Teacher Notes00Teacher Notes-61415149073Suggested LiteraturePiece = Part = Portion by Scott GiffordOne Riddle, One Answer by Lauren Thompson00Suggested LiteraturePiece = Part = Portion by Scott GiffordOne Riddle, One Answer by Lauren Thompson-57150209550Number and Operations - Fractions 4.NFExtend understanding of fraction equivalence and ordering. 1. Explain why a fraction a/b is equivalent to a fraction (n × a)/(n × b) by using visual fraction models, with attention to how the number and size of the parts differ even though the two fractions themselves are the same size. Use this principle to recognize and generate equivalent fractions. 2. Compare two fractions with different numerators and different denominators, e.g., by creating common denominators or numerators, or by comparing to a benchmark fraction such as 1/2. Recognize that comparisons are valid only when the two fractions refer to the same whole. Record the results of comparisons with symbols >, =, or <, and justify the conclusions, e.g., by using a visual fraction model. 3. Understand a fraction a/b with a > 1 as a sum of fractions 1/b. a. Understand addition and subtraction of fractions as joining and separating parts referring to the same whole. b. Decompose a fraction into a sum of fractions with the same denominator in more than one way, recording each decomposition by an equation. Justify decompositions, e.g., by using a visual fraction model. Examples: 3/8 = 1/8 + 1/8 + 1/8 ; 3/8 = 1/8 + 2/8 ; 2 1/8 = 1+1 + 1/8 = 8/8 + 8/8 + 1/8. c. Add and subtract mixed numbers with like denominators, e.g., by replacing each mixed number with an equivalent fraction, and/or by using properties of operations and the relationship between addition and subtraction. d. Solve word problems involving addition and subtraction of fractions referring to the same whole and having like denominators, e.g., by using visual fraction models and equations to represent the problem. 4. Apply and extend previous understandings of multiplication to multiply a fraction by a whole number. b. Understand a multiple of a/b as a multiple of 1/b, and use this understanding to multiply a fraction by a whole number. For example, use a visual fraction model to express 3 × (2/5) as 6 × (1/5), recognizing this product as 6/5. (In general, n × (a/b) = (n × a)/b.) c. Solve word problems involving multiplication of a fraction by a whole number, e.g., by using visual fraction models and equations to represent the problem. For example, if each person at a party will eat 3/8 of a pound of roast beef, and there will be 5 people at the party, how many pounds of roast beef will be needed? Between what two whole numbers does your answer lie?00Number and Operations - Fractions 4.NFExtend understanding of fraction equivalence and ordering. 1. Explain why a fraction a/b is equivalent to a fraction (n × a)/(n × b) by using visual fraction models, with attention to how the number and size of the parts differ even though the two fractions themselves are the same size. Use this principle to recognize and generate equivalent fractions. 2. Compare two fractions with different numerators and different denominators, e.g., by creating common denominators or numerators, or by comparing to a benchmark fraction such as 1/2. Recognize that comparisons are valid only when the two fractions refer to the same whole. Record the results of comparisons with symbols >, =, or <, and justify the conclusions, e.g., by using a visual fraction model. 3. Understand a fraction a/b with a > 1 as a sum of fractions 1/b. a. Understand addition and subtraction of fractions as joining and separating parts referring to the same whole. b. Decompose a fraction into a sum of fractions with the same denominator in more than one way, recording each decomposition by an equation. Justify decompositions, e.g., by using a visual fraction model. Examples: 3/8 = 1/8 + 1/8 + 1/8 ; 3/8 = 1/8 + 2/8 ; 2 1/8 = 1+1 + 1/8 = 8/8 + 8/8 + 1/8. c. Add and subtract mixed numbers with like denominators, e.g., by replacing each mixed number with an equivalent fraction, and/or by using properties of operations and the relationship between addition and subtraction. d. Solve word problems involving addition and subtraction of fractions referring to the same whole and having like denominators, e.g., by using visual fraction models and equations to represent the problem. 4. Apply and extend previous understandings of multiplication to multiply a fraction by a whole number. b. Understand a multiple of a/b as a multiple of 1/b, and use this understanding to multiply a fraction by a whole number. For example, use a visual fraction model to express 3 × (2/5) as 6 × (1/5), recognizing this product as 6/5. (In general, n × (a/b) = (n × a)/b.) c. Solve word problems involving multiplication of a fraction by a whole number, e.g., by using visual fraction models and equations to represent the problem. For example, if each person at a party will eat 3/8 of a pound of roast beef, and there will be 5 people at the party, how many pounds of roast beef will be needed? Between what two whole numbers does your answer lie?4648200209550Grade 3 Learner Goals:Compare and order fractions with the same denominator or with the same numerator.Find equivalent fractions and simplest form of a pare and order fractions with different denominators.Recognize and name the fraction of a set.Find the value given the fraction of a set, using objects or drawings.Find the fraction of a set where the answer is a whole number.Add/Subtract like fractions.00Grade 3 Learner Goals:Compare and order fractions with the same denominator or with the same numerator.Find equivalent fractions and simplest form of a pare and order fractions with different denominators.Recognize and name the fraction of a set.Find the value given the fraction of a set, using objects or drawings.Find the fraction of a set where the answer is a whole number.Add/Subtract like fractions.4646295490855Grade 5 Learner Goals:Compare and order fractions with different denominators.Find the fraction of a set where the answer is a whole number or a mixed number.Find fraction of a set for measurements (e.g. 10 minutes as a fraction of one hour).Add/Subtract unlike fractions.Relate division to fractions.Add/subtract mixed numbers.Multiply a fraction by a whole number.Multiply a fraction by a fraction.Divide a fraction by a whole number.Divide a whole number or a fraction by a fraction.Use bar diagrams to solve word problems involving fractions.00Grade 5 Learner Goals:Compare and order fractions with different denominators.Find the fraction of a set where the answer is a whole number or a mixed number.Find fraction of a set for measurements (e.g. 10 minutes as a fraction of one hour).Add/Subtract unlike fractions.Relate division to fractions.Add/subtract mixed numbers.Multiply a fraction by a whole number.Multiply a fraction by a fraction.Divide a fraction by a whole number.Divide a whole number or a fraction by a fraction.Use bar diagrams to solve word problems involving fractions.247512015240GEOMETRY0GEOMETRY4th Grade – Math – Singapore Ch 1 – 1 day, Ch 2 – 2 days, Ch 3 – 2 days,Ch 4 – 2 days, Ch 5 – 1 day, Ch 6 – 1 day, Ch 7 – 1 day, Ch 8 – 1 day, Ch 9 – 2 days, R – 1-2 daysLearner Goals:Singapore Page CitationsDescribe and classify common 3-dimensional shapes according to number and shape of faces, edges, and vertices. Visualize, describe, and draw geometric solids.TB–A: Unit 4, 130-131 WB–A: 146-147Identify acute, obtuse, and right angles and relate 90°, 180°, 270°, and 360° with quarter, half, three-quarter, and whole turns.TB–A: Unit 4, 116-121 WB–A: 123–131Measure and construct angles.Identify perpendicular and parallel lines.TB–A: Unit 4, 116-121 WB–A: 132-139Name different types of triangles and quadrilaterals. Identify attributes of triangles and quadrilaterals.TB–A: Unit 4, 122-127 WB–A: 140-143Find the lengths of unknown sides given the length of other sides or the perimeter of triangles and quadrilaterals.Identify the radius and diameter of a circle, find one given the other.TB–A: Unit 4, 128-129 WB–A: 144-145Identify nets of solids, or solids of nets.TB–A: Unit 4, 132-136 WB–A: 148-15566530483540058Teacher Notes00Teacher Notes-788283540059MaterialsFolding meter stick or 2 strips of cardboard attached with a brad at one endProtractors, compasses, rulers, rulers (cm)Large demonstration protractor or overhead projectorWorksheets with angles to measureWorksheets each with a large rectangle on itSet-squaresSquare grid paper such as cm graph paperScissors, straws, paperclips, string and pinsWorksheet with lines crossing each other some perpendicular to each otherworksheet with various rectilinear figuresworksheets with pairs of lines, some crossing each other, some parallel to each otherPaper for cut-out trianglesPaper circles of various diametersModels of solids – prisms, pyramids, cylindresAppendix pages4.5a-14.9b-14.r00MaterialsFolding meter stick or 2 strips of cardboard attached with a brad at one endProtractors, compasses, rulers, rulers (cm)Large demonstration protractor or overhead projectorWorksheets with angles to measureWorksheets each with a large rectangle on itSet-squaresSquare grid paper such as cm graph paperScissors, straws, paperclips, string and pinsWorksheet with lines crossing each other some perpendicular to each otherworksheet with various rectilinear figuresworksheets with pairs of lines, some crossing each other, some parallel to each otherPaper for cut-out trianglesPaper circles of various diametersModels of solids – prisms, pyramids, cylindresAppendix pages4.5a-14.9b-14.r4587240173355Grade 3 Learner Goals:Describe and classify common 3-dimensional shapes according to number and shape of faces, edges, and vertices. Identify common 3-dimensional shapes within compound shapes.Identify intersecting and parallel lines.Identify and describe polygons.Identify attributes of triangles and quadrilaterals.Identify right angles and compare angles to right angles.00Grade 3 Learner Goals:Describe and classify common 3-dimensional shapes according to number and shape of faces, edges, and vertices. Identify common 3-dimensional shapes within compound shapes.Identify intersecting and parallel lines.Identify and describe polygons.Identify attributes of triangles and quadrilaterals.Identify right angles and compare angles to right angles.-79375173355Measurement and Data 4.MDGeometric measurement: understand concepts of angle and measure angles.5. Recognize angles as geometric shapes that are formed wherever two rays share a common endpoint, and understand concepts of angle measurement:a. An angle is measured with reference to a circle with its center at the common endpoint of the rays, by considering the fraction of the circular arc between the points where the two rays intersect the circle. An angle that turns through 1/360 of a circle is called a “one-degree angle,” and can be used to measure angles.b. An angle that turns through n one-degree angles is said to have an angle measure of n degrees. 6. Measure angles in whole-number degrees using a protractor. Sketch angles of specified measure.7. Measure angles in whole-number degrees using a protractor. Sketch angles of specified measure.Geometry 4.G Draw and identify lines and angles, and classify shapes by properties of their lines and angles.1. Draw points, lines, line segments, rays, angles (right, acute, obtuse), and perpendicular and parallel lines. Identify these in two-dimensional figures. 2. Classify two-dimensional figures based on the presence or absence of parallel or perpendicular lines, or the presence or absence of angles of a specified size. Recognize right triangles as a category, and identify right triangles. 00Measurement and Data 4.MDGeometric measurement: understand concepts of angle and measure angles.5. Recognize angles as geometric shapes that are formed wherever two rays share a common endpoint, and understand concepts of angle measurement:a. An angle is measured with reference to a circle with its center at the common endpoint of the rays, by considering the fraction of the circular arc between the points where the two rays intersect the circle. An angle that turns through 1/360 of a circle is called a “one-degree angle,” and can be used to measure angles.b. An angle that turns through n one-degree angles is said to have an angle measure of n degrees. 6. Measure angles in whole-number degrees using a protractor. Sketch angles of specified measure.7. Measure angles in whole-number degrees using a protractor. Sketch angles of specified measure.Geometry 4.G Draw and identify lines and angles, and classify shapes by properties of their lines and angles.1. Draw points, lines, line segments, rays, angles (right, acute, obtuse), and perpendicular and parallel lines. Identify these in two-dimensional figures. 2. Classify two-dimensional figures based on the presence or absence of parallel or perpendicular lines, or the presence or absence of angles of a specified size. Recognize right triangles as a category, and identify right triangles. -793753949065Vocabularyacute anglecenterendpointmeasurerhombusanglecircleright anglearcrhombiobtuse angledegreeprotractordiametercylinderradiusradiiperpendicularparallelcubesquadrilateraltriangleisoscelesequilateralareascaleneperimeterrectangularprismtriangularpyramidsquarefaceedgeverticesnetset-squareintersectingnon-intersectingparallelogramtrapezoid00Vocabularyacute anglecenterendpointmeasurerhombusanglecircleright anglearcrhombiobtuse angledegreeprotractordiametercylinderradiusradiiperpendicularparallelcubesquadrilateraltriangleisoscelesequilateralareascaleneperimeterrectangularprismtriangularpyramidsquarefaceedgeverticesnetset-squareintersectingnon-intersectingparallelogramtrapezoid46035313886397Suggested LiteratureSir Cumference and the Isle of Inmeter by Cindy NeuschwanderSir Cumference and the Great Knight of Angleland by Cindy NeuschwanderThe Greedy Triangle by Marilyn Burns00Suggested LiteratureSir Cumference and the Isle of Inmeter by Cindy NeuschwanderSir Cumference and the Great Knight of Angleland by Cindy NeuschwanderThe Greedy Triangle by Marilyn Burns45853351287780Grade 5 Learner Goals:Identify attributes of triangles and quadrilaterals.Measure and construct angles.Find unknown angles in figures based on identifying vertical, adjacent, complementary, or supplementary angles.Know and use angle properties of intersecting lines, triangles, parallelograms, rhombuses, and trapezoids to solve problems involving finding find unknown angles. Construct triangles, parallelograms, and rhombuses with specified angles.Visualize, describe, and draw geometric solids.00Grade 5 Learner Goals:Identify attributes of triangles and quadrilaterals.Measure and construct angles.Find unknown angles in figures based on identifying vertical, adjacent, complementary, or supplementary angles.Know and use angle properties of intersecting lines, triangles, parallelograms, rhombuses, and trapezoids to solve problems involving finding find unknown angles. Construct triangles, parallelograms, and rhombuses with specified angles.Visualize, describe, and draw geometric solids.291662215766Area and Perimeter0Area and Perimeter4th Grade – Math – Singapore Ch 1 – 1 day, Ch 2 – 3 days, Ch 3 – 4 days, R – 1-2 daysLearner Goals:Singapore Page CitationsFind the area of shapes by covering them with unit squares or by counting squares.TB-A: Unit 5, 141-144WB-A: 162-164Understand and use units of area, such as square centimeter and square inch.Find the area, perimeter, and unknown sides of rectangles.TB-A: Unit 5, 145-150WB-A: 165-171Find the area and perimeter of composite figures made from squares and rectangles.TB-A: Unit 5, 151-156WB-A: 172-17645872402242820Vocabularyareaperimetersquare unitdimensionwidthlengthmeasurementsquare unitdistancerectanglesquarecomposite figurespath00Vocabularyareaperimetersquare unitdimensionwidthlengthmeasurementsquare unitdistancerectanglesquarecomposite figurespath-788282243061Measurement and Data4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit.3 Apply the area and perimeter formulas for rectangles in real world and mathematical problems. For example, find the width of a rectangular room given the area of the flooring and the length, by viewing the area formula as a multiplication equation with an unknown factor. 00Measurement and Data4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit.3 Apply the area and perimeter formulas for rectangles in real world and mathematical problems. For example, find the width of a rectangular room given the area of the flooring and the length, by viewing the area formula as a multiplication equation with an unknown factor. 4587240183799Suggested Literature00Suggested Literature-78828355863MaterialsSquare grid paper such as centimeter graph paperRectangular cards 8 cm x 5 cm, 6 cm x 3 cm, squares 4 cm x 4 cm for each studentCentimeter graph paperAppendix 5.r00MaterialsSquare grid paper such as centimeter graph paperRectangular cards 8 cm x 5 cm, 6 cm x 3 cm, squares 4 cm x 4 cm for each studentCentimeter graph paperAppendix 5.r4589780232410Teacher Notes00Teacher Notes-79375141605Grade 3 Learner Goals:Find the perimeter of polygons.Find the area of shapes by covering them with unit squares or by counting squares.Understand and use units of area, such as square centimeter and square inch.Count unit cubes in 2-dimensional representations of 3-dimensional solids.00Grade 3 Learner Goals:Find the perimeter of polygons.Find the area of shapes by covering them with unit squares or by counting squares.Understand and use units of area, such as square centimeter and square inch.Count unit cubes in 2-dimensional representations of 3-dimensional solids.4556234141890Grade 5 Learner Goals:Find the area of shapes by covering them with unit squares or by counting squares.Understand and use units of area, such as square centimeter and square inch.Find the area, perimeter, and unknown sides of rectangles.Find the area and perimeter of composite figures made from squares and rectangles.Derive the formula for area of a triangle and find the area of triangles.Derive the formula for area of a parallelogram and find the area of parallelograms.Find the surface area of cubes and rectangular prisms.00Grade 5 Learner Goals:Find the area of shapes by covering them with unit squares or by counting squares.Understand and use units of area, such as square centimeter and square inch.Find the area, perimeter, and unknown sides of rectangles.Find the area and perimeter of composite figures made from squares and rectangles.Derive the formula for area of a triangle and find the area of triangles.Derive the formula for area of a parallelogram and find the area of parallelograms.Find the surface area of cubes and rectangular prisms.291662115766DECIMALS00DECIMALS4th Grade – Math – Singapore Ch 1 – 4 days, Ch 2 – 6 days, Ch 3 – 3 days, Ch 4 – 2 days, R – 1-2daysLearner Goals:Singapore Page CitationsUnderstand tenths, hundredths, thousandths, locate decimal numbers on a number line, compare decimal numbers.TB–B: Unit 6, 8-27 WB–B: 7-33Convert a decimal to a fraction and simplify.Convert a fraction to a decimal number (denominators are a factor of 10, 100, or 1000).Compare and order decimal numbers of up to 3 decimal places and fractions.Round decimal numbers of up to 2 decimal places to the nearest whole number or to 1-decimal place.TB–B: Unit 6, 28-30 WB–B: 34-36Find coin amounts as a fraction of a dollar.50449662168459Vocabularyhundredthcompareequivalentdecimalonestenthdecimal pointroundtenths placethousandthwhole number partfractional partcentimetermillimeterdigitsvaluedotdollarcentsumnumber patternconstant amountnumeratordenominatorsimplest formsimplifyfactorgreatersmallermore/less thanmake 100count onplace valuerenameround up/downhundredth place00Vocabularyhundredthcompareequivalentdecimalonestenthdecimal pointroundtenths placethousandthwhole number partfractional partcentimetermillimeterdigitsvaluedotdollarcentsumnumber patternconstant amountnumeratordenominatorsimplest formsimplifyfactorgreatersmallermore/less thanmake 100count onplace valuerenameround up/downhundredth place-787402190750Number and Operations—Fractions 4.NFUnderstand decimal notation for fractions, and compare decimal fractions.5. Express a fraction with denominator 10 as an equivalent fraction with denominator 100, and use this technique to add two fractions with respective denominators 10 and 100. For example, express 3/10 as 30/100, and add 3/10 + 4/100 = 34/100.6. Use decimal notation for fractions with denominators 10 or 100. For example, rewrite 0.62 as 62/100; describe a length as 0.62 meters; locate 0.62 on a number line diagram. 7. Compare two decimals to hundredths by reasoning about their size. Recognize that comparisons are valid only when the two decimals refer to the same whole. Record the results of comparisons with the symbols >, =, or <, and justify the conclusions, e.g., by using a visual model. Measurement and Data 4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit. 2. Use the four operations to solve word problems involving distances, intervals of time, liquid volumes, masses of objects, and money, including problems involving simple fractions or decimals, and problems that require expressing measurements given in a larger unit in terms of a smaller unit. Represent measurement quantities using diagrams such as number line diagrams that feature a measurement scale.00Number and Operations—Fractions 4.NFUnderstand decimal notation for fractions, and compare decimal fractions.5. Express a fraction with denominator 10 as an equivalent fraction with denominator 100, and use this technique to add two fractions with respective denominators 10 and 100. For example, express 3/10 as 30/100, and add 3/10 + 4/100 = 34/100.6. Use decimal notation for fractions with denominators 10 or 100. For example, rewrite 0.62 as 62/100; describe a length as 0.62 meters; locate 0.62 on a number line diagram. 7. Compare two decimals to hundredths by reasoning about their size. Recognize that comparisons are valid only when the two decimals refer to the same whole. Record the results of comparisons with the symbols >, =, or <, and justify the conclusions, e.g., by using a visual model. Measurement and Data 4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit. 2. Use the four operations to solve word problems involving distances, intervals of time, liquid volumes, masses of objects, and money, including problems involving simple fractions or decimals, and problems that require expressing measurements given in a larger unit in terms of a smaller unit. Represent measurement quantities using diagrams such as number line diagrams that feature a measurement scale.5044966205849MaterialsBase-10 blocksNumber discsFraction squares (Appendix 0.1)CylindersPlace value chartNumber linesFraction cardsRulersPlay moneyTape measuresAppendix 6.r00MaterialsBase-10 blocksNumber discsFraction squares (Appendix 0.1)CylindersPlace value chartNumber linesFraction cardsRulersPlay moneyTape measuresAppendix 6.r141890204952Teacher Notes00Teacher Notes4587766177778Grade 3 Learner Goals:Use decimal notation to add and subtract money within $100.00.Multiply and divide money amounts in decimal notation.00Grade 3 Learner Goals:Use decimal notation to add and subtract money within $100.00.Multiply and divide money amounts in decimal notation.45877653240011Suggested LiteraturePiece = Part = Portion by Scott GiffordOne Riddle, One Answer by Lauren Thompson00Suggested LiteraturePiece = Part = Portion by Scott GiffordOne Riddle, One Answer by Lauren Thompson4587766559872Grade 5 Learner Goals:Understand tenths, hundredths, thousandths, locate decimal numbers on a number line, compare decimal numbers.Convert a decimal to a fraction and simplify.Convert a fraction to a decimal number (denominators are a factor of 10, 100, or 1000).Compare and order decimal numbers of up to 3 decimal places and fractions.Round decimal numbers up to 3 decimal places to the nearest whole number, to 1-decimal place, or to 2-decimal places.Convert fractions to decimals correct to 2-decimal places.00Grade 5 Learner Goals:Understand tenths, hundredths, thousandths, locate decimal numbers on a number line, compare decimal numbers.Convert a decimal to a fraction and simplify.Convert a fraction to a decimal number (denominators are a factor of 10, 100, or 1000).Compare and order decimal numbers of up to 3 decimal places and fractions.Round decimal numbers up to 3 decimal places to the nearest whole number, to 1-decimal place, or to 2-decimal places.Convert fractions to decimals correct to 2-decimal places.231753115766THE FOUR OPERATIONS OF DECIMALS0THE FOUR OPERATIONS OF DECIMALS4th Grade – Math – Singapore Ch 1 – 10 days, Ch 2 – 4 days, Ch 3 – 6 days, R – 1-2 daysLearner Goals:Singapore Page CitationsAdd/Subtract decimal numbers of up to 2 decimal places.TB–B: Unit 7, 35-44 WB–B: 42-53Multiply/Divide decimal numbers of up to 2 decimal places by a whole number.TB–B: Unit 7, 49-64WB–B: 54-56Find the quotient of a division problem correct to 1 decimal place.Use estimation to verify the reasonableness of calculated results in problems involving decimal numbers. throughoutSolve 2-step word problems which involve decimals and fractions.TB–B: Unit 7, 45-48, 65-69WB–B: 54-56, 74-76Use bar diagrams to solve word problems involving decimals.Mentally add/subtract tenths, hundredths, or thousandths to or from decimal numbers.TB–B: Unit 7, 35-44 WB–B: 42-5350449662306123Vocabularyhundredthcompareequivalentdecimaladdtenthdecimal pointroundrenamethousandthvertical formatnumber bondsalignline upsubtract tenthscross outmake 100subtractdifferencewhole numbersmultiplyplace holderrounding offestimatecomparepart-wholeequaldivideequationremainderquotientequal groupsno remainderapproximate00Vocabularyhundredthcompareequivalentdecimaladdtenthdecimal pointroundrenamethousandthvertical formatnumber bondsalignline upsubtract tenthscross outmake 100subtractdifferencewhole numbersmultiplyplace holderrounding offestimatecomparepart-wholeequaldivideequationremainderquotientequal groupsno remainderapproximate-787402311400Number and Operations—Fractions 4.NFUnderstand decimal notation for fractions, and compare decimal fractions.5. Express a fraction with denominator 10 as an equivalent fraction with denominator 100, and use this technique to add two fractions with respective denominators 10 and 100. For example, express 3/10 as 30/100, and add 3/10 + 4/100 = 34/100.6. Use decimal notation for fractions with denominators 10 or 100. For example, rewrite 0.62 as 62/100; describe a length as 0.62 meters; locate 0.62 on a number line diagram. 7. Compare two decimals to hundredths by reasoning about their size. Recognize that comparisons are valid only when the two decimals refer to the same whole. Record the results of comparisons with the symbols >, =, or <, and justify the conclusions, e.g., by using a visual model. Measurement and Data 4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit. 2. Use the four operations to solve word problems involving distances, intervals of time, liquid volumes, masses of objects, and money, including problems involving simple fractions or decimals, and problems that require expressing measurements given in a larger unit in terms of a smaller unit. Represent measurement quantities using diagrams such as number line diagrams that feature a measurement scale.00Number and Operations—Fractions 4.NFUnderstand decimal notation for fractions, and compare decimal fractions.5. Express a fraction with denominator 10 as an equivalent fraction with denominator 100, and use this technique to add two fractions with respective denominators 10 and 100. For example, express 3/10 as 30/100, and add 3/10 + 4/100 = 34/100.6. Use decimal notation for fractions with denominators 10 or 100. For example, rewrite 0.62 as 62/100; describe a length as 0.62 meters; locate 0.62 on a number line diagram. 7. Compare two decimals to hundredths by reasoning about their size. Recognize that comparisons are valid only when the two decimals refer to the same whole. Record the results of comparisons with the symbols >, =, or <, and justify the conclusions, e.g., by using a visual model. Measurement and Data 4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit. 2. Use the four operations to solve word problems involving distances, intervals of time, liquid volumes, masses of objects, and money, including problems involving simple fractions or decimals, and problems that require expressing measurements given in a larger unit in terms of a smaller unit. Represent measurement quantities using diagrams such as number line diagrams that feature a measurement scale.504444092075Suggested LiteraturePiece = Part = Portion by Scott GiffordOne Riddle, One Answer by Lauren Thompson00Suggested LiteraturePiece = Part = Portion by Scott GiffordOne Riddle, One Answer by Lauren Thompson5044440132080MaterialsNumber discsPlace value chartNumber cubesAppendix 7.r00MaterialsNumber discsPlace value chartNumber cubesAppendix 7.r457327062230Grade 3 Learner Goals:Use decimal notation to add and subtract money within $100.00.Multiply and divide money amounts in decimal notation.00Grade 3 Learner Goals:Use decimal notation to add and subtract money within $100.00.Multiply and divide money amounts in decimal notation.14160541910Teacher Notes00Teacher Notes457147486469Grade 5 Learner Goals:Add/Subtract decimal numbers of up to 3 decimal places.Multiply/Divide decimal numbers of up to 2 decimal places by a whole number.Find the quotient of a division problem correct to 2-decimal places.Multiply/Divide decimal number by tens, hundreds, or thousands.Multiply/divide a decimal number by a 2-digit whole number.Multiply/divide a whole number or a decimal by a decimal.Use estimation to verify the reasonableness of calculated results in problems involving decimal numbers. Solve multi-step word problems involving all four operations on whole numbers, fractions, decimals, percentage, and ratios.Use bar diagrams to solve word problems involving decimals.00Grade 5 Learner Goals:Add/Subtract decimal numbers of up to 3 decimal places.Multiply/Divide decimal numbers of up to 2 decimal places by a whole number.Find the quotient of a division problem correct to 2-decimal places.Multiply/Divide decimal number by tens, hundreds, or thousands.Multiply/divide a decimal number by a 2-digit whole number.Multiply/divide a whole number or a decimal by a decimal.Use estimation to verify the reasonableness of calculated results in problems involving decimal numbers. Solve multi-step word problems involving all four operations on whole numbers, fractions, decimals, percentage, and ratios.Use bar diagrams to solve word problems involving decimals.231753115766CONGRUENT AND SYMMETRIC FIGURES0CONGRUENT AND SYMMETRIC FIGURES4th Grade – Math – Singapore Ch 1 – 1 d, Ch 2 – 2 d, Ch 3 – 3 d, Ch 4 – 1 d, R – 1-2 dLearner Goals:Singapore Page CitationsIdentify congruent figures.TB–B: Unit 8, 74-76 WB–B: 83-85Create tessellations.TB–B: Unit 8, 77-80 WB–B: 86-94Identify figures that have line symmetry.TB–B: Unit 8, 81-86 WB–B: 95-100Identify figures that have rotational symmetry.TB–B: Unit 8, 87-88WB–B: 101-788281801626Geometry 4.GDraw and identify lines and angles, and classify shapes by properties of their lines and angles.3. Recognize a line of symmetry for a two-dimensional figure as a line across the figure such that the figure can be folded along the line into matching parts. Identify line-symmetric figures and draw lines of symmetry.00Geometry 4.GDraw and identify lines and angles, and classify shapes by properties of their lines and angles.3. Recognize a line of symmetry for a two-dimensional figure as a line across the figure such that the figure can be folded along the line into matching parts. Identify line-symmetric figures and draw lines of symmetry.50450751801407Vocabularyline of symmetrycorresponding vertices, sides, and anglestessellationstessellatesymmetrysymmetric figuresline symmetrycongruentisosceles trapezoidrotational symmetryvertextwo-dimensional figuretiling patternfold line00Vocabularyline of symmetrycorresponding vertices, sides, and anglestessellationstessellatesymmetrysymmetric figuresline symmetrycongruentisosceles trapezoidrotational symmetryvertextwo-dimensional figuretiling patternfold line-78828203353MaterialsPaper: tracing, grid, construction or colored, plain, square gridPaintCutouts of symmetric figuresMirrorCutout of shapes or pattern blocks of shapesAppendix pages:8.1a-18.2a-18.2b-18.3b-18.4a-18.r00MaterialsPaper: tracing, grid, construction or colored, plain, square gridPaintCutouts of symmetric figuresMirrorCutout of shapes or pattern blocks of shapesAppendix pages:8.1a-18.2a-18.2b-18.3b-18.4a-18.r5044440131445Suggested LiteratureM is For Mirror by Duncan Birmingham00Suggested LiteratureM is For Mirror by Duncan Birmingham5044965254263Grade 3 Learner Goals:00Grade 3 Learner Goals:-79375144780Teacher Notes00Teacher Notes5045075278130Grade 5 Learner Goals:00Grade 5 Learner Goals:233329615766COORDINATE GRAPHS AND CHANGES IN QUANTITIES00COORDINATE GRAPHS AND CHANGES IN QUANTITIES4th Grade – Math – Singapore Ch 1 – 2d, Ch 2 – 1d, Ch 3 -1d, R – 1-2dLearner Goals:Singapore Page CitationsUnderstand the coordinate grid, locate points, and write ordered pairs (first quadrant). Identify ordered pairs of data from a graph.TB–B: Unit 9, 93-95 WB–B: 107-108Find the length of horizontal and vertical lines on the coordinate grid.TB–B: Unit 9, 95-96WB–B: 109-110Use boxes and other symbols to stand for unknown numbers in expressions and equations.TB–B: Unit 9, 97-98WB–B: Use letters to stand for unknown numbers in equations and solve for the unknown numbers using properties of the four operations.TB–B: Unit 8, 98-101WB–B: 111-114Solve word problems involving the functional relationship between two quantities.TB–B: Unit 9, 97-101WB–B:111-114Use and interpret formulas to answer questions about quantities and their relationships.Write simple equations involving related changes in quantities (e.g. y = 3x + 5) and solve for the dependent value when given the independent value. Solve problems involving simple linear functions with whole numbers values, write the equation, and graph the resulting ordered pairs on a grid.50444403393440Vocabularycoordinate gridaxeshorizontal axis originvertical axisordered paircoordinatesrelationshipformulaline segment00Vocabularycoordinate gridaxeshorizontal axis originvertical axisordered paircoordinatesrelationshipformulaline segment-945933362413Operations and Algebraic Thinking 4.OA Generate and analyze patterns.5. Generate a number or shape pattern that follows a given rule. Identify apparent features of the pattern that were not explicit in the rule itself. For example, given the rule “Add 3” and the starting number 1, generate terms in the resulting sequence and observe that the terms appear to alternate between odd and even numbers. Explain informally why the numbers will continue to alternate in this way.00Operations and Algebraic Thinking 4.OA Generate and analyze patterns.5. Generate a number or shape pattern that follows a given rule. Identify apparent features of the pattern that were not explicit in the rule itself. For example, given the rule “Add 3” and the starting number 1, generate terms in the resulting sequence and observe that the terms appear to alternate between odd and even numbers. Explain informally why the numbers will continue to alternate in this way.5041900140970Suggested Literature00Suggested Literature-9459349705MaterialsMapRulersGraph paper for board, large graph paper for boardBlue and red tokenCalendar pageAppendix pages:9.1a-19.3a-19.r00MaterialsMapRulersGraph paper for board, large graph paper for boardBlue and red tokenCalendar pageAppendix pages:9.1a-19.3a-19.r5044440-111125Grade 5 Learner Goals:Understand the coordinate grid, locate points, and write ordered pairs (first quadrant).Identify ordered pairs of data from a graph.Understand the coordinate grid, locate points, and write ordered pairs (all four quadrants).Use letters to stand for unknown numbers in equations and solve for the unknown numbers using properties of the four operations.Solve word problems involving the functional relationship between two quantities.Use and interpret formulas to answer questions about quantities and their relationships.Write simple equations involving related changes in quantities (e.g. y = 3x + 5) and solve for the dependent value when given the independent value. Solve problems involving simple linear functions with whole numbers values, write the equation, and graph the resulting ordered pairs on a grid.00Grade 5 Learner Goals:Understand the coordinate grid, locate points, and write ordered pairs (first quadrant).Identify ordered pairs of data from a graph.Understand the coordinate grid, locate points, and write ordered pairs (all four quadrants).Use letters to stand for unknown numbers in equations and solve for the unknown numbers using properties of the four operations.Solve word problems involving the functional relationship between two quantities.Use and interpret formulas to answer questions about quantities and their relationships.Write simple equations involving related changes in quantities (e.g. y = 3x + 5) and solve for the dependent value when given the independent value. Solve problems involving simple linear functions with whole numbers values, write the equation, and graph the resulting ordered pairs on a grid.-78740-113030Grade 3 Learner Goals:Use boxes and other symbols to stand for unknown numbers in expressions and equations.00Grade 3 Learner Goals:Use boxes and other symbols to stand for unknown numbers in expressions and equations.-7882879222Teacher Notes00Teacher Notes236476215240DATA ANALYSIS AND PROBABILITY00DATA ANALYSIS AND PROBABILITY4th Grade – Math – Singapore Ch 1 – 2d, Ch 2 – 1d, Ch 3 -1d, Ch 4 – 1d, Ch 5 – 1d, R – 1-2dLearner Goals:Singapore Page CitationsCollect, organize, and analyze data using tables, bar graphs tally charts, and line plots.TB–B: Unit 10, 106-111, 116-118WB–B: 121-126, 129-130Ask and solve questions related to data representation, including finding the range and mode. TB–B: Unit 10, 106-111, 116-118,119-121WB–B: 121-126, 129-130, 131-136Collect, organize, and analyze data using line graphs and coordinate graphs.TB–B: Unit 10, 119-121WB–B:131-136Identify the mode and median of categorical data.TB–B: Unit 10, 106-111 WB–B: 121-126Represent all possible outcomes for simple probability experiments.TB–B: Unit 10, 112-115WB–B: 125-128Express all possible outcome of experimental probability situations verbally and numerically and as fractions.50444402371725Vocabularyanalyzeorganizeline plotmedianmodebar graphtally charttableprobabilityoutcomepossible outcomesline graphrangedatatree diagram00Vocabularyanalyzeorganizeline plotmedianmodebar graphtally charttableprobabilityoutcomepossible outcomesline graphrangedatatree diagram-788282369185Measurement and Data 4.MD Represent and interpret data.4. Make a line plot to display a data set of measurements in fractions of a unit (1/2, 1/4, 1/8). Solve problems involving addition and subtraction of fractions by using information presented in line plots. For example, from a line plot find and interpret the difference in length between the longest and shortest specimens in an insect collection. 00Measurement and Data 4.MD Represent and interpret data.4. Make a line plot to display a data set of measurements in fractions of a unit (1/2, 1/4, 1/8). Solve problems involving addition and subtraction of fractions by using information presented in line plots. For example, from a line plot find and interpret the difference in length between the longest and shortest specimens in an insect collection. 504126577470Suggested Literature00Suggested Literature-78828125577MaterialsRulersCoinsSpinnersGraph paperAppendix pages:10.5a-110.r00MaterialsRulersCoinsSpinnersGraph paperAppendix pages:10.5a-110.r5044966192361Teacher Notes00Teacher Notes5044440-103505Grade 5 Learner Goals:Ask and solve questions related to data representation, including finding the range and mode.Collect, organize, and analyze data using line plots.Collect, organize, and analyze data using line graphs.Collect, organize, and analyze data using coordinate graphs.Collect, organize and display data in pie charts.Collect, organize and display data in histograms.Find the average of a set of data.Find a data value given the average and the other values.Understand, find, and compare mean, median, and mode of a set of data.00Grade 5 Learner Goals:Ask and solve questions related to data representation, including finding the range and mode.Collect, organize, and analyze data using line plots.Collect, organize, and analyze data using line graphs.Collect, organize, and analyze data using coordinate graphs.Collect, organize and display data in pie charts.Collect, organize and display data in histograms.Find the average of a set of data.Find a data value given the average and the other values.Understand, find, and compare mean, median, and mode of a set of data.-78828-126123Grade 3 Learner Goals:Collect, organize, and analyze data using tables and bar graphs.Collect, organize, and analyze data using tally charts.Ask and solve questions related to data representation, including finding the range and mode.Collect, organize, and analyze data using line plots.Identify whether common events are certain, likely, unlikely, or impossible.Record the possible outcomes for a simple event and systematically keep track of the outcome when it is repeated many times.Summarize and display results of simple probability experiments, use the results to predict future events.00Grade 3 Learner Goals:Collect, organize, and analyze data using tables and bar graphs.Collect, organize, and analyze data using tally charts.Ask and solve questions related to data representation, including finding the range and mode.Collect, organize, and analyze data using line plots.Identify whether common events are certain, likely, unlikely, or impossible.Record the possible outcomes for a simple event and systematically keep track of the outcome when it is repeated many times.Summarize and display results of simple probability experiments, use the results to predict future events.2490930-525MEASURE AND VOLUME00MEASURE AND VOLUME4th Grade – Math – Singapore Ch 1 – 2d, Ch 2 – 1d, Ch 3 – 2d, Ch 4 – 1d, Ch 5 – 4d, R – 1-2dLearner Goals:Singapore Page CitationsFind the volume of solid figures by counting cubic units.TB–B: Unit 11, 137-139WB–B: 150Understand and use units of volume, such as cubic centimeter and cubic inch.Find the volume of rectangular prisms.TB–B: Unit 11, 140-144WB–B:151-154Understand the relationship between cubic centimeters, milliliters, and liters.TB–B: Unit 11, 144 WB–B: 153-154Add/subtract measurements in compound units.TB–B: Unit 11, 128-130WB–B: 144-145Multiply/divide measurements in compound units.TB–B: Unit 11, 131-134WB–B: 146-149Convert between of units of time.TB–B: Unit 11, 129-130WB–B: 144-145-788282558371MaterialsConnect-a-cubes of different colorsBase-10 blocksRectangular tanks (plastic)Plastic cupsStrawsA4-size papersRolls of sticky tapeMeter sticks, yard sticks, rulersAppendix pages:0.211.5c-111.5d-111.r00MaterialsConnect-a-cubes of different colorsBase-10 blocksRectangular tanks (plastic)Plastic cupsStrawsA4-size papersRolls of sticky tapeMeter sticks, yard sticks, rulersAppendix pages:0.211.5c-111.5d-111.r50449662558371Vocabularymeasurelengthwidthcapacitylitermilliliterkilogramkilometermetercentimetergallonquartpintgramcubic unitvolumecubic centimeterrectangular prismcubic metercompound units1-digit number00Vocabularymeasurelengthwidthcapacitylitermilliliterkilogramkilometermetercentimetergallonquartpintgramcubic unitvolumecubic centimeterrectangular prismcubic metercompound units1-digit number5040630222885Suggested LiteratureHow Big is a Foot? By Rolf MyllerJim and the Beanstalk by Raymond Briggs00Suggested LiteratureHow Big is a Foot? By Rolf MyllerJim and the Beanstalk by Raymond Briggs504444019685Grade 5 Learner Goals:Understand and use units of volume, such as cubic centimeter and cubic inch.Find the volume of rectangular prisms.Find the side of a rectangular prism given the volume and two sides or area of one side.Understand the relationship between cubic centimeters, milliliters, and liters.Solve problems involving the change in height of liquids and volume of liquids in rectangular tanks, including rate problems.Convert fractional measurements to a different unit or a compound unit, within a measuring system.Convert units involving decimals within a measuring system.Convert between of units of time.00Grade 5 Learner Goals:Understand and use units of volume, such as cubic centimeter and cubic inch.Find the volume of rectangular prisms.Find the side of a rectangular prism given the volume and two sides or area of one side.Understand the relationship between cubic centimeters, milliliters, and liters.Solve problems involving the change in height of liquids and volume of liquids in rectangular tanks, including rate problems.Convert fractional measurements to a different unit or a compound unit, within a measuring system.Convert units involving decimals within a measuring system.Convert between of units of time.-787406985Grade 3 Learner Goals:Find the volume of solid figures by counting cubic units.Count unit cubes in 2-dimensional representations of 3-dimensional solids.Add/subtract measurements in compound units.Convert between of units of time.00Grade 3 Learner Goals:Find the volume of solid figures by counting cubic units.Count unit cubes in 2-dimensional representations of 3-dimensional solids.Add/subtract measurements in compound units.Convert between of units of time.-78740292735Measurement and Data 4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit.1. Know relative sizes of measurement units within one system of units including km,m, cm; kg, g; lb, oz.; l, ml; hr, min, sec. Within a single system of measurement, express measurements in a larger unit in terms of a smaller unit. Record measurement equivalents in a two- column table. For example, know that 1 ft is 12times as long as 1 in. Express the length of a 4 ft snake as 48 in. Generate a conversion table for feet and inches listing the number pairs (1, 12), (2, 24), (3, 36), ...2. Use the four operations to solve word problems involving distances, intervals of time, liquid volumes, masses of objects, and money, including problems involving simple fractions or decimals, and problems that require expressing measurementsgiven in a larger unit in terms of a smaller unit. Represent measurement quantities using diagrams such as number line diagrams that feature a measurement scale. 00Measurement and Data 4.MD Solve problems involving measurement and conversion of measurements from a larger unit to a smaller unit.1. Know relative sizes of measurement units within one system of units including km,m, cm; kg, g; lb, oz.; l, ml; hr, min, sec. Within a single system of measurement, express measurements in a larger unit in terms of a smaller unit. Record measurement equivalents in a two- column table. For example, know that 1 ft is 12times as long as 1 in. Express the length of a 4 ft snake as 48 in. Generate a conversion table for feet and inches listing the number pairs (1, 12), (2, 24), (3, 36), ...2. Use the four operations to solve word problems involving distances, intervals of time, liquid volumes, masses of objects, and money, including problems involving simple fractions or decimals, and problems that require expressing measurementsgiven in a larger unit in terms of a smaller unit. Represent measurement quantities using diagrams such as number line diagrams that feature a measurement scale. 50449661116418Teacher Notes00Teacher Notes ................
................

In order to avoid copyright disputes, this page is only a partial summary.

Google Online Preview   Download