Title 21A - ZONING (21A.01 Through 21A.06)



Title 21AzoningUPDATED: November 5, 2024Chapters: TOC \o "1-3" \n \h \z \u 21A.01ZONING CODE ADOPTION21A.02AUTHORITY, PURPOSE, INTERPRETATION AND ADMINISTRATION21A.04ZONES, MAPS AND DESIGNATIONS21A.06TECHNICAL TERMS AND LAND USE DEFINITIONS21A.08PERMITTED USES21A.12DEVELOPMENT STANDARDS - DENSITY AND DIMENSIONS21A.14DEVELOPMENT STANDARDS - DESIGN REQUIREMENTS21A.16DEVELOPMENT STANDARDS - LANDSCAPING AND WATER USE21A.18DEVELOPMENT STANDARDS - PARKING AND CIRCULATION21A.20DEVELOPMENT STANDARDS - SIGNS21A.22DEVELOPMENT STANDARDS - MINERAL EXTRACTION21A.23SEA LEVEL RISE RISK AREA21A.24CRITICAL AREAS (Formerly Environmentally Sensitive Areas)21A.25SHORELINES21A.26DEVELOPMENT STANDARDS - COMMUNICATION FACILITIES21A.27DEVELOPMENT STANDARDS - MINOR COMMUNICATION FACILITIES21A.28DEVELOPMENT STANDARDS - ADEQUACY OF PUBLIC FACILITIES AND SERVICES21A.30DEVELOPMENT STANDARDS - ANIMALS, HOME OCCUPATION, HOME INDUSTRY21A.32GENERAL PROVISIONS - NONCONFORMANCE, TEMPORARY USES, AND RE-USE OF FACILITIES21A.34GENERAL PROVISIONS - RESIDENTIAL DENSITY INCENTIVES21A.37GENERAL PROVISIONS - TRANSFER OF DEVELOPMENT RIGHTS (TDR)21A.38GENERAL PROVISIONS - PROPERTY-SPECIFIC DEVELOPMENT STANDARDS/SPECIAL DISTRICT OVERLAYS21A.39GENERAL PROVISIONS - URBAN PLANNED DEVELOPMENTS21A.40APPLICATION REQUIREMENTS/NOTICE METHODS21A.41COMMERCIAL SITE DEVELOPMENT PERMITS21A.42REVIEW PROCEDURES/NOTICE REQUIREMENTS21A.43IMPACT FEES21A.44DECISION CRITERIA21A.45HOMELESS ENCAMPMENTS21A.48INCLUSIONARY HOUSING21A.49DEMONSTRATION OF FINANCIAL RESPONSIBILITY21A.50ENFORCEMENT21A.55DEMONSTRATION PROJECTS21A.60URBAN DESIGN STANDARDS - NORTH HIGHLINE21A.01ZONING CODE ADOPTIONSections:21A.01.010Adoption and transference.21A.01.020Zoning code adopted.21A.01.025Notification to Tribes.21A.01.030Application of the 1993 Zoning Code.21A.01.040Transition to new code.21A.01.045Relationship to certain adopted 1994 development regulations.21A.01.050Tree retention and landscaping (Ch. 21A.16) effective date.21A.01.070Area zoning conversion guidelines.21A.01.090Drawings.21A.01.100Periodic review.21A.01.010 Adoption and transference. Pursuant to the requirement of King County Charter Section 880, there is adopted Title 21A of the "King County code" as compiled by the King County council. K.C.C. Chapter 21A.61A of the code is hereby transferred to Title 27. K.C.C. Sections 21A.61.060, .070 are hereby transferred to Title 20. (Ord. 10870 § 1, 1993).21A.01.020 Zoning code adopted. Under the provisions of Article XI, Section 11 of the Washington State Constitution and Article 2, Section 220.20 of the King County Charter, the zoning code attached to Ordinance 10870, which is referred to hereinafter as the 1993 Zoning Code, is adopted and declared to be the zoning code for King County until amended, repealed or superseded, subject to the provisions of K.C.C. 21A.01.030. This code also is hereby enacted to be consistent with and implement the comprehensive plan in accordance with RCW 36.70A. This code shall be compiled in Title 21A. (Ord. 11621 § 1 (part), 1994: Ord. 10870 § 2, 1993).21A.01.025 Notification to Tribes. The county recognizes that many actions undertaken pursuant to Title 21A, as amended, may impact treaty fishing rights of federally-recognized tribes. In order to honor and prevent interference with these treaty fishing rights and to provide for water quality and habitat preservation, the county shall provide notice to any federally-recognized tribes whose treaty fishing rights would be affected by an action undertaken pursuant to this title, including but not limited to: development of wetlands, stream and river banks, lakeshore habitat of water bodies, or development directly or indirectly affecting anadromous bearing water bodies, including the promulgation of plans, rules, regulations or ordinances implementing the provisions of this title, whether or not review of such actions is required under the State Environmental Policy Act (SEPA) RCW 43.21C. (Ord. 11621 § 1 (part), 1994).21A.01.030 Application of the 1993 Zoning Code.A. Except as provided in subsection C below, the 1993 Zoning Code shall apply to a specific property when, after the June 28, 1993, the zoning map with respect to such property is amended pursuant to: 1. an individual quasi-judicial zone reclassification; 2. countywide zoning conversion process set out in K.C.C. 21A.01.070; or 3. community planning area zoning proposals accompanying plan updates or amendment studies.B. Any reclassification requests or proposals for application of area or countywide zoning initiated after June 28, 1993, shall use the new zone classifications adopted in the 1993 Zoning Code.C. The provisions of King County Code Chapter 21A.24, together with the relevant provisions of Chapters 21A.06 and 21A.12, shall apply to all properties as of January 9, 1994. (Ord. 11621 § 2, 1994: 10870 § 3, 1993).21A.01.040 Transition to new code.A. Complete applications for conditional use permits, planned unit developments, binding site plans, right-of-way use permits, commercial site development permits, variances, unclassified use permits, or public agency and utility exceptions which were pending at the time Title 21A took effect shall continue to be processed under those applicable zoning regulations governing review prior to implementation of Title 21A; except when a conditional use permit application has been submitted for a use that under Title 21A no longer requires a conditional use permit, that conditional use permit shall not be a requirement for the vested development proposal. Notwithstanding any contrary provisions in this title, where approved, these permits shall continue to establish allowable uses on the property until permit expiration. A variance to Title 21 standards which has been approved and has not expired shall be deemed to also vary like standards set forth in Title 21A relating to the same subject matter and development proposal. Planned unit development applications pending on October 1, 1994 shall be deemed to have vested at the time a complete application was filed. Nothing in this subsection is intended to restrict otherwise applicable vested applicant rights.B. Except for the requirements of K.C.C. 21A.43, any lot created by subdivision or short subdivision for which a complete subdivision or short subdivision application was submitted prior to February 2, 1995, may be developed pursuant to the standards of Resolution 25789, as amended (former K.C.C. Title 21), including any applicable p-suffix conditions in adopted community plans and area zoning in effect on February 1, 1995 for a period of six years from the date of recording of the applicable final plat or short plat. (Ord. 12824 § 19, 1997: Ord. 11765 § 1, 1995: Ord. 11621 § 3, 1994: 10870 § 4, 1993).21A.01.045 Relationship to certain adopted 1994 development regulations.A. The King County Council makes the following findings of fact: 1. On December 19, 1994, the King County Council adopted Ordinance 11618, 11619, and 11620 amending Title 16 of the King County Code. The effective date of Ordinance 11618, 11619, and 11620 is January 9, 1995. 2. In drafting Ordinance 11618, 11619, and 11620, the references to the King County Zoning Code were amended to cite K.C.C. Title 21A, the new zoning code, and at the same time repeal references to K.C.C. Title 21, the old zoning code. This was done in anticipation that Proposed Ordinance 94-737, which adopts new zoning to implement the 1994 Comprehensive Plan and Title 21A, adopted would be on December 19, 1994 concurrent with Ordinance 11618, 11619, and 11620. Thus, K.C.C. Title 21A would become effective on the same date as Ordinance 11618, 11619, and 11620 [January 9, 1995]. 3. However, on December 19, 1994 the King County Council deferred action on Proposed Ordinance 94-737 until January 3, 1995. On January 3, 1995 the action was again deferred to January 9, 1995. As a result of deferring action on Proposed Ordinance 94-737, K.C.C. 21A will not go into effect until some time after January 9, 1995. 4. The problem created by the actions described above is that Ordinance 11618, 11619, and 11620 will go into effect with references to zoning code requirements (K.C.C. Title 21A) that will not be in effect until the adoption and effective date [February 2, 1995] of Proposed Ordinance 94-737. Additionally, the references to the existing zoning code (K.C.C. Title 21) are repealed in Ordinance 11618, 11619, and 11620. As a result, development applications filed between January 9, 1995, and February 2, 1995, may vest to land use controls that will not include either existing Title 21 or the new Title 21A regulations. Such development may not provide protection for, and be harmful to, the public health, safety and welfare which Title 21 and 21A were adopted to address.B. Ordinance 11618, 11619, and 11620 shall not take effect, or if in effect shall no longer be in effect, until King County adopts zoning to implement the 1994 King county Comprehensive Plan and to convert zoning to Title 21A (Proposed Ordinance 94-737) and such zoning becomes effective. Prior to January 9, 1995, provisions of law in effect prior to the adoption of January 9, 1995, shall remain in effect until Ordinance 11618, 11619, and 11620 is in effect under the provisions of this section. (Ord. 11652 § 1-2, 1995). 21A.01.050 Tree retention and landscaping effective date. Chapter 21A.16 (Tree Retention and Landscaping) shall be effective as part of the 1993 Zoning Code only if at the time of the adoption of the first area zoning map conversion a new landscaping chapter has not been adopted, in which case chapter 21A.16 will apply in that area until a revised chapter is adopted. (Ord. 10870 § 9, 1993).21A.01.070 Area zoning conversion guidelines.A. The council directs the department to prepare proposed new zoning maps applying the 1993 King County Zoning Code and transmit within ten months of June 28, 1993, for council review and adoption.B. The department shall use the table in subsection C. of this section and the guidelines of this section in preparing an ordinance or ordinances to convert each area zoning document to the 1993 Zoning Code, with modifications appropriate to be consistent with the Comprehensive Plan land use map and policies, so as to implement the Comprehensive Plan and convert old outright and potential zoning classifications to new ones in a consistent manner. This section also shall apply to conversion of the resource lands area zoning adopted pursuant to K.C.C. 20.12.390.C. Conversion table. The following conversion table and criteria contained therein shall be used by the department in converting the zoning maps adopted pursuant to Resolution 25789 to the 1993 Zoning Code:RESOLUTION 25789 ZONING MAP SYMBOLS1993 ZONING CODEMAP SYMBOLSADDITIONAL CRITERIAFFIn Forest Production or Rural AreasFRF or RAUse zone most consistent with the Comprehensive PlanA, A-10A-35A-10A-35 or A-60In Agricultural or Rural AreasUse zone most consistent with the Comprehensive PlanQ-MMDesignated Mining SitesAR-2.5AR-5AR-10RA-2.5RA-5RA-10 or RA-20In Rural AreasUse zone most consistent with the Comprehensive PlanGR-5, GR-2.5, G-5URRA Only in designated urban areas In areas not designated urbanGR-1RAOnly in designated urban areasIn areas not designated urbanSE, S-CR-1Only in designated urban areas or Rural TownsSR/RS15000,SR/RS9600R-4Only in designated urban areas or Rural TownsSR7200, RS7200R-6Only in designated urban areas or Rural TownsSR5000, RS5000R-8Only in designated urban areas or Rural TownsRMHPR-4 through R-48Use zone closest to zoning on adjacent property or midrange if adjacent zones varyRD3600, RT3600R-12RM2400, RT2400R-18RT, RM1800, RT1800R-24RM900O or R-48Apply zoning closest to Comprehensive Plan land use designationsRM 900 PO or R-48According to P-suffix limitations allowing only office or residential usesB-N, BR-NNB or RBB-C, BR-CC-GM-L, M-P, M-HCB or RBRBIFor all business zones, use zone most consistent with the Comprehensive Plan designation and actual scale of business areaD. Unclassified Use Permit Mining Operations. In addition to the conversions set out in the table in subsection C. of this section, all sites legally operating pursuant to an unclassified use permit for mining operations shall be zoned M (Mineral).E. Resolution of map conflicts. In cases of ambiguity or conflict between a community or Comprehensive Plan land use designation and the zoning classification applied under the old code, the department shall use the following guidelines and procedures in recommending new zones: 1. As a general rule, the outright or potential zoning classification applied shall be that which is consistent with the 1994 King County Comprehensive Plan; adopted community plans, where they do not conflict, may be used to provide additional guidance; 2. If the application of the guidelines in this subsection leads the department to propose applying an outright or potential zoning classification from the 1993 Zoning Code that is not functionally equivalent to a classification from the old code as defined in the table in subsection C. of this section, the department shall notify the owner of the property proposed for reclassification no later than the council introduction date of the ordinance amending said property, and the property owner may request a change in the area zoning in a manner consistent with the procedures used for council review of a community plan and area zoning.F. Area-wide P-suffix development conditions. The department shall review all area-wide P-suffix conditions applied through zoning adopted pursuant to Resolution 25789, and recommend legislation removing all such conditions which conflict with the Comprehensive Plan or have been replaced adequately by standards adopted in the 1993 zoning code. If P-suffix conditions implement policies in the Comprehensive Plan, then regulations shall be developed by the end of 1995 and the P-suffix conditions shall be removed. Any P-suffix conditions which implement policies in community plans which are not in conflict with the Comprehensive Plan but are not adequately addressed by this code shall be carried forward intact until they are evaluated for replacement by general code revisions in 1995.G. Site-specific development conditions. Approval conditions for previous zone reclassifications, planned unit developments, unclassified permits, and P-suffix conditions applied to individual properties in land use actions pursuant to Resolution 25789, should be recommended for retention wherever they address conditions unique to a particular property and not addressed by the standards in the Zoning Code.H. For area zoning documents being converted to the 1993 Zoning Code without amendments to their respective community plan maps and policies, only requests for zone changes which meet one of the following criteria shall be considered during either the department or council review process: 1. As provided in subsection E. of this section; 2. When an applicant can demonstrate that the department's proposal incorrectly implements an adopted Comprehensive Plan map designation or policy in converting existing zoning to a new zoning classification; or 3. The site is the subject of an application for a Master Planned Development or Urban Planned Development, and conversion to the 1993 Zoning Code is requested as part of such application. Rezoning of such sites during the conversion, area zoning otherwise shall be to Urban Reserve with the urban planned development overlay district as provided in K.C.C. chapter 21A.38.I. Requests which do not meet one of the criteria of subsection H. of this section shall be treated as quasi-judicial reclassification requests which must be formally applied for according to the process provided for such requests and shall be subject to the criteria in K.C.C. 20.22.150.J. Requests for quasi-judicial reclassification that are consistent with the conversion table illustrated in subsection C. of this section and requests for quasi-judicial reclassification to the M zone, shall not be subject to the criteria in K.C.C. 20.22.150.K. Bear Creek MPD's. The following transition provisions shall apply to the Master Plan Development applications in the Bear Creek Community Plan (BCCP). 1. An applicant may either continue to utilize the procedural provisions of the BCCP or may utilize the procedural provisions of K.C.C. chapter 21A.39. 2. If an applicant utilizes the procedural provisions of K.C.C. 21A.39, the Pre-Development Applications previously submitted for the Blakely Ridge MPD and the Northridge MPD are deemed the equivalent of and accepted as complete applications for "UPD Permits" under Chapter 21A.39 of the 1993 zoning code. 3. The substantive provisions of the BCCP Area Zoning MPD P-Suffix conditions and conditions precedent to rezoning set forth in Section 1C of the BCCP Area Zoning (page 140) shall remain in effect for purposes of considering the UPD applications, under either the BCCP or K.C.C. chapter 21A.39. 4. The applicants may elect either one base zone pursuant to K.C.C. 21A.39, or multiple zones pursuant to the Bear Creek Community Plan, applying the equivalent zone and potential zoning classifications of the 1993 zoning code. 5. The Novelty Hill Master Plan sites and urban designation adopted and delineated in the Bear Creek Community Plan and Bear Creek Area zoning shall be considered "UPD Special District Overlays" and "UPD boundary delineations" for purposes of applying K.C.C. 21A.38.020, 21A.38.070B.1. and 2. and K.C.C. 21A.39.020. (Ord. 19146 § 15, 2020: Ord. 18230 § 124, 2016: Ord. 11621 § 5, 1994: Ord. 11157 § 1, 1993: Ord. 10870 § 5, 1993).21A.01.090 Drawings. The department is hereby authorized after June 7, 1993, to incorporate drawings as necessary for the purpose of illustrating concepts and regulatory standards contained in this title, provided that the adopted provisions of the code shall control over such drawings. (Ord. 10870 § 7, 1993).21A.01.100 Periodic review. The department shall submit an annual written report to the council detailing issues relating to the implementation of the 1993 King County Zoning Code and recommending amendments to address those issues. (Ord. 10870 § 8, 1993).21A.02AUTHORITY, PURPOSE, INTERPRETATION AND ADMINISTRATIONSections:21A.02.010Title.21A.02.020Authority to adopt code.21A.02.030Purpose.21A.02.040Conformity with this title required.21A.02.050Minimum requirements.21A.02.055Covenant of retention of common ownership for lots considered as a site.21A.02.060Interpretation: General.21A.02.070Interpretation: Standard industrial classification.21A.02.080Interpretation: Zoning maps.21A.02.090Administration and review authority.21A.02.110Classification of right-of-way.21A.02.010 Title. This title shall be known as the King County Zoning Code. (Ord. 15051 § 1, 2004: Ord. 10870 § 11, 1993).21A.02.020 Authority to adopt code. The King County Zoning Code is adopted by King County ordinance, pursuant to Article XI, Section 11 of the Washington State Constitution; and Article 2, Section 220.20 of the King County Charter. (Ord. 10870 § 12, 1993).21A.02.030 Purpose. The general purposes of this title are:A. To encourage land use decision making in accordance with the public interest and applicable laws of the State of Washington.B. To protect the general public health, safety, and welfare;C. To implement the King County Comprehensive Plan's policies and objectives through land use regulations;D. To provide for the economic, social, and aesthetic advantages of orderly development through harmonious groupings of compatible and complementary land uses and the application of appropriate development standards;E. To provide for adequate public facilities and services in conjunction with development; andF. To promote general public safety by regulating development of lands containing physical hazards and to minimize the adverse environmental impacts of development. (Ord. 10870 § 13, 1993).21A.02.040 Conformity with this title required.A. No development, use or structure shall be established, substituted, expanded, constructed, altered, moved, maintained, or otherwise changed except in conformance with this title.B. Creation of or changes to lot lines shall conform with the use provisions, dimensional and other standards, and procedures of this title and Title 19, Subdivisions.C. All land uses and development authorized by this title shall comply with all other regulations and or requirements of this title as well as any other applicable local, state or federal law. Where a difference exists between this title and other county regulations, the more restrictive requirements shall apply.D. Where more than one part of this title applies to the same aspect of a proposed use or development, the more restrictive requirement shall apply.E. Temporary uses or activities, conducted during an emergency event, or training exercises conducted at emergency sites, designated pursuant to an emergency management plan, shall not be subject to the provisions of this title. (Ord. 16985 § 126, 2010: Ord. 11621 § 8, 1994: 10870 § 14, 1993).21A.02.050 Minimum requirements. In interpretation and application, the requirements set forth in this title shall be considered the minimum requirements necessary to accomplish the purposes of this title. (Ord. 10870 § 15, 1993).21A.02.055 Covenant of retention of common ownership for lots considered as a site.If a development proposal depends on two or more lots to be considered as a site for purposes of complying with the provisions of this title or any other provision of the King County Code, the department may require the applicant to record a covenant to the benefit of the county that requires the retention of the lots under common ownership and control for the duration that the use is maintained on the site. (Ord. 17191 § 18, 2011).21A.02.060 Interpretation: General.A. In case of inconsistency or conflict, regulations, conditions or procedural requirements that are specific to an individual land use shall supersede regulations, conditions or procedural requirements of general application.B. A land use includes the necessary structures to support the use unless specifically prohibited or the context clearly indicates otherwise.C. In case of any ambiguity, difference of meaning, or implication between the text and any heading, caption, or illustration, the text and the permitted use tables in K.C.C. 21A.08 shall control. All applicable requirements shall govern a use whether or not they are cross-referenced in a text section or land use table.D. Unless the context clearly indicates otherwise, words in the present tense shall include past and future tense, and words in the singular shall include the plural, or vice versa. Except for words and terms defined in this title, all words and terms used in this title shall have their customary meanings. (Ord. 10870 § 16, 1993).21A.02.070 Interpretation: Standard industrial classification.A. All references to the Standard Industrial Classification (SIC) are to the titles and descriptions found in the Standard Industrial Classification Manual, 1987 edition, prepared by United States Office of Management and Budget which is hereby adopted by reference. The (SIC) is used, with modifications to suit the purposes of this title, to list and define land uses authorized to be located in the various zones consistent with the comprehensive plan land use map.B. The SIC categorizes each land use under a general two-digit major group number, or under a more specific three- or four-digit industry group or industry number. A use shown on a land use table with a two-digit number includes all uses listed in the SIC for that major group. A use shown with a three-digit or four-digit number includes only the uses listed in the SIC for that industry group or industry.C. An asterisk (*) in the SIC number column of a land use table means that the SIC definition for the specific land use identified has been modified by this title. The definition may include one or more SIC subclassification numbers, or may define the use without reference to the SIC. D. The Director shall determine whether a proposed land use not specifically listed in a land use table or specifically included within a SIC classification is allowed in a zone. The director's determination shall be based on whether or not permitting the proposed use in a particular zone is consistent with the purposes of this title and the zone's purpose as set forth in K.C.C. 21A.04, by considering the following factors: 1. The physical characteristics of the use and its supporting structures, including but not limited to scale, traffic and other impacts, and hours of operation; 2. Whether or not the use complements or is compatible with other uses permitted in the zone; and 3. The SIC classification, if any, assigned to the business or other entity that will carry on the primary activities of the proposed use. (Ord. 11621 § 7, 1994: 10870 § 17, 1993).21A.02.080 Interpretation: Zoning maps. Where uncertainties exist as to the location of any zone boundaries, the following rules of interpretation, listed in priority order, shall apply:A. Where boundaries are indicated as paralleling the approximate centerline of the street right-of-way, the zone shall extend to each adjacent boundary of the right-of-way. Non road-related uses by adjacent property owners, if allowed in the right-of-way, shall meet the same zoning requirements regulating the property owners lot;B. Where boundaries are indicated as approximately following lot lines, the actual lot lines shall be considered the boundaries;C. Where boundaries are indicated as following lines of ordinary high water, or government meander line, the lines shall be considered to be the actual boundaries. If these lines should change the boundaries shall be considered to move with them; andD. If none of the rules of interpretation described in subparagraphs A. through C. apply, then the zoning boundary shall be determined by map scaling. (Ord. 10870 § 18, 1993).21A.02.090 Administration and review authority.A. The hearing examiner in accordance with K.C.C. chapter 20.22 may hold public hearings and make decisions and recommendations on reclassifications, subdivisions and other development proposals, and appeals.B. The director may grant, condition or deny applications for variances, conditional use permits, renewals of permits for mineral extraction and processing, alteration exceptions and other development proposals, unless an appeal is filed and a public hearing is required under K.C.C. chapter 20.20, in which case this authority shall be exercised by the hearing examiner.C. The department shall have authority to grant, condition or deny commercial and residential building permits, grading and clearing permits, and temporary use permits in accordance with the procedures in K.C.C. chapter 21A.42.D. Except for other agencies with authority to implement specific provisions of this title, the department shall have the sole authority to issue official interpretations and adopt public rules to implement this title, in accordance with K.C.C. chapter 2.98. (Ord. 18230 § 125, 2016: Ord. 15051 § 2, 2004: Ord. 10870 § 19, 1993).21A.02.110 Classification of right-of-way.A. Except when such areas are specifically classified on the zoning map as being classified in one of the zones provided in this title, land contained in rights-of-way for streets or alleys, or railroads shall be considered unclassified.B. Within street or alley rights-of-way, uses shall be limited to street purposes as defined by law.C. Within railroad rights-of-way, allowed uses shall be limited to tracks, signals or other operating devices, movement of rolling stock, utility lines and equipment, and freight-rail dependent uses.D. Where such right-of-way is vacated, the vacated area shall have the zoning classification of the adjoining property with which it is first merged. (Ord. 19146 § 16, 2020: Ord. 10870 § 21, 1993).21A.04ZONES, MAPS AND DESIGNATIONSSections:21A.04.010Zoning classifications and zoning map symbols established.21A.04.020Zoning classification purpose statements.21A.04.030Agricultural zone.21A.04.040Forest zone.21A.04.050Mineral zone.21A.04.060Rural area zone.21A.04.070Urban reserve zone.21A.04.080Urban residential zone.21A.04.090Neighborhood business zone.21A.04.100Community business zone.21A.04.110Regional business zone.21A.04.120Office zone.21A.04.130Industrial zone.21A.04.140Map classification - regional use classification.21A.04.150Map classification - property-specific development or P-suffix standards.21A.04.160Map classification - special district overlay or SO-suffix classification.21A.04.170Map classification - special zone classification.21A.04.180Map classification - interim zoning classification.21A.04.190Zoning maps and boundaries.21A.04.010 Zoning classifications and zoning map symbols established. In order to accomplish the purposes of this title the following zoning classifications and zoning map symbols are established:ZONING CLASSIFICATIONSMAP SYMBOLAgriculturalA (10 -or 35 acre minimum lot size)Forest FMineralMRural AreaRA (2.5-acre, 5-acre, 10-acre or 20-acre minimum lot size)Urban ReserveURUrban ResidentialR (base density in dwellings per acre)Neighborhood BusinessNBCommunity BusinessCBRegional BusinessRBOfficeOIndustrialIRegional UseCase file number following zone's map symbolProperty-specific development standards-P(suffix to zone's map symbol)Special District Overlay-SO(suffix to zone's map symbol)Potential Zone ------------------------------| || | ------------------------------(dashed box surrounding zone’s map symbol)Interim Zone* (asterisk adjacent to zone's map symbol)(Ord. 19146 § 17, 2020: Ord. 12929 § 1, 1997: Ord. 12596 § 1, 1997: Ord. 11621 § 9, 1994: Ord. 10870 § 22, 1993).21A.04.020 Zoning classification purpose statement. The purpose statements for each zoning classification set forth in the following sections shall be used to guide the application of the zoning classifications to all lands in unincorporated King County. The purpose statements also shall guide interpretation and application of land use regulations within the zoning classifications, and any changes to the range of permitted uses within each zoning classification through amendments to this title. (Ord. 19146 § 18, 2020: Ord. 10870 § 23, 1993).21A.04.030 Agricultural zone.A. The purpose of the agricultural zone (A) is to preserve and protect irreplaceable and limited supplies of farmland well suited to agricultural uses by their location, geological formation and chemical and organic composition and to encourage environmentally sound agricultural production. These purposes are accomplished by: 1. Establishing residential density limits to retain lots sized for efficient farming; 2. Allowing for uses related to agricultural production and limiting nonagricultural uses to those compatible with farming, or requiring close proximity for the support of agriculture; and 3. Allowing for residential development primarily to house farm owners, on-site agricultural employees and their respective families.B. Use of this zone is appropriate for lands within agricultural production districts designated by the Comprehensive Plan and for other farmlands deemed appropriate for long-term protection. (Ord. 10870 § 24, 1993).21A.04.040 Forest zone.A. The purpose of the forest zone (F) is to preserve the forest land base; to conserve and protect the long-term productivity of forest lands; and to restrict uses unrelated to or incompatible with forestry. These purposes are accomplished by: 1. Applying the F zone to large contiguous areas where a combination of site, soil and climatic characteristics make it possible to sustain timber growth and harvests over time; 2. Limiting residential, recreational, commercial and industrial uses to those uses that are compatible with forestry, to minimize the potential hazards of damage from fire, pollution and land use conflicts; and 3. Providing for compatible outdoor recreation uses and for conservation and protection of municipal watersheds and fish and wildlife habitats.B. Use of this zone is appropriate for lands within forest production districts designated by the Comprehensive Plan. (Ord. 10870 § 25, 1993).21A.04.050 Mineral zone.A. The purpose of the mineral zone (M) is to provide for continued extraction and processing of mineral and soil resources in an environmentally responsible manner by: 1. Reserving known deposits of minerals and materials within areas as protection against premature development of the land for non-extractive purposes; 2. Providing neighboring properties with notice of prospective extracting and processing activities; and 3. Providing appropriate location and development standards for extraction and on-site processing to mitigate adverse impacts on the natural environment and on nearby properties.B. Use of this zone is appropriate for known deposits of minerals and materials on sites that are of sufficient size to mitigate the impacts of operation and that are served or capable of being served at the time of development by adequate roads and other public services; and for sites containing mineral extracting and processing operations that were established in compliance with land use regulations in effect at the time the use was established. (Ord. 10870 § 26, 1993).21A.04.060 Rural area zone.A. The purpose of the rural zone (RA) is to provide for an area-wide long-term rural character and to minimize land use conflicts with nearby agricultural or forest production districts or mineral extraction sites. These purposes are accomplished by: 1. Limiting residential densities and permitted uses to those that are compatible with rural character and nearby resource production districts and sites and are able to be adequately supported by rural service levels; 2. Allowing small scale farming and forestry activities and tourism and recreation uses that can be supported by rural service levels and that are compatible with rural character; 3. Increasing required setbacks to minimize conflicts with adjacent agriculture, forest or mineral zones; and 4. Requiring tracts created through cluster development to be designated as permanent open space or as permanent resource use. B. Use of this zone is appropriate in rural areas designated by the Comprehensive Plan as follows: 1. RA-2.5 in rural areas where the predominant lot pattern is below five acres in size for lots established prior to the adoption of the 1994 Comprehensive Plan; 2. RA-5 in rural areas where the predominant lot pattern is five acres or greater but less than ten acres in size and the area is generally environmentally unconstrained; 3. RA-10 in rural areas where the predominant lot pattern is ten acres or greater but less than twenty acres in size. RA-10 is also applied on land that is generally environmentally constrained, as defined by county, state or federal law, to protect critical habitat and regionally significant resource areas (RSRAs). The RA-10 zone is also applied to lands within one-quarter mile of a forest or agricultural production district or an approved long-term mineral extraction site. On Vashon-Maury Island RA-10 zoning shall be maintained on areas zoned RA-10 as of 1994 and on areas with a predominant lot size of ten acres or greater that are identified on the Areas Highly Susceptible to Groundwater Contamination map; and 4. RA-20 in Rural Forest Focus Districts designated by the King County Comprehensive Plan. (Ord. 14045 § 1, 2001: Ord. 11621 § 10, 1994: Ord. 10870 § 27, 1993).21A.04.070 Urban reserve zone.A. The purposes of the urban reserve zone (UR) are to phase growth and demand for urban services, and to reserve large tracts of land for possible future growth in portions of King County designated by the Comprehensive Plan for future urban growth while allowing reasonable interim uses of property; or to reflect designation by the comprehensive plan of a property or area as part of the urban growth area when a detailed plan for urban uses and densities has not been completed. These purposes are accomplished by: 1. Allowing for rural, agricultural and other low-density uses; 2. Allowing for limited residential growth, either contiguous to existing urban public facilities, or at a density supportable by existing rural public service levels; and 3. Requiring clustered residential developments where feasible, to prevent establishment of uses and lot patterns which may foreclose future alternatives and impede efficient later development at urban densities. B. Use of this zone is appropriate in urban areas, rural towns or in rural city expansion areas designated by the Comprehensive Plan, when such areas do not have adequate public facilities and services or are not yet needed to accommodate planned growth, do not yet have detailed land use plans for urban uses and densities, or are designated as sites for a potential urban planned development or new fully contained communities. (Ord. 19146 § 19, 2020: Ord. 13278 § 2, 1998: Ord. 12171 § 2, 1996: Ord. 11621 § 11, 1994: Ord. 10870 § 28, 1993).21A.04.080 Urban residential zone.A. The purpose of the urban residential zone (R) is to implement comprehensive plan goals and policies for housing quality, diversity and affordability, and to efficiently use urban residential land, public services and energy. These purposes are accomplished by: 1. Providing, in the R-1 through R-8 zones, for a mix of predominantly single detached dwelling units and other development types, with a variety of densities and sizes in locations appropriate for urban densities; 2. Providing, in the R-12 through R-48 zones, for a mix of predominantly apartment and townhouse dwelling units, mixed-use and other development types, with a variety of densities and sizes in locations appropriate for urban densities; 3. Allowing only those accessory and complementary nonresidential uses that are compatible with urban residential communities; and 4. Establishing density designations to facilitate advanced area-wide planning for public facilities and services, and to protect environmentally sensitive sites from over development.B. Use of this zone is appropriate in urban areas, activity centers, or rural towns designated by the comprehensive plan as follows: 1. The R-1 zone on or adjacent to lands with area-wide environmental constraints where development is required to cluster away from sensitive areas, on lands designated urban separators or wildlife habitat network where development is required to cluster away from the axis of the corridor on critical aquifer recharge areas, and on Regionally and Locally Significant Resource Areas (RSRAs/LSRAs) or in well-established subdivisions of the same density, which are served at the time of development by public or private facilities and services adequate to support planned densities; 2. The R-4 through R-8 zones on urban lands that are predominantly environmentally unconstrained and are served at the time of development, by adequate public sewers, water supply, roads and other needed public facilities and services; and 3. The R-12 through R-48 zones next to Unincorporated Activity centers, in Community or Neighborhood Business Centers, in mixed-use development, on small, scattered lots integrated into existing residential areas, or in rural towns, that are served at the time of development by adequate public sewers, water supply, roads and other needed public facilities and services. (Ord. 14045 § 2, 2001: Ord. 12822 § 5, 1997: Ord. 12596 § 2, 1997: Ord. 11621 § 12, 1994: Ord. 10870 § 29, 1993).21A.04.090 Neighborhood business zone.A. The purpose of the neighborhood business zone (NB) is to provide convenient daily retail and personal services for a limited service area and to minimize impacts of commercial activities on nearby properties and in urban areas on properties with the land use designation of commercial outside of center, to provide for limited residential development. These purposes are accomplished by: 1. Limiting nonresidential uses to those retail or personal services which can serve the everyday needs of a surrounding urban or rural residential area; 2. Allowing for mixed use (housing and retail/service) developments and for townhouse developments as a sole use on properties in the urban area with the land use designation of commercial outside of center; and 3. Excluding industrial and community/regional business-scaled uses.B. Use of this zone is appropriate in urban neighborhood business centers, rural towns, or rural neighborhood centers designated by the comprehensive plan, on sites which are served at the time of development by adequate public sewers when located in urban areas or adequate on-site sewage disposal when located in rural areas, water supply, roads and other needed public facilities and services. (Ord. 12522 § 2, 1996: Ord. 11621 § 13, 1994: Ord. 10870 § 30, 1993).21A.04.100 Community business zone.A. The purpose of the community business zone (CB) is to provide convenience and comparison retail and personal services for local service areas which exceed the daily convenience needs of adjacent neighborhoods but which cannot be served conveniently by larger activity centers, and to provide retail and personal services in locations within activity centers that are not appropriate for extensive outdoor storage or auto related and industrial uses. These purposes are accomplished by: 1. Providing for limited small-scale offices as well as a wider range of the retail, professional, governmental and personal services than are found in neighborhood business areas; 2. Allowing for mixed use (housing and retail/service) developments; and 3. Excluding commercial uses with extensive outdoor storage or auto related and industrial uses.B. Use of this zone is appropriate in urban and community centers or rural towns that are designated by the Comprehensive Plan and community plans and that are served at the time of development by adequate public sewers, water supply, roads and other needed public facilities and services. (Ord. 11621 § 14, 1994: Ord. 10870 § 31, 1993).21A.04.110 Regional business zone.A. The purpose of the regional business zone (RB) is to provide for the broadest mix of comparison retail, wholesale, service and recreation/cultural uses with compatible storage and fabrication uses, serving regional market areas and offering significant employment opportunities. These purposes are accomplished by: 1. Encouraging compact development that is supportive of transit and pedestrian travel, through higher nonresidential building heights and floor area ratios than those found in community centers; 2. Allowing for outdoor sales and storage, regional shopping areas and limited fabrication uses; and 3. Concentrating large scale commercial and office uses to facilitate the efficient provision of public facilities and services.B. Use of this zone is appropriate in urban activity centers or rural towns that are designated by the Comprehensive Plan and community plans that are served at the time of development by adequate public sewers, water supply, roads and other needed public facilities and services. (Ord. 11621 § 15, 1994: Ord. 10870 § 32, 1993).21A.04.120 Office zone.A. The purpose of the office zone (O) is to provide for pedestrian and transit-oriented high-density employment uses together with limited complementary retail and urban density residential development in locations within activity centers where the full range of commercial activities is not desirable. These purposes are accomplished by: 1. Allowing for uses that will take advantage of pedestrian-oriented site and street improvement standards; 2. Providing for higher building heights and floor area ratios than those found in community centers; 3. Reducing the ratio of required parking to building floor area; 4. Allowing for on-site convenient daily retail and personal services for employees and residences; and 5. Excluding auto-oriented, outdoor or other retail sales and services which do not provide for the daily convenience needs of on-site and nearby employees or residents.B. Use of this zone is appropriate in activity centers designated by the Comprehensive Plan and community plans which are served at the time of development by adequate public sewers, water supply, roads and other needed public facilities and services. (Ord. 10870 § 33, 1993).21A.04.130 Industrial zone.A. The purpose of the industrial zone (I) is to provide for the location and grouping of industrial enterprises and activities involving manufacturing, assembly, fabrication, processing, bulk handling and storage, research facilities, warehousing and heavy trucking. It is also a purpose of this zone to protect the industrial land base for industrial economic development and employment opportunities. These purposes are accomplished by: 1. Allowing for a wide range of industrial and manufacturing uses; 2. Establishing appropriate development standards and public review procedures for industrial activities with the greatest potential for adverse impacts; and 3. Limiting residential, institutional, commercial, office and other non-industrial uses to those necessary for the convenience of industrial activities. B. Use of this zone is appropriate in urban activity centers or rural towns designated by the Comprehensive Plan and community plans which are served at the time of development by adequate public sewers, water supply, roads and other needed public facilities and services. (Ord. 11621 § 16, 1994: Ord. 10870 § 34, 1993).21A.04.140 Map classification - regional use classification. The purpose of the regional use classification (case file number following underlying zone's map symbol) is to provide for individual review of certain proposed uses with unique characteristics and adverse impacts on neighboring properties. Regional uses are of a size and involve activities which require individual review to determine compatibility with surrounding uses. (Ord. 19146 § 20, 2020: Ord. 10870 § 35, 1993).21A.04.150 Map classification - property-specific development or P-suffix standards. The purpose of the property-specific development standards classification (-P suffix to zone's map symbol) is to indicate that conditions beyond the minimum requirements of this title have been applied to development on the property, including but not limited to increased development standards, limits on permitted uses or special conditions of approval. Property-specific development standards are adopted in either a reclassification or area zoning ordinance and are shown in a geographic information system data layer for an individual property maintained by the department. Regardless of the form in which a property-specific development standard is adopted, the P-suffix shall be shown on the official zoning map maintained by the department and as a notation in a geographic information system data layer, which shall be updated as soon as possible after the effective date of the adopting ordinance adopting a P-suffix standard. (Ord. 19146 § 21, 2020: Ord. 17485 § 12, 2012: Ord. 12824 § 20, 1997: Ord. 11621 § 17 1994: Ord. 10870 § 36, 1993).21A.04.160 Map classification - special district overlay or SO-suffix classification. The purpose of the special district overlay classification (-SO suffix to zone's map symbol) is to carry out Comprehensive Plan and community, subarea or neighborhood plan policies that identify special opportunities for achieving public benefits by allowing or requiring alternative uses and development standards that differ from the general provisions of this title. Special district overlays are generally applied to a group of individual properties or entire community, subarea or neighborhood planning areas and are classified primarily through the area zoning process. Regardless of the form in which a special district overlay is adopted, the -SO suffix shall be shown on the official zoning map maintained by the department and as a notation in a geographic information system data layer, which shall be updated as soon as possible after the effective date of the adopting ordinance adopting an overlay. (Ord. 19146 § 22, 2020: Ord. 17485 § 13, 2012: Ord. 12823 § 1, 1997: Ord. 11621 § 18, 1994: Ord. 10870 § 37, 1993).21A.04.170 Map classification - special zone classification.A. The purpose of the potential zone (dashed box surrounding zone's map symbol) is to classify properties potentially suitable for future changes in land uses or densities once additional infrastructure, project phasing or site-specific public review has been accomplished. Potential zones are classified by either area zoning or individual zone reclassification. Area zoning may classify more than one potential zone on a single property if the community plan designates alternative uses for the site. Potential zones are actualized in accordance with K.C.C. chapter 20.20.B. The use of a potential zoning classification is appropriate to: 1. Phase development based on availability of public facilities and services or infrastructure improvements, such as roads, utilities and schools; 2. Prevent existing development from becoming a nonconforming use in areas that are in transition from previous uses; 3. Allow for future residential density increases consistent with a community plan; and 4. Provide for public review of proposed uses on sites where some permitted uses in a zoning classification may not be appropriate. (Ord. 19146 § 23, 2020: Ord. 18230 § 126, 2016: Ord. 10870 § 38, 1993).21A.04.180 Map classification - interim zoning classification. The purpose of the interim zoning classification (* suffix to zone's map symbol) is to identify areas where zoning has been applied for a limited period of time in order to preserve the county's planning options and to protect the public safety, health and general welfare during an emergency or pending a community, comprehensive or functional plan amendment process. Any of the zones set forth in this chapter, with or without -P suffix conditions, may be applied as interim zones. The adopting ordinance shall state the reasons for the interim zoning and provide for its expiration upon a certain date or the adoption of a new plan, plan amendment or area zoning. (Ord. 19146 § 24, 2020: Ord. 10870 § 39, 1993).21A.04.190 Zoning maps and boundaries.A. The location and boundaries of the zones defined by this chapter shall be shown and delineated on zoning maps adopted by ordinance.B. Changes in the boundaries of the zones, including application or amendment of interim zoning, shall be made by ordinance adopting or amending a zoning map.C. Zoning maps are available for public review at the department of local services, permitting division, permit center during business hours. (Ord. 18791 § 162, 2018: Ord. 17420 § 96, 2012: Ord. 10870 § 40, 1993).21A.06TECHNICAL TERMS AND LAND USE DEFINITIONSSections:21A.06.005Scope of chapter.21A.06.007Abandoned vehicle.21A.06.010Accessory living quarters.21A.06.013Accessory use.21A.06.015Accessory use, commercial/industrial.21A.06.020Accessory use, residential.21A.06.025Accessory use, resource.21A.06.026Active recreation space.21A.06.027Adjustment factor.21A.06.035Adult entertainment business.21A.06.036Agricultural activities.21A.06.037Agricultural drainage.21A.06.039Agricultural products.21A.06.040Agricultural product sales.21A.06.040SAgricultural support services.21A.06.042Agriculture training facility.21A.06.043Agricultural waterway.21A.06.044Agriculture.21A.06.045Aircraft, ship and boat manufacturing.21A.06.050Airport/heliport.21A.06.055Alley.21A.06.056Alteration.21A.06.057Alternative water sources.21A.06.058AMI.21A.06.060Amusement arcades.21A.06.065Animal, small.21A.06.067Antenna.21A.06.070Applicant.21A.06.072Application rate.21A.06.072BAquaculture.21A.06.072CAquatic areas.21A.06.073Artist studio.21A.06.075Auction house.21A.06.078Bank stabilization.21A.06.080Base flood.21A.06.085Base flood elevation.21A.06.087Battery energy storage system.21A.06.090Bed and breakfast guesthouse.21A.06.095Beehive.21A.06.097Berm.21A.06.098Best management practice.21A.06.100Billboard.21A.06.105Billboard face.21A.06.108Bioengineering.21A.06.111Bioretention.21A.06.113Bog.21A.06.115Book, stationery, video and art supply store.21A.06.118Breakwater.21A.06.120Broadleaf tree.21A.06.122Buffer.21A.06.125Building.21A.06.135Building envelope.21A.06.140Building facade.21A.06.145Building materials and hardware store.21A.06.155Bulk retail.21A.06.156Bulkhead.21A.06.158Camp, agriculture-related special needs.21A.06.160Campground.21A.06.162Camps, recreational and retreat.21A.06.165Capacity, school.21A.06.170Capital facilities plan, school.21A.06.172Catastrophic collapse.21A.06.175Cattery, commercial.21A.06.177Cattery, hobby.21A.06.180Cemetery, columbarium or mausoleum.21A.06.181Channel.21A.06.181CChannel edge.21A.06.181EChannel migration hazard area, moderate.21A.06.181GChannel migration hazard area, severe.21A.06.182Channel migration zone.21A.06.185Church, synagogue or temple.21A.06.190Classrooms, school.21A.06.195Clearing.21A.06.196Clustering.21A.06.197Coal mine by-products stockpile.21A.06.200Coal mine hazard area.21A.06.205Cogeneration.21A.06.208Commercial salmon net pens.21A.06.210Communication facility, major.21A.06.215Communication facility, minor.21A.06.217Community identification sign.21A.06.219Community preference.21A.06.220Community residential facility ("CRF").21A.06.223Commuter parking lot.21A.06.225Compensatory storage.21A.06.230Conditional use permit.21A.06.235Conference center.21A.06.240Confinement area.21A.06.245Consolidation.21A.06.247Construction and trades.21A.06.250Construction cost per student, school.21A.06.251Consumer-scale renewable energy system.21A.06.252Conversion factor.21A.06.253County fairground facility.21A.06.253CCritical aquifer recharge area.21A.06.254Critical area.21A.06.255Critical drainage area.21A.06.260Critical facility.21A.06.261Critical saltwater habitat.21A.06.262Daily care.21A.06.265Daycare.21A.06.270Deciduous.21A.06.275Development rights, transfer of ("TDR").21A.06.280Department.21A.06.285Department and variety store.21A.06.290Destination resort.21A.06.295Developer or applicant.21A.06.300Development activity.21A.06.305Development agreement.21A.06.310Development proposal.21A.06.315Development proposal site.21A.06.318Digester, agricultural anaerobic.21A.06.320Direct traffic impact.21A.06.325Director.21A.06.326Ditch.21A.06.328Dog training facility.21A.06.330Dormitory.21A.06.331Draft flood boundary work map.21A.06.332Drainage basin.21A.06.332CDrainage facility.21A.06.333Drainage subbasin.21A.06.333ADredging.21A.06.334Drift cell.21A.06.335Drop box facility.21A.06.340Drug store.21A.06.345Dwelling unit.21A.06.350Dwelling unit, accessory.21A.06.352Dwelling unit, affordable.21A.06.355Dwelling unit, apartment.21A.06.358Dwelling unit, cottage housing.21A.06.362Dwelling unit, market-rate.21A.06.365Dwelling unit, single detached.21A.06.370Dwelling unit, townhouse.21A.06.375Earth station.21A.06.378Ecosystem.21A.06.380Effective radiated power.21A.06.385Electric vehicle.21A.06.386Electric-vehicle load management system.21A.06.387Electric-vehicle-ready parking space.21A.06.388Electric-vehicle supply equipment.21A.06.389Electric-vehicle-supply-equipment parking space.21A.06.390Electrical substation.21A.06.392Emergency.21A.06.393Employee, agricultural.21A.06.395Energy resource recovery facility.21A.06.398Engineer, civil, geotechnical and structural.21A.06.400Enhancement.21A.06.401Environment, shoreline.21A.06.402Environmental education project.21A.06.405Equipment, heavy.21A.06.410Erosion.21A.06.415Erosion hazard area.21A.06.420Evergreen.21A.06.425Examiner.21A.06.427Expansion.21A.06.430Fabric shop.21A.06.435Facilities standard.21A.06.440Factory-built commercial building.21A.06.445Fairground.21A.06.450Family.21A.06.450FFarm.21A.06.451Farm field access drive.21A.06.451AFarm pad.21A.06.451MFarmers market.21A.06.451RFarm residence.21A.06.452Feasible.21A.06.453Federal Emergency Management Agency.21A.06.454FEMA.21A.06.455Federal Emergency Management Agency ("FEMA") floodway.21A.06.460Feed store.21A.06.464Fen.21A.06.465Fence.21A.06.467Financial guarantee.21A.06.468Firearm.21A.06.469Float.21A.06.470Flood fringe, zero-rise.21A.06.475Flood hazard areas.21A.06.478Flood hazard data.21A.06.480Flood Insurance Rate Map.21A.06.485Flood Insurance Study.21A.06.490Flood protection elevation.21A.06.492Flood protection facility.21A.06.495Floodplain.21A.06.497Floodplain development.21A.06.500Floodproofing, dry.21A.06.505Floodway, zero-rise.21A.06.510Florist shop.21A.06.512Footprint.21A.06.513Footprint, development21A.06.514Forecourt.21A.06.515Forest land.21A.06.517Forest management activity.21A.06.520Forest practice.21A.06.525Forest product sales.21A.06.530Forest research.21A.06.531Forestry.21A.06.532Fossil fuel facility.21A.06.532CFossil fuels.21A.06.533Fully contained community (FCC).21A.06.535Furniture and home furnishings store.21A.06.537Gateway sign.21A.06.540General business service.21A.06.543Geoduck aquaculture.21A.06.545Geologist.21A.06.555Golf course facility.21A.06.558Grade.21A.06.560Grade span.21A.06.565Grading.21A.06.570Grazing area.21A.06.573Groin.21A.06.575Groundcover.21A.06.577Habitat.21A.06.578Habitat, fish.21A.06.580Hazardous household substance.21A.06.582Hazardous liquid and gas transmission pipeline.21A.06.585Hazardous substance.21A.06.590Heavy equipment and truck repair.21A.06.595Helistop.21A.06.597Historic resource.21A.06.598Historic resource inventory.21A.06.599Historical flood hazard information.21A.06.600Hobby, toy, and game shop.21A.06.605Home industry.21A.06.610Home occupation.21A.06.615Household pets.21A.06.620Hydroelectric generation facility.21A.06.625Impervious surface.21A.06.628Impoundment.21A.06.630Improved public roadways.21A.06.635Individual transportation and taxi.21A.06.637Infiltration rate.21A.06.638Instream structure.21A.06.640Interim recycling facility.21A.06.641Interlocal agreement.21A.06.641CInvasive vegetation.21A.06.642Irrigation efficiency.21A.06.645Jail.21A.06.650Jail farm.21A.06.653Jetty.21A.06.655Jewelry store.21A.06.658Joint use driveway.21A.06.660Kennel, commercial.21A.06.660AKennel, hobby.21A.06.661Kennel-free dog boarding and daycare.21A.06.662Kitchen or kitchen facility.21A.06.665Landfill.21A.06.667Landscape water features.21A.06.670Landscaping.21A.06.675Landslide.21A.06.680Landslide hazard area.21A.06.685Level of service ("LOS"), traffic.21A.06.690Light equipment.21A.06.695Livestock.21A.06.700Livestock, large.21A.06.705Livestock, small.21A.06.707Livestock heavy use area.21A.06.708Livestock manure storage facility.21A.06.710Livestock sales.21A.06.715Loading space.21A.06.717Local distribution gas storage tank.21A.06.720Log storage.21A.06.725Lot.21A.06.730Lot line, interior.21A.06.731Maintenance.21A.06.732Manufactured home or mobile home.21A.06.734Mapping partner.21A.06.7341Marijuana.21A.06.7342Marijuana greenhouse.21A.06.7344Marijuana processer.21A.06.7346Marijuana producer.21A.06.7348Marijuana retailer.21A.06.735Marina.21A.06.738Master program, shoreline.21A.06.740Material error.21A.06.742Materials processing facility.21A.06.743Maximum extent practical.21A.06.745Microwave.21A.06.747Midblock connection.21A.06.750Mitigation.21A.06.751Mitigation bank.21A.06.752Mitigation banking.21A.06.753Mixed-use development.21A.06.755Mobile home.21A.06.760Mobile home park.21A.06.765Monitoring.21A.06.770Monuments, tombstones, and gravestones sales.21A.06.775Motor vehicle, boat and mobile home dealer.21A.06.780Motor vehicle and bicycle manufacturing.21A.06.782Mulch.21A.06.785Municipal water production.21A.06.787Music and dance entertainment venue.21A.06.790Native vegetation.21A.06.795Naturalized species.21A.06.796Navigability or navigable.21A.06.796ANearshore.21A.06.797Net buildable area.21A.06.799No net loss of shoreline ecological function.21A.06.799ANoncommercial native salmon net pens.21A.06.800Nonconformance.21A.06.805Non-hydroelectric generation facility.21A.06.810Non-ionizing electromagnetic radiation ("NIER").21A.06.812Nonnative marine finfish aquaculture.21A.06.815Noxious weed.21A.06.817Off-street required parking lot.21A.06.819Open space.21A.06.820Open-work fence.21A.06.825Ordinary high water mark.21A.06.830Outdoor performance center.21A.06.831Overburden-cover-to-seam-thickness ratio.21A.06.832Overspray.21A.06.834Paintball.21A.06.835Park.21A.06.837Park, recreation or multiuse.21A.06.840Park service area.21A.06.845Parking lot aisle.21A.06.850Parking lot unit depth.21A.06.855Parking space.21A.06.860Parking space angle.21A.06.865Party of record.21A.06.870Peak hour.21A.06.875Permanent school facilities.21A.06.880Personal medical supply store.21A.06.882Personal wireless services.21A.06.885Pet shop.21A.06.887Petroleum refining and related industries.21A.06.890Photographic and electronic shop.21A.06.892Pier or dock.21A.06.895Plant associations of infrequent occurrence.21A.06.897Plant factor.21A.06.899Potable water.21A.06.899CPreliminary flood insurance rate map.21A.06.899EPreliminary flood insurance study.21A.06.900Private.21A.06.908Processing operation, waste materials.21A.06.910Professional office.21A.06.913Public access.21A.06.915Public agency.21A.06.920Public agency animal control facility.21A.06.925Public agency archive.21A.06.930Public agency or utility office.21A.06.935Public agency or utility yard.21A.06.940Public agency training facility.21A.06.942Public road right-of-way structure.21A.06.943Public transportation amenities.21A.06.944Puget Sound counties.21A.06.944CRacetrack21A.06.945Radio frequency.21A.06.950Reasonable use.21A.06.955Receiving site.21A.06.957Reclamation.21A.06.958Recreation, active.21A.06.9585Recreation, passive.21A.06.959Recreation facilities, passive.21A.06.960Recreational vehicle ("RV").21A.06.965Recreational vehicle parks.21A.06.970Recyclable material.21A.06.971Redesignation.21A.06.972Reference evapotranspiration (Eto).21A.06.973Regional light rail transit.21A.06.973CRegional motor sports facility.21A.06.974Regional road maintenance guidelines.21A.06.977Regional transit authority facility.21A.06.980Regional utility corridor.21A.06.985Relocatable facilities cost per student.21A.06.990Relocatable facility.21A.06.995Relocation facilities.21A.06.996Remote tasting room.21A.06.996CRenewable energy generation facility.21A.06.997Repair.21A.06.998Replace.21A.06.1000Restoration.21A.06.1002Resource land tract.21A.06.1005Retail comparison.21A.06.1010Retail convenience.21A.06.10105Retail nursery, garden center and farm supply store.21A.06.1011Retaining wall.21A.06.1011ARoad amenities.21A.06.1011CRoadway.21A.06.1012Runoff.21A.06.1013Rural equestrian community trail.21A.06.1014Rural forest focus areas.21A.06.1014FRural public infrastructure maintenance facility.21A.06.1015Salmonid.21A.06.1020School bus base.21A.06.1025School district.21A.06.1030School district support facility.21A.06.1035Schools, elementary, and middle/junior high.21A.06.1040Schools, secondary or high school.21A.06.1043Secure community transition facility ("SCTF").21A.06.1044Sea level rise protection elevation.21A.06.1044CSea level rise risk area.21A.06.1044HSearch and rescue facility.21A.06.1045Seismic hazard area.21A.06.1050Self-service storage facility.21A.06.1055Sending site.21A.06.1060Senior citizen.21A.06.1062Senior citizen assisted housing.21A.06.1070Setback.21A.06.1075Shelters for temporary placement.21A.06.1080Shooting range.21A.06.1081Shorelands.21A.06.1082Shoreline.21A.06.1082AShoreline conditional use.21A.06.1082BShoreline jurisdiction.21A.06.1082CShoreline stabilization.21A.06.1082DShoreline variance.21A.06.1083AShorelines of statewide significance.21A.06.1083BShorelines of the state.21A.06.1084Side channel.21A.06.1085Sign.21A.06.1090Sign, awning.21A.06.1095Sign, changing message center.21A.06.1100Sign, community bulletin board.21A.06.1105Sign, directional.21A.06.1110Sign, freestanding.21A.06.1115Sign, fuel price.21A.06.1120Sign, incidental.21A.06.1125Sign, indirectly illuminated.21A.06.1130Sign, monument.21A.06.1135Sign, off-premise directional.21A.06.1140Sign, on-premise.21A.06.1145Sign, permanent residential development identification.21A.06.1150Sign, portable.21A.06.1155Sign, projecting.21A.06.1160Sign, time and temperature.21A.06.1165Sign, wall.21A.06.1167Significant tree.21A.06.1170Site.21A.06.1172Site area.21A.06.1175Site cost per student.21A.06.1180Ski area.21A.06.1182Slope.21A.06.1185Soil recycling facility.21A.06.1190Source-separated organic material.21A.06.1195Special use permit.21A.06.1200Specialized instruction school.21A.06.1205Specified sexual activities.21A.06.1210Sporting goods store.21A.06.1215Sports club.21A.06.1220Stable.21A.06.1225Standard of service, school districts.21A.06.1230Steep slope hazard area.21A.06.1235Stream functions.21A.06.1240Stream.21A.06.1245Street.21A.06.1250Street frontage.21A.06.1255Structure.21A.06.1260Student factor.21A.06.1263Subdivision or residential subdivision.21A.06.1265Submerged land.21A.06.1268Substantial Development.21A.06.1270Substantial improvement.21A.06.1271Surface water conveyance.21A.06.1272Surface water discharge.21A.06.1273TDR.21A.06.1273ATDR amenities.21A.06.1273BTDR bank fund.21A.06.1273CTDR conversion ratio.21A.06.1273DTDR executive board.21A.06.1274TDR extinguishment document.21A.06.1274ATemporary farm worker housing.21A.06.1275Temporary use permit.21A.06.1277Theater.21A.06.1278Theatrical production services.21A.06.1280Tightline sewer.21A.06.1285Trails.21A.06.1290Transfer station.21A.06.1295Transit base.21A.06.1297Transit comfort facility.21A.06.1305Transitional housing facilities.21A.06.1310Transmission equipment.21A.06.1315Transmission line booster station.21A.06.1320Transmission support structure.21A.06.1325Transmitter building.21A.06.1330Transportation system management ("TSM").21A.06.1331Tree, hazard.21A.06.1331CTree canopy spread.21A.06.1332Trough subsidence.21A.06.1335Ultimate roadway section.21A.06.1340Urban Plan Development (UPD).21A.06.1345Use.21A.06.1347Use, established.21A.06.1348Utility corridor.21A.06.1350Utility facility.21A.06.1352Vactor waste.21A.06.1353Vactor waste receiving facility.21A.06.1355Variance.21A.06.1360Vegetation.21A.06.1365Vocational school.21A.06.1370Volcanic hazard area.21A.06.1375Warehousing and wholesale trade.21A.06.1380Wastewater treatment facility.21A.06.1382Water budget.21A.06.1385Water dependent use.21A.06.1386Water enjoyment use.21A.06.1388Water oriented use.21A.06.1389Water related use.21A.06.1390Wet meadow, grazed or tilled.21A.06.1391Wetland.21A.06.1392Wetland complex.21A.06.1393Wetland creation.21A.06.1395Wetland edge.21A.06.1397Wetland enhancement.21A.06.1400Wetland, forested.21A.06.1405Wetland functions.21A.06.1414Wetland reestablishment.21A.06.1416Wetland rehabilitation.21A.06.1418Wetland vegetation class.21A.06.1420Wetpond.21A.06.1422Wildlife.21A.06.1423Wildlife habitat conservation area.21A.06.1424Wildlife habitat network.21A.06.1425Wildlife shelter.21A.06.1427AWinery, brewery, distillery facility I.21A.06.1427BWinery, brewery, distillery facility II.21A.06.1427CWinery, brewery, distillery facility III.21A.06.1430Work release facility.21A.06.1432Wrecked, dismantled or inoperative vehicle.21A.06.1435Yard waste processing facility.21A.06.1440Zoo animal breeding facility.21A.06.005 Scope of chapter. This chapter contains definitions of technical and procedural terms used throughout the code and definitions of land uses listed in tables in K.C.C. 21A.08. The definitions in this chapter supplement the standard Industrial Classification Manual (SIC). See K.C.C. 21A.02 for rules on interpretation of the code, including use of these definitions. Development standards are found in K.C.C. 21A.12 through K.C.C. 21A.38. (Ord. 10870 § 41, 1993).21A.06.007 Abandoned vehicle. An "abandoned vehicle" means any vehicle left upon the property of another without the consent of the owner of such property for a period of twenty-four hours or longer, except that a vehicle shall not be considered abandoned if its owner or operator is unable to remove it from the place where it is located and so notifies law enforcement officials and requests assistance. (Ord. 12024 § 10, 1995).21A.06.010 Accessory living quarters. Accessory living quarters: living quarters in an accessory building for the use of the occupant or persons employed on the premises, or for temporary use by guests of the occupant. Such quarters do not include an area for the preparation or storage of food and are not used as a separate dwelling unit. (Ord. 19146 § 25, 2020: Ord. 10870 § 42, 1993).21A.06.013 Accessory use. Accessory use: a use, structure or activity that is:A. Customarily associated with a principal use;B. Located on the same site as the principal use; andC. Subordinate and incidental to the principal use. (Ord. 17841 § 6, 2014).21A.06.015 Accessory use, commercial/industrial. Accessory use, commercial/industrial: an accessory use to a commercial or industrial use, including, but not limited to:A. Administrative offices;B. Employee exercise facilities;C. Employee food service facilities;D. Incidental storage of raw materials and finished products sold or manufactured on-site;E. Business owner or caretaker residence;F. Cogeneration facilities;G. Ground maintenance facilities; H. Consumer-scale renewable energy systems; andI. Battery energy storage systems meeting the requirements of K.C.C. 21A.08.060.B.41. (Ord. 19824 § 2, 2024: Ord. 19146 § 26, 2020: Ord. 17841 § 7, 2014: Ord. 10870 § 43, 1993).21A.06.020 Accessory use, residential. Accessory use, residential: an accessory use to a residential use, including, but not limited to: A. Accessory living quarters and dwellings;B. Fallout or bomb shelters;C. Keeping household pets or operating a hobby cattery or hobby kennel;D. On-site rental office;E. Pools, private docks, or piers;F. Antennae for private telecommunication services;G. Storage of yard maintenance equipment;H. Storage of private vehicles, such as motor vehicles, boats, trailers, or planes;I. Greenhouses;J. Recreation space areas required under K.C.C. 21A.14.180 and play areas required under K.C.C. 21A.14.190;K. Home occupations and home industries under K.C.C. chapter 21A.30; L. Consumer-scale renewable energy systems; andM. Battery energy storage systems meeting the requirements of K.C.C. 21A.08.030.B.7. (Ord. 19824 § 3, 2024: Ord. 19146 § 27, 2020: Ord. 17841 § 8, 2014: Ord. 11621 § 29, 1994: Ord. 10870 § 44, 1993).21A.06.025 Accessory use, resource. Accessory use, resource: an accessory use to a resource use, including, but not limited to:A. Housing of agricultural workers;B. Storage of agricultural products or equipment used on site; C. Consumer-scale renewable energy systems; andD. Battery energy storage systems meeting the requirements of K.C.C. 21A.08.090.B. (Ord. 19824 § 4, 2024: Ord. 19146 § 28, 2020: Ord. 17841 § 9, 2014: Ord. 10870 § 45, 1993).21A.06.026 Active recreation space. Active recreation space: recreation space that recognizes a higher level of public use than passive recreation space, and that will be developed for organized or intense recreation. Active recreation site includes both the active recreation uses and all necessary support services and facilities. (Ord. 14045 § 3, 2001).21A.06.027 Adjustment factor. Adjustment factor: a factor that when applied to the reference evapotranspiration, adjusts for plant factors and irrigation efficiently. (Ord. 11210 § 22, 1994).21A.06.035 Adult entertainment business. Adult entertainment business: An adult club, adult arcade or adult theatre as those terms are defined in the adult entertainment licensing provisions in K.C.C. Title 6. (Ord. 13546 § 2, 1999: Ord. 10870 § 47, 1993).21A.06.036 Agricultural activities. Agricultural activities: those agricultural uses and practices that pertain directly to the commercial production of agricultural products, including, but not limited to:A. Tilling, discing, planting, seeding, fertilization, composting and other soil amendments and harvesting;B. Grazing, animal mortality management and on-site animal waste storage, disposal and processing;C. Soil conservation practices including dust control, rotating and changing agricultural crops and allowing agricultural lands to lie fallow under local, state or federal conservation programs;D. Maintenance of farm and stock ponds, agricultural drainage, irrigation systems canals and flood control facilities;E. Normal maintenance, operation and repair of existing serviceable equipment, structures, facilities or improved areas, including, but not limited to, fencing, farm access roads and parking; andF. Processing, promotion, sale, storage, packaging and distribution. (Ord. 18626 § 10, 2017).21A.06.037 Agricultural drainage. Agricultural drainage: any ditch, tile system, pipe or culvert primarily used to drain fields for horticultural or livestock activities. (Ord. 17539 § 16, 2013: Ord. 15051 § 3, 2004).21A.06.039 Agricultural products. Agricultural products: products that include, but are not limited to:A. Horticultural, viticultural, floricultural and apiary products;B. Livestock and livestock products;C. Animal products including, but not limited to, upland finfish, dairy products, meat, poultry and eggs;D. Feed or forage for livestock;E. Christmas trees, hybrid cottonwood and similar hardwood trees grown as crops and harvested within twenty years of planting; andF. Turf, sod, seed and related products. (Ord. 18626 § 11, 2017).21A.06.040 Agricultural product sales. Agricultural product sales: the retail sale of items resulting from the practice of agriculture, including primary horticulture products such as fruits, vegetables, grains, seed, feed and plants, primary animal products such as eggs, milk and meat, or secondary and value added products resulting from processing, sorting or packaging of primary agricultural products such as jams, cheeses, dried herbs or similar items. Agricultural product sales do not include marijuana, usable marijuana or marijuana-infused products. (Ord. 17710 § 1, 2013: Ord. 15032 § 1, 2004: Ord. 10870 § 48, 1993).21A.06.040S Agricultural support services. Agricultural support services: any agricultural activity that is directly related to agriculture and directly dependent upon agriculture for its existence but is undertaken on lands that are not predominately in agricultural use. (Ord. 18626 § 12, 2017).21A.06.042 Agriculture training facility. Agriculture training facility: an establishment developed for use by the property owner, its employees, and/or agricultural trainees for training activities which are related to or supportive of the agricultural use of the property and surrounding agricultural activities. Agriculture training facilities may include overnight lodging, meeting rooms, and educational activities. (Ord. 12691 § 1, 1997).21A.06.043 Agricultural waterway. Agricultural waterway: A segment of a modified type F, N or O aquatic area that drains land defined in RCW 84.34.020 as farm and agricultural land or as farm and agricultural conservation land. (Ord. 17539 § 17, 2013).21A.06.044 Agriculture. Agriculture: the use of land for commercial purposes for either the raising of crops or livestock or the production of agricultural products, or both. (Ord. 18626 § 9, 2017).21A.06.045 Aircraft, ship and boat manufacturing. Aircraft, ship and boat manufacturing: the fabrication and/or assembling of aircraft, ships or boats, including only uses located in SIC Industry Group Nos.:A. 372-Aircraft and Parts; andB. 373-Ship and Boat Building and Repairing. (Ord. 10870 § 49, 1993).21A.06.050 Airport/heliport. Airport/heliport: any runway, landing area or other facility, excluding facilities for the primary use of the individual property owner which are classified as helistops, designed or used by public carriers or private aircraft for the landing and taking off of aircraft, including the following associated facilities:A. Taxiways;B. Aircraft storage and tie-down areas;C. Hangars;D. Servicing; andE. Passenger and air freight terminals. (Ord. 10870 § 50, 1993).21A.06.055 Alley. Alley: an improved thoroughfare or right-of-way, whether public or private, usually narrower than a street, that provides vehicular access to an interior boundary of one or more lots, and is not designed for general traffic circulation. (Ord. 10870 § 51, 1993).21A.06.056 Alteration. Alteration: any human activity that results or is likely to result in an impact upon the existing condition of a critical area or its buffer. "Alteration" includes, but is not limited to, grading, filling, dredging, channelizing, applying herbicides or pesticides or any hazardous substance, discharging pollutants except stormwater, grazing domestic animals, paving, constructing, applying gravel, modifying topography for surface water management purposes, cutting, pruning, topping, trimming, relocating or removing vegetation or any other human activity that results or is likely to result in an impact to existing vegetation, hydrology, fish or wildlife or their habitats. "Alteration" does not include passive recreation such as walking, fishing or any other similar activities. (Ord. 15051 § 5, 2004: Ord. 10870 § 466, 1993. Formerly K.C.C. 21A.24.190).21A.06.057 Alternative water sources. Alternative water sources: stored rainwater, or treated or recycled waste water of a quality suitable for uses such as landscape irrigation. Such water is not considered potable. (Ord. 11210 § 23, 1994).21A.06.058 AMI. AMI: Area Medium Income, which is the median household income for King County as established by the United States Department of Housing and Urban Development, adjusted for household size. (Ord. 19555 § 7, 2022).21A.06.060 Amusement arcades. Amusement arcades: a building or part of a building in which five or more pinball machines, video games, or other such player-operator amusement devices (excluding juke boxes or gambling-related machines) are operated. (Ord. 10870 § 52, 1993).21A.06.065 Animal, small. Animal, small: any animal other than livestock or animals considered to be predatory or wild which are kept outside a dwelling unit all or part of the time. Animals considered predatory or wild, excluding those in zoo animal breeding facilities, shall be considered small animals when they are taken into captivity for the purposes of breeding, domestication, training, hunting or exhibition. (Ord. 12709 § 1, 1997: Ord. 10870 § 53, 1993).21A.06.067 Antenna. Antenna: any system of poles, panels, rods, reflecting discs or similar devices used for the transmission or reception or radio frequency signals. (Ord. 13129 § 20, 1998).21A.06.070 Applicant. Applicant: a property owner, a public agency or a public or private utility that owns a right-of-way or other easement or has been adjudicated the right to such an easement under RCW 8.08.040, or any person or entity designated or named in writing by the property or easement owner to be the applicant, in an application for a development proposal, permit or approval. (Ord. 15051 § 6, 2004: Ord. 12196 § 53, 1996: Ord. 11700 § 42, 1995: Ord. 10870 § 54, 1993).21A.06.072 Application rate. Application rate: the depth of water applied to an area expressed in inches per hour. (Ord. 11210 § 24, 1994).21A.06.072B Aquaculture. Aquaculture: the culture or farming of finfish, shellfish, algae or other plants or animals in fresh or marine waters. Aquaculture does not include: related commercial or industrial uses such as wholesale or retail sales; or final processing, packing or freezing. "Aquaculture" does not include the harvest of wild geoduck associated with the state-managed wildstock geoduck fishery. (Ord. 19034 § 7, 2019: Ord. 16985 § 133, 2010: Ord. 6511 § 1, 1983: Ord. 4222 § 1, 1979: Ord. 3688 § 202, 1978. Formerly K.C.C. 25.08.030).21A.06.072C Aquatic areas.A. Aquatic areas: 1. Nonwetland water features including: all shorelines of the state, rivers, streams, marine waters and bodies of open water, such as lakes, ponds and reservoirs; 2. Impoundments, such as reservoirs or ponds, if any portion of the contributing water is from a nonwetland water feature listed in subsection A.1. of this section; and 3. Above-ground open water conveyance systems, such as ditches, if any portion of the contributing water is from either a wetland or a nonwetland water feature listed in subsection A.1. or A.2. of this section, or both.B. "Aquatic areas" does not include water features where the source of contributing water is entirely artificial, including, but not limited to, ground water wells. (Ord. 19034 § 8, 2019: Ord. 17191 § 19, 2011: Ord. 15051 § 7, 2004).21A.06.073 Artist studio. Artist studio: an establishment providing a place solely for the practice or rehearsal of various performing or creative arts; including, but not limited to, acting, dancing, singing, drawing, painting and sculpting. (Ord. 13022 § 1, 1998).21A.06.075 Auction house. Auction house: an establishment where the property of others is sold by a broker or auctioneer to persons who attend scheduled sales periods or events. (Ord. 10870 § 55, 1993).21A.06.078 Bank stabilization. Bank stabilization: an action taken to minimize or avoid the erosion of materials from the banks of rivers and streams. (Ord. 15051 § 8, 2004).21A.06.080 Base flood. Base flood: a flood having a one percent chance of being equaled or exceeded in any given year, often referred to as the "100-year flood." (Ord. 10870 § 56, 1993).21A.06.085 Base flood elevation. Base flood elevation: the elevation to which floodwater is anticipated to rise during the base flood. (Ord. 19128 § 4, 2020: Ord. 10870 § 57, 1993).21A.06.087 Battery energy storage system.Battery energy storage system: A system consisting of one or more rechargeable batteries assembled together, capable of storing energy in order to supply electrical energy at a future time. Such systems typically include battery chargers, controls, power conditioning systems, and associated electrical equipment, and are typically used to provide standby or emergency power, uninterruptable power supply, load shedding, load sharing, smoothing and dispatching of intermittent renewable energy sources, or similar capabilities. (Ord. 19824 § 5, 2024).21A.06.090 Bed and breakfast guesthouse. Bed and breakfast guesthouse: a dwelling unit or accessory building within which bedrooms are available for paying guests. (Ord. 10870 § 58, 1993).21A.06.095 Beehive. Beehive: a structure designed to contain one colony of honey bees (apis mellifera). (Ord. 10870 § 59, 1993).21A.06.097 Berm. Berm: a constructed area of compacted earth. (Ord. 12987 § 1, 1998).21A.06.098 Best management practice. Best management practice: a schedule of activities, prohibitions of practices, physical structures, maintenance procedures and other management practices undertaken to reduce pollution or to provide habitat protection or maintenance. (Ord. 15051 § 10, 2004).21A.06.100 Billboard. Billboard: a sign, including both the supporting structural framework and attached billboard faces, used principally for advertising a business activity, use, product, or service unrelated to the primary use or activity of the property on which the billboard is located; excluding off-premise directional, or temporary real estate signs. (Ord. 10870 § 60, 1993).21A.06.105 Billboard face. Billboard face: that portion of a billboard, exclusive of its structural support, on which changeable advertising copy is displayed, either by affixing preprinted poster panels or by painting copy on location; subclassified as follows:A. Billboard face I -- a billboard face not exceeding a height of 14 feet or a width of 48 feet, and may also include temporary and irregularly shaped extensions subject to the area and duration limitations in K.C.C. 21A.20; andB. Billboard face II -- a billboard face not exceeding a height of 12 feet or a width of 24 feet. (Ord. 10870 § 61, 1993).21A.06.108 Bioengineering. Bioengineering: the use of vegetation and other natural materials such as soil, wood and rock to stabilize soil, typically against slides and stream flow erosion. When natural materials alone do not possess the needed strength to resist hydraulic and gravitational forces, "bioengineering" may consist of the use of natural materials integrated with human-made fabrics and connecting materials to create a complex matrix that joins with in-place native materials to provide erosion control. (Ord. 15051 § 11, 2004).21A.06.111 Bioretention. A. Bioretention: A stormwater best management practice consisting of a shallow landscaped depression designed to temporarily store and promote infiltration of stormwater runoff. (Ord. 18257 § 21, 2016).21A.06.113 Bog. Bog: a wetland that has no significant inflows or outflows and supports acidophilic mosses, particularly sphagnum. (Ord. 15051 § 13, 2004).21A.06.115 Book, stationery, video and art supply store. Book, stationery, video and art supply store: an establishment engaged in the retail sale of books and magazines, stationery, records and tapes, video and art supplies, including only uses located in SIC Industry Nos.:A. 5942-Book Stores;B. 5943-Stationery Stores;C. 5999-Architectural Supplies and Artists' Supply and Materials Stores;D. 7841-Video tape rental;E. 5735-Record, compact disc and prerecorded tape stores; andF. 5736-Musical Instrument stores. (Ord. 10870 § 63, 1993).21A.06.118 Breakwater. Breakwater: an off-shore structure either floating or not that may or may not be connected to the shore, such structure being designated to absorb or reflect back into the water body the energy of the waves. (Ord. 16985 § 65, 2010: Ord. 3688 § 208, 1978. Formerly K.C.C. 25.08.090).21A.06.120 Broadleaf tree. Broadleaf tree: a tree characterized by leaves that are broad in width and may include both deciduous and evergreen species. (Ord. 10870 § 64, 1993).21A.06.122 Buffer. Buffer: a designated area contiguous to a steep slope or landslide hazard area intended to protect slope stability, attenuation of surface water flows and landslide hazards or a designated area contiguous to and intended to protect and be an integral part of an aquatic area or wetland. (Ord. 15051 § 14, 2004: Ord. 10870 § 70, 1993).21A.06.125 Building. Building: any structure having a roof. (Ord. 10870 § 65, 1993).21A.06.135 Building envelope. Building envelope: area of a lot that delineates the limits of where a building may be placed on the lot. (Ord. 10870 § 67, 1993).21A.06.140 Building facade. Building facade: that portion of any exterior elevation of a building extending from the grade of the building to the top of the parapet wall or eaves, for the entire width of the building elevation. (Ord. 10870 § 68, 1993).21A.06.145 Building materials and hardware store. Building materials and hardware store: an establishment engaged in selling lumber and other building materials, paint and glass; including, but not limited to uses located in SIC Major Group No. 52-Building Materials, Hardware, Garden Supply, and Mobile Home Dealers, but excluding retail nursery, garden center and farm supply stores and mobile home dealers. (Ord. 15974 § 2, 2007: 10870 § 69, 1993).21A.06.155 Bulk retail. Bulk retail: an establishment offering the sale of bulk goods to the general public, including limited sales to wholesale customers. These establishments offer a variety of lines of merchandise including but not limited to: food, building, hardware and garden materials, dry goods, apparel and accessories, home furnishings, housewares, drugs, auto supplies, hobby, toys, games, photographic, and electronics. (Ord. 10870 § 71, 1993).21A.06.156 Bulkhead. "Bulkhead" means a solid or open pile wall of rock, concrete, steel or timber or other materials or a combination of these materials erected generally parallel to and near the ordinary high water mark for the purpose of protecting adjacent wetlands and uplands from waves or currents. (Ord. 16985 § 68, 2010: Ord. 3688 § 209, 1978. Formerly K.C.C. 25.08.100).21A.06.158 Camp, agriculture-related special needs. Camp, agriculture-related special needs: An establishment primarily engaged in operating a camp for youths with special needs due to a disability, as defined by the American with Disabilities Act of 1990, or due to medical conditions, that engages in activities that are related to or coexist with agriculture and agricultural activities onsite. Agriculture-related special needs camps do not include establishments that have as a primary purpose the treatment of addictions, correctional or disciplinary training, or housing for homeless persons. (Ord. 15909 § 1, 2007).21A.06.160 Campground. Campground: an area of land developed for recreational use in temporary occupancy, such as: tents or recreational vehicles without hook-up facilities. (Ord. 10870 § 72, 1993).21A.06.162 Camps, recreational and retreat. Camps, recreational and retreat: Establishments primarily engaged in operating recreational and retreat camps that offer a variety of active recreational activities such as trail riding, hiking, hunting, water-related activities such as swimming, kayaking, canoeing, rafting and fishing, and other similar outdoor activities, as well as, more passive activities based on the enjoyment of the natural setting. Recreational and retreat camps may provide overnight accommodation facilities, such as cabins and designated campsites, and other amenities for site users, such as meeting and assembly spaces, food services, recreational facilities and equipment and medical/health stations. Recreational and retreat camps do not include establishments that have as a primary purpose the treatment of addictions, correctional or disciplinary training, or housing for homeless persons. (Ord. 15606 § 4, 2006: Ord. 15245 § 1, 2005).21A.06.165 Capacity, school. Capacity, school: the number of students a school district's facilities can accommodate district-wide, based on the district's standard of service, as determined by the school district. (Ord. 10870 § 73, 1993).21A.06.170 Capital facilities plan, school. Capital facilities plan, school: a district's facilities plan adopted by the school board consisting of:A. A forecast of future needs for school facilities based on the district's enrollment projections;B. The long-range construction and capital improvements projects of the district;C. The schools under construction or expansion;D. The proposed locations and capacities of expanded or new school facilities;E. At least a six-year financing plan component, updated as necessary to maintain at least a six-year forecast period, for financing needed school facilities within projected funding levels, and identifying sources of financing for such purposes, including bond issues authorized by the voters and projected bond issues not yet authorized by the voters;F. Any other long-range projects planned by the district.G. The current capacity of the district's school facilities based on the districts adopted standard of service, and a plan to eliminate existing deficiencies, if any, without the use of impact fees; andH. An inventory showing the location and capacity of existing school facilities. (Ord. 10870 § 74, 1993).21A.06.172 Catastrophic collapse. Catastrophic collapse: The collapse of the ground surface by overburden caving into underground voids created by mining. Catastrophic collapse does not include the effects from trough subsidence. (Ord. 13319 § 2, 1998).21A.06.175 Cattery, commercial. Cattery, commercial: an establishment or facility where four or more cats are kept for commercial purposes, including, but not limited to, boarding, breeding and training. (Ord. 17841 § 10, 2014: Ord. 10870 § 75, 1993).21A.06.177 Cattery, hobby.A. Cattery, hobby: means a noncommercial cattery at or adjoining a private residence where four or more cats are bred or kept for exhibition for organized shows or the enjoyment of the species.B. For purposes of this section, "noncommercial purposes" includes: 1. The breeding and sale of no more than two litters per applicable license year per female cat; and 2. The training of cats, but not for compensation. (Ord. 17841 § 11, 2014).21A.06.180 Cemetery, columbarium or mausoleum. Cemetery, columbarium or mausoleum: land or structures used for interment of the dead or their remains. For purposes of the code, pet cemeteries are considered a subclassification of this use. (Ord. 10870 § 76, 1993).21A.06.181 Channel. Channel: a feature that contains and was formed by periodically or continuously flowing water confined by banks. (Ord. 15051 § 15, 2004).21A.06.181C Channel edge. Channel edge: The outer edge of the water's bankfull width or, where applicable, the outer edge of the associated channel migration zone. (Ord. 15051 § 16, 2004).21A.06.181E Channel migration hazard area, moderate. Channel migration hazard area, moderate: a portion of the channel migration zone, as shown on King County's Channel Migration Zone maps, that lies between the severe channel migration hazard area and the outer boundaries of the channel migration zone. (Ord. 15051 § 17, 2004).21A.06.181G Channel migration hazard area, severe. Channel migration hazard area, severe: a portion of the channel migration zone, as shown on King County's Channel Migration Zone maps, in which there is a higher level of channel migration hazard due to a high likelihood of continued, progressive bank erosion, rapid shifting of channel location or other imminent channel changes. (Ord. 17485 § 14, 2012: Ord. 15051 § 18, 2004).21A.06.182 Channel migration zone. Channel migration zone: the area along a river channel within which the channel can be reasonably predicted, based on best available science, to migrate over time as a result of natural and normally occurring hydrological and related processes when considered with the characteristics of the river and its surroundings, as follows:A. In areas located outside King County's shoreline jurisdiction, channel migration zones are as shown on King County's Channel Migration Zone maps. In those areas, "channel migration zone" means the corridor that includes the present channel, the severe channel migration hazard area and the moderate channel migration hazard area;B. In areas located in King County's shoreline jurisdiction, the channel migration zone include: 1. Areas shown on King County's Channel Migration zone maps, including both the severe channel migration hazard area and the moderate channel migration hazard area; and 2. Areas not shown on King County's Channel Migration Zone maps but located within the floodplain. (Ord. 17485 § 15, 2012: Ord. 16985 § 130, 2010: Ord. 15051 § 19, 2004: Ord. 11621 § 20, 1994).21A.06.185 Church, synagogue or temple. Church, synagogue or temple: a place where religious services are conducted, including those uses located in SIC Industry No. 866 and including accessory uses in the primary or accessory buildings such as religious education, reading rooms, assembly rooms, and residences for nuns and clergy. This definition does not include facilities for training of religious orders. (Ord. 10870 § 77, 1993).21A.06.190 Classrooms, school. Classrooms, school: educational facilities of the district required to house students for its basic educational program. The classrooms are those facilities the district determines are necessary to best serve its student population. Specialized facilities as identified by the district, including but not limited to gymnasiums, cafeterias, libraries, administrative offices, and child care centers, shall not be counted as classrooms. (Ord. 10870 § 78, 1993).21A.06.195 Clearing. Clearing: cutting, killing, grubbing or removing vegetation or other organic plant material by physical, mechanical, chemical or any other similar means. For the purpose of this definition of "clearing," "cutting" means the severing of the main trunk or stem of woody vegetation at any point. (Ord. 15051 § 20, 2004; Ord. 10870 § 79, 1993).21A.06.196 Clustering. Clustering: development of a subdivision at the existing zoned density that reduces the size of individual lots and creates natural open space for the preservation of critical areas, parks and permanent open space or as a reserve for future development. (Ord. 15606 § 5, 2006).21A.06.197 Coal mine by-products stockpile. Coal mine by-products stockpile: an accumulation, greater than five hundred cubic yards and five feet of vertical depth, of undisturbed waste and/or byproduct materials having greater than fifty percent, as measured by weight, of coal or coal shale as a component and which resulted from historic coal mining. (Ord. 19146 § 33, 2020: Ord. 13319 § 3, 1998).21A.06.200 Coal mine hazard area. Coal mine hazard area: an area underlain or directly affected by operative or abandoned subsurface coal mine workings. (Ord. 15051 § 21, 2004: Ord. 13319 § 1, 1998: Ord. 10870 § 80, 1993).21A.06.202 Coastal high hazard area. Coastal high hazard area: Coastal high hazard area means an area of special flood hazard extending from offshore to the inland limit of a primary frontal dune along an open coast and any other area subject to high velocity wave action from storms or seismic sources. The area is designated on the Flood Insurance Rate Maps as VE or AE zones that are immediately adjacent to the VE zone. (Ord. 19128 § 5, 2020: Ord. 17173 § 1, 2011).21A.06.205 Cogeneration. Cogeneration: the sequential generation of energy and useful heat from the same primary source or fuel for industrial, commercial, or residential heating or cooling purposes. (Ord. 10870 § 81, 1993).21A.06.208 Commercial salmon net pens. Commercial salmon net pens: underwater net facilities used for the raising of salmonid species, whether or not they are indigenous to the Puget Sound region for commercial purposes. (Ord. 19034 § 9, 2019).21A.06.210 Communication facility, major. Major communication facility: a communication facility, not classified as a minor communication facility, for transmission of:A. Television signals; or B. FM or AM radio signals. (Ord. 17191 § 23, 2011: Ord. 10870 § 82, 1993).21A.06.215 Communication facility, minor. Minor communication facility: a communication facility for the: A. Transmission and reception of: 1. Two-way or citizen band ("CB") radio signals; or 2. Point-to-point microwave signals; 3. Signals through FM radio translators; or 4. Signals through FM radio boosters under ten watts effective radiated power ("ERP"); andB. Provision of personal wireless services. (Ord. 17191 § 24 2011: Ord. 10870 § 83, 1993).21A.06.217 Community identification sign. Community identification sign: a sign identifying the location of a community or geographic area such as unincorporated activity centers or rural towns designated by the comprehensive plan. (17416 § 14, 2012: Ord. 13022 § 2, 1998).21A.06.219 Community preference. Community preference: a process to identify people with a current or past connection to specific community service area subarea geographies, including:A. People who are current or former residents of that geography;B. People with a parent, guardian or ancestor who are current or former residents of that geography;C. People who are current or former residents within one half mile of the inclusionary housing project; orD. People who use, participate in, volunteer or work for an organization located in that geography, including but not limited to cultural or faith-based organizations, nonprofit organizations, businesses or community centers. (19555 § 8, 2022).21A.06.220 Community residential facility ("CRF"). Community residential facility ("CRF"): living quarters meeting applicable federal and state standards that function as a single housekeeping unit and provide supportive services, including but not limited to counseling, rehabilitation and medical supervision, excluding drug and alcohol detoxification which is classified in K.C.C. 21A.08.050 as health services, and excluding a secure community transition facility as defined in R.C.W. 71.09.020 and in this chapter. For purposes of domestic violence shelters, minors living with a parent shall not be counted as part of the maximum number of residents. CRFs are further classified as follows:A. CRF-I -- Nine to ten residents and staff;B. CRF-II -- Eleven or more residents and staff.If staffed by nonresident staff, each twenty-four staff hours per day equals one full-time residing staff member for purposes of subclassifying CRFs. (Ord. 16040 § 2, 2008: Ord. 14503 § 1, 2002: Ord. 10870 § 84, 1993).21A.06.223 Commuter parking lot. Commuter parking lot: vehicle parking specifically for the purpose of access to a public transit system or for users of carpools or vanpools. (Ord. 13022 § 3, 1998).21A.06.225 Compensatory storage. Compensatory storage: new, excavated storage volume equivalent to any flood storage that is eliminated by building filling or grading within the floodplain. (Ord. 16172 § 2, 2008: Ord. 10870 § 85, 1993).21A.06.230 Conditional use permit. Conditional use permit: permit granted by the county to locate a permitted use on a particular property subject to conditions placed on the permitted use to ensure compatibility with nearby land uses. (Ord. 10870 § 86, 1993).21A.06.235 Conference center. Conference center: an establishment developed primarily as a meeting facility, including only facilities for recreation, overnight lodging, and related activities provided for conference participants. (Ord. 10870 § 87, 1993).21A.06.240 Confinement area. Confinement area. A confinement area is any open land area in which livestock are kept where the forage does not meet the definition of a grazing area. (Ord. 11157 § 2, 1993: Ord. 10870 § 88, 1993).21A.06.245 Consolidation. Consolidation: the relocation to a consolidated transmission structure of the main transmit antennae of two or more FCC broadcast licensees which prior to such relocation utilized transmission structures located within a 1500 foot radius of the center of the consolidated transmission structure to support their main transmit antennae. (Ord. 10870 § 89, 1993).21A.06.247 Construction and trades. Construction and trades: establishments that provide services related to construction of buildings and infrastructure, and other improvements to property. Such establishments include, SIC Major group no.'s 15-17, and SIC Industry group no. 078 (Landscape and Horticultural Services). (Ord. 12243 § 4, 1996).21A.06.250 Construction cost per student, school. Construction cost per student, school: the estimated cost of construction of a permanent school facility in the district for the grade span of school to be provided, as a function of the district's facilities standard per grade span and taking into account the requirements of students with special needs. (Ord. 10870 § 90, 1993).21A.06.251 Consumer-scale renewable energy system. Consumer-scale renewable energy system: a facility that produces on-site energy using renewable resources, such as solar, wind or geothermal, for the property on which the facility is located. A consumer-scale renewable energy system does not include energy generated at a scale for sale or donation to others, excluding net metering. (Ord. 19146 § 29, 2020).21A.06.252 Conversion factor. Conversion factor: a number that converts the water budget allowance from acre-inches per acre per year to gallons per square foot per year or cubic feet per year. (Ord. 11210 § 25, 1994).21A.06.253 County fairground facility. County fairground facility: a site permanently designated and improved for holding a county fair, as provided in chapters 15.76 and 36.37 RCW. A county fairground facility may be used for hosting social, educational, recreational, arts and entertainment activities including, but not limited to:A. Regional and local festivals;B. Agricultural shows and events;C. Animal shows;D. Training, seminars, classes and conferences;E. Trade and specialty shows;F. Private and public parties, receptions or banquets;G. Sporting events;H. Carnivals;I. Circuses;J. Recreational vehicle parks;K. Campgrounds;L. Outdoor performance centers; andM. Retail, rental and services consistent with the fairgrounds. (Ord. 14808 § 1, 2003).21A.06.253C Critical aquifer recharge area. Critical aquifer recharge area: an area designated on the critical aquifer recharge area map adopted by K.C.C. 21A.24.311 that has a high susceptibility to ground water contamination or an area of medium susceptibility to ground water contamination that is located within a sole source aquifer or within an area approved in accordance with chapter 246-290 WAC as a wellhead protection area for a municipal or district drinking water system, or an area over a sole source aquifer and located on an island surrounded by saltwater. Susceptibility to ground water contamination occurs where there is a combination of permeable soils, permeable subsurface geology and ground water close to the ground surface. (Ord. 15051 § 23, 2004: Ord. 11481 § 1, 1994. Formerly K.C.C. 21A.06.253C).21A.06.254 Critical area. Critical area: any area that is subject to natural hazards or a land feature that supports unique, fragile or valuable natural resources including fish, wildlife or other organisms or their habitats or such resources that carry, hold or purify water in their natural state. "Critical area" includes the following areas:A. Aquatic areas;B. Coal mine hazard areas;C. Critical aquifer recharge area;D. Erosion hazard areas;E. Flood hazard areas;F. Landslide hazard areas;G. Seismic hazard areas;H. Steep slope hazard areas;I. Volcanic hazard areas;J. Wetlands;K. Wildlife habitat conservation areas; andL. Wildlife habitat networks. (Ord. 15051 § 24, 2004).21A.06.255 Critical drainage area. Critical drainage area: an area which has been formally determined by the King County surface water management department to require more restrictive regulation than county-wide standards afford in order to mitigate severe flooding, drainage, erosion or sedimentation problems which result from the cumulative impacts of development and urbanization. (Ord. 10870 § 91, 1993).21A.06.260 Critical facility. Critical facility: a facility necessary to protect the public health, safety and welfare including, but not limited to, a facility defined under the occupancy categories of "essential facilities," "hazardous facilities" and "special occupancy structures" in the structural forces chapter or succeeding chapter in K.C.C. Title 16. Critical facilities also include nursing and personal care facilities, schools, senior citizen assisted housing, public roadway bridges and sites that produce, use or store hazardous substances or hazardous waste, not including the temporary storage of consumer products containing hazardous substances or hazardous waste intended for household use or for retail sale on the site. (Ord. 15051 § 25, 2004: Ord. 10870 § 92, 1993).21A.06.261 Critical saltwater habitat. Critical saltwater habitat: all kelp beds, eelgrass beds, spawning and holding areas for forage fish, such as herring, smelt and sandlance; and subsistence, commercial and recreational shellfish beds; and mudflats, intertidal habitats with vascular plants and areas with which priority species have a primary association. (Ord. 16985 § 128, 2010).21A.06.262 Daily care. Daily care: medical procedures, monitoring and attention that are necessarily provided at the residence of the patient by the primary provider of daily care on a 24-hour basis. (Ord. 12523 § 2, 1996).21A.06.265 Daycare. Daycare: an establishment for group care of non-resident adults or children.A. Daycare shall include only, SIC Industry No. 835, Child Day Care Services, SIC Industry No. 8322, Adult Daycare Centers and the following: 1.Adult Daycare, such as adult day health centers or social day care as defined by the Washington State Department of Social and Health Services; 2. Nursery schools for children under minimum age for education in public schools; 3. Privately conducted kindergartens or prekindergartens when not a part of a public or parochial school; and 4. Programs covering after-school care for school children.B. Daycare establishments are subclassified as follows: 1. Daycare I -- a maximum of 12 adults or children in any 24 hour period; and 2. Daycare II -- over 12 adults or children in any 24 hour period. (Ord. 10870 § 93, 1993).21A.06.270 Deciduous. Deciduous: a plant species with foliage that is shed annually. (Ord. 10870 § 94, 1993).21A.06.275 Development rights, transfer of ("TDR"). Development rights, transfer of ("TDR"): the ability to transfer potentially buildable dwelling units from an eligible sending site to an eligible receiving site as provided in this code. (Ord. 14190 § 25, 2001: Ord. 10870 § 95, 1993).21A.06.280 Department. Department: the King County department of local services or its successor. (Ord. 18791 § 163, 2018: Ord. 17420 § 97, 2012: Ord. 15051 § 26, 2004: Ord. 10870 § 96, 1993).21A.06.285 Department and variety store. Department and variety store: an establishment engaged in the retail sale of a variety of lines of merchandise, such as; dry goods, apparel and accessories, home furnishings, housewares, including only uses located in SIC Major Group and Industry Nos.:A. 53-General Merchandise;B. 5947-Gift, Novelty, and Souvenir Shops; andC. 5948-Luggage and Leather Goods Stores. (Ord. 10870 § 97, 1993).21A.06.290 Destination resort. Destination resort: an establishment for resource-based recreation and intended to utilize outdoor recreational opportunities, including related services, such as food, overnight lodging, equipment rentals, entertainment and other conveniences for guests of the resort. (Ord. 10870 § 98, 1993).21A.06.295 Developer or applicant. Developer or applicant: the person or entity who owns or holds purchase options or other development control over property for which development activity is proposed. [See Applicant 21A.06.070.] (Ord. 11978 § 2, 1995: Ord. 10870 § 99, 1993).21A.06.300 Development activity. Development activity: any residential construction or expansion of a building, structure or use, any change in use of a building or structure, or any change in the use of land that creates additional demand for school facilities. (Ord. 10870 § 100, 1993).21A.06.305 Development agreement.Development agreement:A. A recorded agreement between a UPD applicant and King County which incorporates the site plans, development standards, and other features of an Urban Plan Development as described in K.C.C. chapter 21A.39; orB. An agreement authorized under RCW 36.70B.170 through 36.70B.210. (Ord. 19648 § 47, 2023: Ord. 10870 § 101, 1993).21A.06.310 Development proposal. Development proposal: any activities requiring a permit or other approval from King County relative to the use or development of land. (Ord. 10870 § 102, 1993).21A.06.315 Development proposal site. Development proposal site: the legal boundaries of the parcel or parcels of land for which an applicant has or should have applied for authority from King County to carry out a development proposal. (Ord. 10870 § 103, 1993).21A.06.318 Digester, agricultural anaerobic. Digester, agricultural anaerobic: an air tight, oxygen-free container that is fed animal manure and other agricultural waste that uses a biological process to stabilize organic matter and produce methane gas for onsite energy generation or other beneficial use. (Ord. 17191 § 20, 2011).21A.06.320 Direct traffic impact. Direct traffic impact: any increase in vehicle traffic generated by a proposed development which equals or exceeds ten (10) peak hour, peak direction vehicle trips on any roadway or intersection. (Ord. 10870 § 104, 1993).21A.06.325 Director. Director: the department of local services permitting division manager or designee. (Ord. 18791 § 164, 2018: Ord. 18683 § 48, 2018: Ord. 17420 § 98, 2012: Ord. 10870 § 105, 1993).21A.06.326 Ditch. Ditch: an artificial open channel used or constructed for the purpose of conveying water. (Ord. 15051 § 27, 2004).21A.06.328 Dog training facility. Dog training facility: a place for the training of dogs for discipline, agility and other purposes. (Ord. 15032 § 3, 2004).21A.06.330 Dormitory. Dormitory: a residential building that provides sleeping quarters, but not separate dwelling units, and may include common dining, cooking and recreation or bathing facilities. (Ord. 10870 § 106, 1993).21A.06.331 Draft flood boundary work map. Draft flood boundary work map: a floodplain map prepared by a mapping partner, reflecting the results of a flood study or other floodplain mapping analysis. The draft flood boundary work map depicts floodplain boundaries, FEMA floodway and zero-rise floodway boundaries, base flood elevations and flood cross-sections, and provides the basis for the presentation of this information on a Preliminary Flood Insurance Rate Map or Flood Insurance Rate Map. (Ord. 19128 § 6, 2020: Ord. 15051 § 28, 2004).21A.06.332 Drainage basin. Drainage basin: a drainage area that drains to the Cedar river, Green river, Snoqualmie river, Skykomish river, White river, Lake Washington or other drainage area that drains directly to Puget Sound. (Ord. 15051 § 29, 2004).21A.06.332C Drainage facility. Drainage facility: a feature, constructed or engineered for the primary purpose of providing drainage, that collects, conveys, stores or treats surface water. A drainage facility may include, but is not limited to, a stream, pipeline, channel, ditch, gutter, lake, wetland, closed depression, flow control or water quality treatment facility and erosion and sediment control facility. (Ord. 15051 § 30, 2004).21A.06.333 Drainage subbasin. Drainage subbasin: a drainage area identified as a drainage subbasin in a county-approved basin plan or, if not identified, a drainage area that drains to a body of water that is named and mapped and contained within a drainage basin. (Ord. 15051 § 31, 2004).21A.06.333A Dredging. Dredging: the removal, displacement or disposal of unconsolidated earth material such as sand, silt, gravel or other materials, from water bodies, ditches or natural wetlands, whether during submerged conditions or dry conditions. Dredging includes maintenance dredging and support activities. (Ord. 16985 § 70, 2010: Ord. 5734 § 1, 1981. Formerly K.C.C. 25.08.175).21A.06.334 Drift cell. Drift cell: an independent segment of shoreline along which littoral movements of sediments occur at noticeable rates depending on wave energy and currents. Each drift cell typically includes one or more sources of sediment, such as a feeder bluff or stream outlet that spills sediment onto a beach, a transport zone within which the sediment drifts along the shore and an accretion area; an example of an accretion area is a sand spit where the drifted sediment material is deposited. (Ord. 15051 § 32, 2004).21A.06.335 Drop box facility. Drop box facility: a facility used for receiving solid waste and recyclable from off-site sources into detachable solid waste containers, including the adjacent areas necessary for entrance and exit roads, unloading and vehicle turnaround areas. Drop box facilities normally service the general public with loose loads and may also include containers for separated recyclable. (Ord. 10870 § 107, 1993).21A.06.340 Drug store. Drug store: an establishment engaged in the retail sale of prescription drugs, nonprescription medicines, cosmetics and related supplies, including only uses located in SIC Industry Group and Industry Nos.:A. 591-Drug Stores and Proprietary Stores;B. 5993-Tobacco Stores and Stands; andC. 5999-Cosmetics Stores. (Ord. 10870 § 108, 1993).21A.06.345 Dwelling unit. Dwelling unit: one or more rooms designed for occupancy by a person or family for living and sleeping purposes, containing kitchen facilities and rooms with internal accessibility, for use solely by the dwelling's occupants; dwelling units include but are not limited to bachelor, efficiency and studio apartments, factory-built housing and mobile homes. (Ord. 10870 § 109, 1993).21A.06.350 Dwelling unit, accessory. Dwelling unit, accessory: a separate, complete dwelling unit attached to or contained within the structure of the primary dwelling; or contained within a separate structure that is accessory to the primary dwelling unit on the premises. (Ord. 10870 § 110, 1993).21A.06.352 Dwelling unit, affordable. Dwelling unit, affordable: a dwelling unit reserved for occupancy by households having housing expenses at an affordability level no greater than thirty percent of a given percent of the King County AMI adjusted for household size. (Ord. 19555 § 9, 2022).21A.06.355 Dwelling unit, apartment. Dwelling unit, apartment: a dwelling unit contained in a building consisting of two or more dwelling units which may be stacked, or one or more dwellings with nonresidential uses. (Ord. 10870 § 111, 1993).21A.06.358 Dwelling unit, cottage housing. Dwelling unit, cottage housing: a detached single-family dwelling unit located on a commonly owned parcel with common open space. (Ord. 15032 § 4, 2004)21A.06.362 Dwelling unit, market-rate. Dwelling unit, market-rate: a dwelling unit that is not restricted to a specified affordable rent or sale price. (Ord. 19555 § 10, 2022).21A.06.365 Dwelling unit, single detached. Dwelling unit, single detached: a detached building containing one dwelling unit. (Ord. 10870 § 113, 1993).21A.06.370 Dwelling unit, townhouse. Dwelling unit, townhouse: a building containing one dwelling unit that occupies space from the ground to the roof, and is attached to one or more other townhouse dwellings by common walls. (Ord. 10870 § 114, 1993).21A.06.375 Earth station. Earth station: a communication facility which transmits and/or receives signals to and from an orbiting satellite using satellite dish antennas. (Ord. 10870 § 115, 1993).21A.06.378 Ecosystem. Ecosystem: the complex of a community of organisms and its environment functioning as an ecological unit. (Ord. 15051 § 33, 2004).21A.06.380 Effective radiated power. Effective radiated power: the product of the antenna power input and the numerical antenna power gain. (Ord. 10870 § 116, 1993).21A.06.385 Electric vehicle. Electric vehicle: A vehicle registered for on-road use, primarily powered by an electric motor that draws current from a rechargeable storage source that is charged by being plugged into an electrical current source. (Ord. 19316 § 2, 2021).21A.06.386 Electric-vehicle load management system. Electric-vehicle load management system: A system designed to allocate charging capacity among multiple electric vehicle supply equipment. (Ord. 19316 § 3, 2021).21A.06.387 Electric-vehicle-ready parking space. Electric-vehicle-ready parking space: A parking space that is provided with a minimum 208/240-volt dedicated branch circuit for electric-vehicle supply equipment that is terminated at a receptacle, junction box or electric-vehicle supply equipment within the parking space in order to allow for future installation of electric-vehicle supply equipment. (Ord. 19316 § 4, 2021).21A.06.388 Electric-vehicle supply equipment. Electric-vehicle supply equipment: The conductors, including the ungrounded, grounded and equipment-grounding conductors, and the electric-vehicle connectors, attachment plugs, personnel protection system and all other fittings, devices, power outlets or apparatus installed specifically for the purpose of transferring energy between the premises' wiring and an electric vehicle. (Ord. 19316 § 5, 2021).21A.06.389 Electric-vehicle-supply-equipment parking space. Electric-vehicle-supply-equipment parking space: A parking space with electric-vehicle supply equipment capable of supplying current at a minimum of 208/240 volts, either by electric-vehicle supply equipment that directly serves the parking space or by adjacent electric-vehicle supply equipment capable of serving multiple parking spaces simultaneously. (Ord. 19316 § 6, 2021).21A.06.390 Electrical substation. Electrical substation: a site containing equipment for the conversion of high voltage electrical power transported through transmission lines into lower voltages transported through distribution lines and suitable for individual users. (Ord. 10870 § 118, 1993).21A.06.392 Emergency. Emergency: an occurrence during which there is imminent danger to the public health, safety and welfare, or that poses an imminent risk of property damage or personal injury or death as a result of a natural or human-made catastrophe, as determined by the director. (Ord. 15051 § 34, 2004: Ord. 11621 § 21, 1994).21A.06.393 Employee, agricultural. Employee, agricultural: A person who renders personal services to, or under the direction of, an agricultural employer in connection with the employer's agricultural activity. (Ord. 15974 § 3, 2007).21A.06.395 Energy resource recovery facility. Energy resource recovery facility: an establishment for recovery of energy in a usable form from mass burning or refuse-derived fuel incineration, pyrolysis or any other means of using the heat of combustion of solid waste. (Ord. 10870 § 119, 1993).21A.06.398 Engineer, civil, geotechnical and structural. Engineer, civil, geotechnical and structural:A. Civil engineer: an engineer who is licensed as a professional engineer in the branch of civil engineering by the state of Washington;B. Geotechnical engineer: an engineer who is licensed as a professional engineer by the state of Washington and who has at least four years of relevant professional employment; andC. Structural engineer: an engineer who is licensed as a professional engineer in the branch of structural engineering by the state of Washington. (Ord. 15051 § 35, 2004).21A.06.400 Enhancement. Enhancement: for the purposes of critical area regulation, an action that improves the processes, structure and functions of ecosystems and habitats associated with critical areas or their buffers. (Ord. 15051 § 36, 2004: Ord. 10870 § 120, 1993).21A.06.401 Environment, shoreline. Environment, shoreline: the categories of shorelines and shorelands established by the King County shoreline master program to differentiate between areas whose features imply differing objectives regarding their use and future development. (Ord. 16985 § 72, 2010: Ord. 3688 § 218, 1978. Formerly K.C.C. 25.08.190).21A.06.402 Environmental education project. Environmental education project: A project that facilitates learning where the emphasis is placed on relationships between people and natural resources. Environmental education projects include, but are not limited to:A. Bird blinds;B. Observation decks;C. Boardwalks; andD. Signs or kiosks (Ord. 16267 § 11, 2008).21A.06.405 Equipment, heavy. Equipment, heavy: high-capacity mechanical devices for moving earth or other materials, and mobile power units including, but not limited to:A. Carryalls;B. Graders;C. Loading and unloading devices;D. Cranes;E. Drag lines;F. Trench diggers;G. Tractors;H. Augers;I. Bulldozers;J. Concrete mixers and conveyers;K. Harvesters;L. Combines; orM. Other major agricultural equipment and similar devices operated by mechanical power as distinguished from human-powered equipment. (Ord. 18683 § 49, 2018: Ord. 10870 § 121, 1993).21A.06.410 Erosion. Erosion: the wearing away of the ground surface as the result of the movement of wind, water or ice. (Ord. 15051 § 37, 2004: Ord. 10870 § 122, 1993).21A.06.415 Erosion hazard area. Erosion hazard area: an area underlain by soils that is subject to severe erosion when disturbed. These soils include, but are not limited to, those classified as having a severe to very severe erosion hazard according to the United States Department of Agriculture Soil Conservation Service, the 1990 Snoqualmie Pass Area Soil Survey, the 1973 King County Soils Survey or any subsequent revisions or addition by or to these sources such as any occurrence of River Wash ("Rh") or Coastal Beaches ("Cb") and any of the following when they occur on slopes inclined at fifteen percent or more:A. The Alderwood gravely sandy loam ("AgD");B. The Alderwood and Kitsap soils ("AkF");C. The Beausite gravely sandy loam ("BeD" and "BeF");D. The Kitsap silt loam ("KpD");E. The Ovall gravely loam ("OvD" and "OvF");F. The Ragnar fine sandy loam ("RaD"); andG. The Ragnar-Indianola Association ("RdE"). (Ord. 15051 § 38, 2004: Ord. 10870 § 123, 1993).21A.06.420 Evergreen. Evergreen: a plant species with foliage that persists and remains green year round. (Ord. 10870 § 124, 1993).21A.06.425 Examiner. Examiner: the [zoning and subdivision]* [office of the hearing]** examiner. (Ord. 18230 § 127, 2016: Ord. 10870 § 125, 1993).Reviser’s notes:*Deleted in Ordinance 18230, but not in the form required by K.C.C. 1.24.075.**Added but not underlined In Ordinance 18230. See K.C.C. 1.24.075.21A.06.427 Expansion. Expansion: the act or process of increasing the size, quantity or scope. (Ord. 15051 § 39, 2004).21A.06.430 Fabric shop. Fabric shop: an establishment engaged in the retail sale of sewing supplies and accessories, including only uses located in SIC Industry Nos.: A. 5949-Sewing, Needlework, and Piece Goods Stores; andB. Awning Shops, Banner Shops, and Flag Shops found in 5999. (Ord. 10870 § 126, 1993).21A.06.435 Facilities standard. Facilities standard: the space required by grade span, and taking into account the requirements of students with special needs, which is needed in order to fulfill the educational goals of the school district as identified in the district's capital facilities plan. (Ord. 10870 § 127, 1993).21A.06.440 Factory-built commercial building. Factory-built commercial building: any structure that is either entirely or substantially prefabricated or assembled at a place other than a building site; and designed or used for non-residential human occupancy. (Ord. 10870 § 128, 1993).21A.06.445 Fairground. Fairground: a site permanently constructed for holding a fair, except a county fair or for holding similar events, including, but not limited to:A. Carnivals;B. Circuses;C. Expositions;D. Animal shows; andE. Either exhibitions or demonstrations, or both, of farm and home products with accompanying entertainment and amusements. (Ord. 14808 § 2, 2003: Ord. 10870 § 129, 1993).21A.06.450 Family. Family: an individual; two or more persons related by blood, marriage or state registered domestic partnership under chapter 26.60 RCW; a group of two or more disabled residents protected under the Federal Housing Act Amendments, who are not related by blood, marriage or state registered domestic partnership under chapter 26.60 RCW, living together as a single housekeeping unit; a group of eight or fewer residents, who are not related by blood, marriage or state registered domestic partnership under chapter 26.60 RCW, living together as a single housekeeping unit; or a group living arrangement where eight or fewer residents receive supportive services such as counseling, foster care, or medical supervision at the dwelling unit by resident or non-resident staff. For purposes of this definition, minors living with parent shall not be counted as part of the maximum number of residents. (Ord. 17191 § 22, 2011: Ord. 11621 § 30, 1994: 10870 § 130, 1993).21A.06.450F Farm. Farm: the land, buildings equipment and infrastructure used in the raising and production of agricultural products for commercial sales. (Ord. 18626 § 13, 2017).21A.06.451 Farm field access drive. Farm field access drive: an impervious surface constructed to provide a fixed route for moving livestock, produce, equipment or supplies to and from farm fields and structures. (Ord. 15051 § 41, 2004).21A.06.451A Farm pad. Farm pad; an artificially created mound of earth or an elevated platform placed within a flood hazard area and constructed to an elevation that is above the base flood elevation to provide an area of refuge for livestock or small animals, and for storage of farm vehicles, agricultural equipment and shelter for farm products including, but not limited to, feed, seeds, flower bulbs and hay. (Ord. 16172 § 1, 2008).21A.06.451M Farmers market. Farmers market: a regular assembly of vendors at a defined location for the purpose of promoting the sale of agricultural products grown or produced in Washington state. (Ord. 17191 § 21, 2011).21A.06.451R Farm residence. Farm residence: a single detached dwelling unit that serves as the primary residence for a farm. (Ord. 18626 § 14, 2017).21A.06.452 Feasible. Feasible: capable of being done or accomplished. (Ord. 15051 § 40, 2004).21A.06.453 Federal Emergency Management Agency. Federal Emergency Management Agency: the federal agency that, among other responsibilities, oversees the administration of the National Flood Insurance Program. (Ord. 19128 § 7, 2020: Ord. 15051 § 42, 2004).21A.06.454 FEMA. FEMA: the Federal Emergency Management Agency. (Ord. 15051 § 43, 2004).21A.06.455 FEMA floodway. FEMA floodway: the channel of the stream or other watercourse and the adjacent land areas that must be reserved in order to discharge the base flood without cumulatively increasing the water surface elevation more than a designated height at any point. The FEMA floodway is delineated on the Flood Insurance Rate Map and on King County Surface Water Design Manual major floodplain or floodway studies. (Ord. 19128 § 8, 2020: Ord. 15051 § 44, 2004: Ord. 10870 § 131, 1993).21A.06.460 Feed store. Feed store: an establishment engaged in retail sale of supplies directly related to the day to day activities of agricultural production. (Ord. 10870 § 132, 1993).21A.06.464 Fen. Fen: a wetland that receives some drainage from surrounding mineral soil and includes peat formed mainly from Carex and marsh-like vegetation. (Ord. 15051 § 45, 2004).21A.06.465 Fence. Fence: a barrier for the purpose of enclosing space or separating lots, composed of:A. Masonry or concrete walls, excluding retaining walls; orB. Wood, metal or concrete posts connected by boards, rails, panels, wire or mesh. (Ord. 10870 § 133, 1993).21A.06.467 Financial guarantee. Financial guarantee means a form of financial security posted to ensure timely and proper completion of improvements, to ensure compliance with the King County Code, and/or to warranty materials, quality of work of the improvements, and design. Financial guarantees include assignments of funds, cash deposit, and surety bonds, and or other forms of financial security acceptable to the director. For the purposes of this title, the terms performance guarantee, maintenance guarantee, and defect guarantee are considered sub-categories of financial guarantee. (Ord. 18683 § 50, 2018: Ord. 12020 § 32, 1995).21A.06.468 Firearm. Firearm: a weapon or device from which a projectile or projectiles may be fired by an explosive such as gunpowder. Firearm does not include a flare gun or other pyrotechnic visual distress signaling device, or a powder-actuated tool or other device designed solely to be used for construction purposes. (Ord. 19146 § 30, 2020).21A.06.469 Float. Float: a structure or device that is not a breakwater and that is moored, anchored or otherwise secured in the waters of King County and is not connected to the shoreline. (Ord. 16985 § 74, 2010: Ord. 3688 § 220, 1978. Formerly K.C.C. 25.08.210).21A.06.470 Flood fringe, zero-rise. Flood fringe, zero-rise: that portion of the floodplain outside of the zero-rise floodway. The zero-rise flood fringe is generally associated with standing water rather than rapidly flowing water. (Ord. 15051 § 46, 2004: Ord. 10870 § 134, 1993).21A.06.475 Flood hazard area. Flood hazard area: any area subject to inundation by the base flood or risk from channel migration including, but not limited to, an aquatic area, wetland or closed depression. A flood hazard area may contain one or more of the following components:A. Floodplain;B. Special flood hazard area, as shown on the Flood Insurance Rate Maps;C. Zero-rise flood fringe;D Zero-rise floodway;E. FEMA floodway; andF. Channel migration zones. (Ord. 19128 § 9, 2020: Ord. 17841 § 12, 2014: Ord. 15051 § 47, 2004: Ord. 11621 § 31, 1994: Ord. 10870 § 135, 1993).21A.06.478 Flood hazard data. Flood hazard data: data or any combination of data available from federal, state or other sources including, but not limited to, maps, critical area studies, reports, historical flood hazard information, channel migration zone maps or studies or other related engineering and technical data that identify floodplain boundaries, FEMA floodway or zero-rise floodway boundaries, base flood elevations or flood-cross sections. (Ord. 19128 § 10, 2020: Ord. 15051 § 49, 2004).21A.06.480 Flood Insurance Rate Map. Flood Insurance Rate Map: the official map of a community on which the Federal Emergency Management Agency has delineated the FEMA Floodway, special flood hazard areas and the risk premium zones applicable to the community. (Ord. 19128 § 11, 2020: Ord. 15051 § 50, 2004: Ord. 11157 § 3, 1993: Ord. 10870 § 136, 1993).21A.06.485 Flood Insurance Study. Flood Insurance Study: the official report entitled Flood Insurance Study for King County, Washington and Incorporated Areas, dated August 19, 2020, provided by FEMA that includes flood profiles and the Flood Insurance Rate Map, and revisions thereto. (Ord. 19128 § 12, 2020: Ord. 17841 § 13, 2014: Ord. 15051 § 51, 2004: Ord. 11157 § 4, 1993: Ord. 10870 § 137, 1993).21A.06.490 Flood protection elevation. Flood protection elevation: an elevation that is three feet above the base flood elevation. (Ord. 19128 § 13, 2020: Ord. 16686 § 1, 2009: Ord. 16267 § 12, 2008: Ord. 15051 § 52, 2004: Ord. 10870 § 138, 1993).21A.06.492 Flood protection facility. Flood protection facility: a structure that provides protection from flood damage. Flood protection facility includes, but is not limited to, the following structures and supporting infrastructure:A. Dams or water diversions, regardless of primary purpose, if the facility provides flood protection benefits;B. Flood containment facilities such as levees, dikes, berms, walls and raised banks, including pump stations and other supporting structures; andC. Bank stabilization structures, often called revetments. (Ord. 15051 § 53, 2004).21A.06.495 Floodplain. Floodplain: the total area subject to inundation by the base flood. (Ord. 10870 § 139, 1993).21A.06.497 Floodplain development.A. Floodplain development: any human-made change to improved or unimproved real estate in the floodplain, including, but not limited to, buildings or other structures, mining, dredging, filling, grading, paving, excavation or drilling operations, storage of equipment or materials, subdivision or short subdivision of land and removal of more than five percent of the native vegetation on the site.B. Examples of human-made changes that are not considered "floodplain development" include: 1. Routine maintenance of landscaping that does not involve grading, excavation or filling; 2. Removal of noxious weeds or invasive vegetation and replacement of nonnative vegetation with native vegetation; 3. Removal of a hazard tree; 4. Maintenance of the public road right-of-way outside of the floodplain as shown on the Flood Insurance Rate Map, unless otherwise specified in K.C.C. Title 9 or the Surface Water Design Manual; and 5. Agricultural activities with a low-impact on flood hazards, including tilling, discing, planting, seeding, harvesting, preparing soil, rotating crops, fertilizing, grazing and related activity that does not include grading or fill. (Ord. 19128 § 14, 2020: Ord. 17539 § 18, 2013).21A.06.500 Floodproofing, dry. Floodproofing, dry: adaptations that make a structure that is below the flood protection elevation watertight with walls substantially impermeable to the passage of water and with structural components capable of and with sufficient strength to resist hydrostatic and hydrodynamic loads including buoyancy. (Ord. 15051 § 54, 2004: Ord. 10870 § 140, 1993).21A.06.505 Floodway, zero-rise. Floodway, zero-rise: the channel of a stream and that portion of the adjoining floodplain that is necessary to contain and discharge the base flood flow without any measurable increase in base flood elevation.A. For the purpose of this definition, "measurable increase in base flood elevation" means a calculated upward rise in the base flood elevation, equal to or greater than 0.01 foot, resulting from a comparison of existing conditions and changed conditions directly attributable to alterations of the topography or any other flow obstructions in the floodplain. "Zero-rise floodway" is broader than that of the FEMA floodway but always includes the FEMA floodway.B. "Zero-rise floodway" includes the entire floodplain unless a critical areas report demonstrates otherwise. (Ord. 15051 § 55, 2004: Ord. 10870 § 141, 1993).21A.06.510 Florist shop. Florist shop: an establishment engaged in the retail sale of flowers and plants, including only uses located in SIC Industry Nos.:A. 5992-Florists; andB. 5999-Artificial Flowers. (Ord. 10870 § 142, 1993).21A.06.512 Footprint. Footprint: the area encompassed by the foundation of a structure including building overhangs if the overhangs do not extend more than eighteen inches beyond the foundation and excluding uncovered decks. (Ord. 15051 § 56, 2004).21A.06.513 Footprint, development. Footprint, development: the area encompassed by the foundations of all structures including paved and impervious surfaces. (Ord. 15051 § 57, 2004)21A.06.514 Forecourt. Forecourt: The open area forming an entrance plaza for a single building or several buildings in a group. (Ord. 19687 § 5, 2023).21A.06.515 Forest land. Forest land: land devoted primarily to growing and harvesting forest and timber products and designated as a forest production district by the King County Comprehensive Plan. (Ord. 10870 § 143, 1993).21A.06.517 Forest management activity. Forest management activity: a forest practice regulated as a Class I, II, III or IV-S forest practice under chapter 76.09 RCW and Title 222 WAC or that is conducted in accordance with a forest management plan approved by the department of natural resources and parks. (Ord. 17539 § 19, 2013).21A.06.520 Forest practice. Forest practice: any forest practice as defined in RCW 79.06.020*. (Ord. 15051 § 58, 2004: Ord. 10870 § 144, 1993).*Reviser’s note: RCW 79.06.020 is erroneous. RCW 76.09.020 was apparently intended.21A.06.525 Forest product sales. Forest product sales: the sale of goods produced, extracted, consumed, gathered or harvested from a forest including, but not limited to:A. Trees;B. Wood chips;C. Logs;D. Fuelwood;E. Cones;F. Christmas trees;G. Berries;H. Herbs; orI. Mushrooms. (Ord. 10870 § 145, 1993).21A.06.530 Forest research. Forest research: the performance of scientific studies relating to botany, hydrology, silviculture, biology and other branches of science in relation to management of forest lands, including only uses located in SIC Industry Nos.:A. 8731-Commercial Physical and Biological Research;B. 8733-Noncommercial Research Organizations; andC. 8734-Testing Laboratories. (Ord. 10870 § 146, 1993).21A.06.531 Forestry. Forestry: the science and practice of planting, cultivating, managing, using and conserving trees, forests and associated resources. "Forestry" includes, but is not limited to, scientific research related to forests and forest management for the harvesting of timber, production of forest products, recreation, aesthetics and ecological enhancement. (Ord. 17539 § 20, 2013).21A.06.532 Fossil fuel facility. Fossil fuel facility: a commercial facility used primarily to receive, store, refine, process, transfer, wholesale trade or transport fossil fuels, such as, but not limited to, bulk terminals, bulk storage facilities, bulk refining and bulk handling facilities. Fossil fuel facilities do not include: individual storage facilities of up to thirty thousand gallons and total cumulative facilities per site of sixty thousand gallons for the purposes of retail or direct-to-consumer sales, facilities or activities for local consumption; noncommercial facilities, such as storage for educational, scientific or governmental use; or uses preempted by federal rule or law. (Ord. 19146 § 35, 2020).21A.06.532C Fossil fuels. Fossil fuels: petroleum and petroleum products, coal and natural gas, such as methane, propane and butane, derived from prehistoric organic matter and used to generate energy. Fossil fuels do not include:A. Petrochemicals that are used primarily for non-fuel products, such as asphalt, plastics, lubricants, fertilizer, roofing and paints;B. Fuel additives, such as denatured ethanol and similar fuel additives, or renewable fuels, such as biodiesel or renewable diesel with less than five percent fossil fuel content; orC. Methane generated from the waste management process, such as wastewater treatment, anaerobic digesters, landfill waste management, livestock manure and composting processes. (Ord. 19146 § 34, 2020).21A.06.533 Fully contained community (FCC). FCC: a site specific development project consisting of conceptual site plan(s), development standards, processing and other elements, and which is consistent with the criteria provided in RCW 36.70A.350. (Ord. 12171 § 3, 1996).21A.06.535 Furniture and home furnishings store. Furniture and home furnishings store: an establishment engaged in the retail sale of household furniture and furnishings for the home, including only uses located in SIC Major Group and Industry Nos.:A. 57-Home Furniture, Furnishings, and Equipment Stores, except Industry Group No. 573; andB. Baby carriages, Cake Decorating Supplies, Hot Tubs, Picture Frames (ready made), Swimming Pools (above-ground, not site-built), Telephone Stores and Typewriter Stores found in 5999. (Ord. 10870 § 147, 1993).21A.06.537 Gateway sign. Gateway sign: A sign or fixed display where the content is adopted by ordinance as government speech with King County acting in its capacity as the general government for unincorporated King County. (Ord. 18659 § 1, 2018).21A.06.540 General business service. General business service: an establishment engaged in providing services to businesses or individuals, with no outdoor storage or fabrication, including only uses located in SIC Major Group Nos.:A. 60-Depository Institutions;B. 61-Nondepository Credit Institutions;C. 62-Security and Commodity Brokers, Dealers, Exchanges, and Services;D. 63-Insurance Carriers;E. 65-Real Estate, except 653 (Real Estate Agents and Directors);F. 67-Holding and Other Investment Offices;G. 7299 Miscellaneous Personal Services, not elsewhere classified;H. 73-Business Services, except Industry Group and Industry Nos.:I. 7312-Outdoor Advertising Services; andJ. 86-Membership Organizations, including administrative offices of organized religions found in 8661, but excluding churches and places of worship. (Ord. 10870 § 148, 1993).21A.06.543 Geoduck aquaculture. Geoduck aquaculture: the culture or farming of geoduck, excluding the harvest of wild geoduck associated with the state-managed wildstock geoduck fishery, including planting and harvesting activities. (Ord. 19034 § 10, 2019).21A.06.545 Geologist. Geologist: a person who holds a current license from the Washington state Geologist Licensing Board. (Ord. 15051 § 60, 2004: Ord. 10870 § 149, 1993).21A.06.555 Golf course facility. Golf course facility: a recreational facility, under public or private ownership, designed and developed for golf activities with accessory uses including, but not limited to:A. A driving range;B. Miniature golf;C. Pro shops;D. Caddyshack buildings;E. Swimming pools, tennis courts and other related recreational facilities;F. Restaurants;G. Office and meeting rooms; andH. Related storage facilities. (Ord. 11157 § 5, 1993: Ord. 10870 § 152, 1993).21A.06.558 Grade. Grade: the elevation of the ground surface. "Existing grade," "finish grade" and "rough grade" are defined as follows:A. "Existing grade" means the grade before grading;B. "Finish grade" means the final grade of the site that conforms to the approved plan as required under K.C.C. 16.82.060; andC. "Rough grade" means the grade that approximately conforms to the approved plan as required under K.C.C. 16.82.060. (Ord. 15051 § 62, 2004).21A.06.560 Grade span. Grade span: the categories into which a district groups its grades of students; i.e., elementary, middle or junior high school, and high school. (Ord. 10870 § 152, 1993).21A.06.565 Grading. Grading: any excavation, filling, removing the duff layer or any combination thereof. (Ord. 10870 § 153, 1993).21A.06.570 Grazing area. Grazing area: a grazing area is any open land area used to pasture livestock in which suitable forage is maintained over 80% of the area at all times of the year. (Ord. 11157 § 6, 1993: Ord. 10870 § 154, 1993).21A.06.573 Groin. Groin: a barrier type structure extending from the backshore into the water across the beach. The purpose of a groin is to interrupt sediment movement along the shore. (Ord. 16985 § 76, 2010: Ord. 3688 § 222, 1978. Formerly K.C.C. 25.08.230).21A.06.575 Groundcover. Groundcover: living plants designed to grow low to the ground (generally one foot or less) and intended to stabilize soils and protect against erosion. (Ord. 10870 § 155, 1993).21A.06.577 Habitat. Habitat: the locality, site and particular type of environment occupied by an organism at any stage in its life cycle. (Ord. 15051 § 63, 2004).21A.06.578 Habitat, fish. Habitat, fish: habitat that is used by anadromous or resident salmonids at any life stage at any time of the year including potential habitat likely to be used by anadromous or resident salmonids. "Fish habitat" includes habitat that is upstream of, or landward of, human-made barriers that could be accessible to, and could be used by, fish upon removal of the barriers. This includes off-channel habitat, flood refuges, tidal flats, tidal channels, streams and wetlands. (Ord. 16267 § 13, 2008: Ord. 15051 § 64, 2004).21A.06.580 Hazardous household substance. Hazardous household substance: a substance as defined in RCW?70.105.010. (Ord. 10870 § 156, 1993).21A.06.582 Hazardous liquid and gas transmission pipeline. Hazardous liquid and gas transmission pipeline: Hazardous liquid and gas transmission pipelines, as defined by RCW 81.88.040 and WAC 480-93-005. (Ord. 14045 § 4, 2001).21A.06.585 Hazardous substance. Hazardous substance: a substance as defined in RCW 70.105.010. (Ord. 10870 § 157, 1993).21A.06.590 Heavy equipment and truck repair. Heavy equipment and truck repair: the repair and maintenance of self-powered, self-propelled or towed mechanical devices, equipment and vehicles used for commercial purposes, such as tandem axle trucks, graders, backhoes, tractor trailers, cranes, lifts, but excluding automobiles and pick-up trucks under 10,000 pounds, recreational vehicles, boats and their trailers. (Ord. 11621 § 32, 1994: 10870 § 158, 1993).21A.06.595 Helistop. Helistop: an area on a roof or on the ground used for the takeoff and landing of helicopters for the purpose of loading or unloading passengers or cargo but not including fueling service, hangers, maintenance or overhaul facilities. (Ord. 10870 § 159, 1993).21A.06.597 Historic resource. Historic resource: a district, site, building, structure or object significant in national, state or local history, architecture, archaeology, and culture. (Ord. 11621 § 22, 1994). 21A.06.598 Historic resource inventory. Historic resource inventory: An organized compilation of information on historic resources considered to be potentially significant according to the criteria listed in K.C.C. 20.62.040A. The historic resource inventory is kept on file by the historic preservation officer and is updated from time to time to include newly eligible resources and to reflect changes to resources. (Ord. 11621 § 23, 1994).21A.06.599 Historical flood hazard information. Historical flood hazard information: information that identifies floodplain boundaries, FEMA floodway or zero-rise floodway boundaries, base flood elevations or flood cross-sections, including, but not limited to, photos, video recordings, high water marks, survey information or news agency reports. (Ord. 19128 § 15, 2020: Ord. 15051 § 65, 2004).21A.06.600 Hobby, toy, and game shop. Hobby, toy, and game shop: an establishment engaged in the retail sale of toys, games, hobby and craft kits, including only uses located in SIC Industry Nos.:A. 5945-Hobby, Toy and Game Shops; and B. 5999-Autograph and Philatelist Supply Stores, Coin Shops, and Stamps, philatelist-retail (except mail order). (Ord. 10870 § 160, 1993).21A.06.605 Home industry. Home industry: a limited-scale sales, service or fabrication activity undertaken for financial gain, which occurs in a dwelling unit or residential accessory building, or in a barn or other resource accessory building and is subordinate to the primary use of the site as a residence. (Ord. 13022 § 7, 1998: Ord. 10870 § 161, 1993).21A.06.610 Home occupation. Home occupation: a limited-scale service or fabrication activity undertaken for financial gain, which occurs in a dwelling unit or accessory building and is subordinate to the primary use of the site as a residence. (Ord. 13022 § 8, 1998: Ord. 10870 § 162, 1993).21A.06.615 Household pets. Household pets: small animals that are kept within a dwelling unit. (Ord. 10870 § 163, 1993).21A.06.620 Hydroelectric generation facility. Hydroelectric generation facility: an establishment for the generation of electricity using water sources. (Ord. 10870 § 164, 1993).21A.06.625 Impervious surface. Impervious surface: A nonvertical surface artificially covered or hardened so as to prevent or impede the percolation of water into the soil mantle at natural infiltration rates including, but not limited to, roofs, swimming pools and areas that are paved, graveled or made of packed or oiled earthen materials such as roads, walkways or parking areas. "Impervious surface" does not include landscaping and surface water flow control and water quality treatment facilities. (15051 § 66, 2004: Ord. 13190 § 14, 1998: Ord. 11978 § 3, 1995: Ord. 11802 § 2, 1995: Ord. 10870 § 165, 1993).21A.06.628 Impoundment. Impoundment: a body of water collected in a reservoir, pond or dam or collected as a consequence of natural disturbance events. (Ord. 15051 § 67, 2004).21A.06.630 Improved public roadways. Improved public roadways: public road rights-of-way that have been improved with at least two travel lanes and are maintained by either King County or the state of Washington. (Ord. 10870 § 166, 1993).21A.06.635 Individual transportation and taxi. Individual transportation and taxi: an establishment engaged in furnishing individual or small group transportation by motor vehicle, including only uses located in SIC Industry Group and Industry Nos.:A. 412-Taxicabs; andB. 4119-Local Passenger Transportation, not elsewhere Classified. (Ord. 10870 § 167, 1993).21A.06.637 Infiltration rate. Infiltration rate: the rate of water entry into the soil expressed in inches per hour. (Ord. 11210 § 27, 1994).21A.06.638 Instream structure. Instream structure: anything placed or constructed below the ordinary high water mark, including, but not limited to, weirs, culverts, fill and natural materials and excluding dikes, levees, revetments and other bank stabilization facilities. (Ord. 15051 § 68, 2004).21A.06.640 Interim recycling facility. Interim recycling facility: a site or establishment engaged in collection or treatment of recyclable materials, which is not the final disposal site, and including:A. Drop boxes;B. Collection, separation and shipment of glass, metal, paper or other recyclables. (Ord. 15032 § 5, 2004: Ord. 10870 § 168, 1993).21A.06.641 Interlocal agreement. Interlocal agreement: for purposes of K.C.C. 21A.28, interlocal agreement means any agreement between the county, the district, and any city setting forth certain terms relating to the collection of impact fees by the county and distribution of those fees to the district. An interlocal agreement shall not be required where the county is the sole jurisdiction within the boundaries of the district that is assessing impact fees. (Ord. 11621 § 24, 1994).21A.06.641C Invasive vegetation. Invasive vegetation: a plant species listed as obnoxious weeds on the noxious weed list adopted King County department of natural resources and parks. (Ord. 15051 § 69, 2004).21A.06.642 Irrigation efficiency. Irrigation efficiency: is the coefficient of the amount of water beneficially used divided by the amount of water applied. This coefficient is derived from actual measurements and an evaluation of the general characteristics of the type of irrigation system and management practices proposed. (Ord. 11210 § 26, 1994).21A.06.645 Jail. Jail: a facility operated by a governmental agency; designed, staffed and used for the incarceration of persons for the purposes of punishment, correction and rehabilitation following conviction of an offense. (Ord. 10870 § 169, 1993).21A.06.650 Jail farm. Jail farm: a farm or camp on which persons convicted of minor law violations are confined and participate in agriculture and other work activities of the facility. (Ord. 10870 § 170, 1993).21A.06.653 Jetty. Jetty: an artificial barrier used to change the natural littoral drift to protect inlet entrances from clogging by excess sediment. (Ord. 16985 § 78, 2010: Ord. 3688 § 224, 1978. Formerly K.C.C. 25.08.250).21A.06.655 Jewelry store. Jewelry store: an establishment engaged in the retail sale of a variety of jewelry products, including only uses located in SIC Industry Nos.:A. 5944-Jewelry Stores; andB. Gem stones and Rock specimens found in 5999. (Ord. 10870 § 171, 1993).21A.06.658 Joint use driveway. Joint use driveway: A jointly owned and/or maintained vehicular access to two residential properties. (Ord. 11621 § 25, 1994).21A.06.660 Kennel, commercial. Kennel, commercial: an establishment or facility where four or more dogs are kept for commercial purposes, including, but not limited to, boarding, breeding and training. A commercial kennel does not include a dog daycare facility. (Ord. 17841 § 14, 2014: Ord. 10870 § 172, 1993).21A.06.660A Kennel, hobby.A. Kennel, hobby: a noncommercial kennel at or adjoining a private residence where four or more adult dogs are bred or kept for any combination of hunting, training and exhibition for organized shows, for field, working or obedience trials or for the enjoyment of the species.B. For purposes of this section, "noncommercial purposes" includes: 1. The breeding and sale of no more than one litter per applicable license year per female dog; and 2. The training of dogs, but not for compensation. (Ord. 17841 § 15, 2014).21A.06.661 Kennel-free dog boarding and daycare. Kennel-free dog boarding and daycare: Dog boarding or daycare facility that utilizes rooms or outdoor exercise area, rather than cages or cement floored runs, to allow for and encourage the socialization, interaction and exercise of dogs. (Ord. 15816 § 3, 2007).21A.06.662 Kitchen or kitchen facility. Kitchen or kitchen facility: an area within a building intended for the preparation and storage of food and containing:A. An appliance for the refrigeration of food;B. An appliance for the cooking or heating of food; andC. A sink. (Ord. 12786 § 1, 1997).21A.06.665 Landfill. Landfill: a disposal site or part of a site at which refuse is deposited. (Ord. 10870 § 173, 1993).21A.06.667 Landscape water features. Landscape water features: a pond, pool or fountain used as a decorative component of a development. (Ord. 11210 § 28, 1994).21A.06.670 Landscaping. Landscaping: live vegetative materials required for a development. Said materials provided along the boundaries of a development site is referred to as perimeter landscaping. (Ord. 11210 § 36, 1994: Ord. 10870 § 174, 1993).21A.06.675 Landslide. Landslide: episodic downslope movement of a mass including, but not limited to, soil, rock or snow. (Ord. 10870 § 175, 1993).21A.06.680 Landslide hazard area. Landslide hazard area: an area subject to severe risk of landslide, such as:A. An area with a combination of: 1. Slopes steeper than fifteen percent of inclination; 2. Impermeable soils, such as silt and clay, frequently interbedded with granular soils, such as sand and gravel; and 3. Springs or ground water seepage;B. An area that has shown movement during the Holocene epoch, which is from ten thousand years ago to the present, or that is underlain by mass wastage debris from that epoch;C. Any area potentially unstable as a result of rapid stream incision, stream bank erosion or undercutting by wave action;D. An area that shows evidence of or is at risk from snow avalanches; orE. An area located on an alluvial fan, presently or potentially subject to inundation by debris flows or deposition of stream-transported sediments. (Ord. 15051 § 70, 2004: Ord. 10870 § 176, 1993).21A.06.685 Level of service (LOS), traffic. Level of service ("LOS") traffic: a quantitative measure of traffic congestion identified by a declining letter scale (A-F) as calculated by the methodology contained in the 1985 Highway Capacity Manual Special Report 209 or as calculated by another method approved by the department of local services. LOS "A" indicates free flow of traffic with no delays while LOS "F" indicates jammed conditions or extensive delay. (Ord. 18791 § 165, 2018: Ord. 14199 § 231, 2001: Ord. 10870 § 177, 1993).21A.06.690 Light equipment. Light equipment: hand-held tools and construction equipment, such as chain saws, wheelbarrows and post-hole diggers. (Ord. 10870 § 178, 1993).21A.06.695 Livestock. Livestock: grazing animals kept either in open fields or structures for training, boarding, home use, sales, or breeding and production, including but not limited to:A. Cattle;B. Riding and draft horses;C. Hogs, excluding pigs weighing under 120 lbs. and standing 20 inches or less at the shoulder which are kept as pets or small animals;D. Sheep; andE. Goats. (Ord. 10870 § 179, 1993).21A.06.700 Livestock, large. Livestock, large: cattle, horses, and other livestock generally weighing over 500 pounds. (Ord. 10870 § 180, 1993).21A.06.705 Livestock, small. Livestock, small: hogs, excluding pigs weighing under 120 lbs. and standing 20 inches or less at the shoulder which are kept as household pets or small animals, sheep, goats, miniature horses, llamas, alpaca and other livestock generally weighing under 500 pounds. (Ord. 10870 § 181, 1993).21A.06.707 Livestock heavy use area. Livestock heavy use area: an enclosure, typically constructed with footing material, such as gravel, used to keep grazing livestock off pasture from late fall through early spring or when pastures are grazed down to reduce soil erosion, protect water quality and improve pasture productivity, aesthetics and livestock health. (Ord. 17539 § 21, 2013). 21A.06.708 Livestock manure storage facility. Livestock manure storage facility: an impoundment made by constructing an embankment, pit or structure for the purpose of temporarily storing manure, liquid or slurry manure, agricultural wastewater or other organic agricultural waste before agronomic use to facilitate nutrient management and protect water quality. (Ord. 17539 § 22, 2013). 21A.06.710 Livestock sales. Livestock sales: the sale of livestock but not including auctions. (Ord. 10870 § 182, 1993).21A.06.715 Loading space. Loading space: a space for the temporary parking of a vehicle while loading or unloading cargo or passengers. (Ord. 10870 § 183, 1993).21A.06.717 Local distribution gas storage tank. Local distribution gas storage tank: a tank from which illuminating, heating, or liquefied gas is distributed by piping directly to individual users. A local distribution gas storage tank is not a fossil fuel facility. (Ord. 19146 § 32, 2020: Ord. 11157 § 29, 1993: Formerly K.C.C. 21A.06.150).21A.06.720 Log storage. Log storage: a facility for the open or enclosed storage of logs which may include repair facilities for equipment used on-site or operations offices. (Ord. 10870 § 184, 1993).21A.06.725 Lot. Lot: a physically separate and distinct parcel of property, which has been created pursuant to K.C.C. Title 19, Subdivision. (Ord. 10870 § 185, 1993).21A.06.730 Lot line, interior. Lot line, interior: lot lines that delineate property boundaries along those portions of the property which do not abut a street. (Ord. 10870 § 186, 1993).21A.06.731 Maintenance. Maintenance: the usual acts to prevent a decline, lapse or cessation from a lawfully established condition without any expansion of or significant change from that originally established condition. Activities within landscaped areas within areas subject to native vegetation retention requirements may be considered "maintenance" only if they maintain or enhance the canopy and understory cover. "Maintenance" includes repair work but does not include replacement work. When maintenance is conducted specifically in accordance with the Regional Road Maintenance Guidelines, the definition of "maintenance" in the glossary of those guidelines supersedes the definition of "maintenance" in this section. (Ord. 15051 § 73, 2004).21A.06.732 Manufactured home or mobile home. Manufactured home or mobile home: a structure, transportable in one or more sections, that in the traveling mode is eight body feet or more in width or thirty-two body feet or more in length; or when erected on site, is three-hundred square feet or more in area; which is built on a permanent chassis and is designated for use with or without a permanent foundation when attached to the required utilities; which contains plumbing, heating, air-conditioning and electrical systems; and shall include any structure that meets all the requirements of this section, or of chapter 296-150M WAC, except the size requirements for which the manufacturer voluntarily complies with the standards and files the certification required by the federal Department of Housing and Urban Development. The term "manufactured home" or "mobile home" does not include a "recreational vehicle." (Ord. 15606 § 6, 2006: Ord. 15051 § 74, 2004).21A.06.734 Mapping partner. Mapping partner: any organization or individual that is involved in the development and maintenance of a draft flood boundary work map, Preliminary Flood Insurance Rate Map or Flood Insurance Rate Map. (Ord. 15051 § 75, 2004).21A.06.7341 Marijuana. Marijuana: all parts of the plant cannabis, whether growing or not, with a percentage concentration of delta-9 tetrahydrocannabinol content per dry weight of any part of the plant cannabis, or per volume or weight of marijuana product greater than 0.3 percent on a dry weight basis; the seeds thereof; the resin extracted from any part of the plant; and every compound, manufacture, salt, derivative, mixture, or preparation of the plant, its seeds or resin. Marijuana does not include the mature stalks of the plant, fiber produced from the stalks, oil or cake made from the seeds of the plant, any other compound, manufacture, salt, derivative, mixture or preparation of the mature stalks (except the resin extracted therefrom), fiber, oil, or cake, or the sterilized seed of the plant which is incapable of germination. (Ord. 17710 § 2, 2013).21A.06.7342 Marijuana greenhouse. Marijuana greenhouse: a structure with a glass or rigid plastic roof and glass or rigid plastic walls designed and used to create an artificial climate for the growing of marijuana as licensed by the Washington state Liquor Control Board for the marijuana production that is of sufficient strength and stability to comply with the structural design load requirements of the building code and that is not used as a place for human habitation or by the general public. (Ord. 17710 § 3, 2013).21A.06.7344 Marijuana processor. Marijuana processor: a facility licensed by the Washington state Liquor and Cannabis Board to process marijuana into useable marijuana and marijuana-infused products, package and label useable marijuana and marijuana-infused products for sale in retail outlets, and sell useable marijuana and marijuana-infused products at wholesale to marijuana retailers. Marijuana processors are classified as follows:A. Marijuana processor I -- processing that is limited to: 1. Drying, curing and trimming; and 2. Packaging.B. Marijuana processor II -- all elements of processing including: 1. All marijuana processor I activities; 2. Extracting concentrates and infusing products; 3. Mechanical and chemical processing; and 4. Packaging. (Ord. 18326 § 10, 2016: Ord. 17710 § 4, 2013).21A.06.7346 Marijuana producer. Marijuana producer: a facility licensed by the Washington state Liquor and Cannabis Board for the production and sale at wholesale of marijuana to marijuana processors and other marijuana producers. (Ord. 18326 § 11, 2016: Ord. 17710 § 5, 2013).21A.06.7348 Marijuana retailer. Marijuana retailer: a facility licensed by the Washington state Liquor and Cannabis Board where useable marijuana and marijuana-infused products may be sold at retail. (Ord. 18326 § 12, 2016: Ord. 17710 § 6, 2013).21A.06.735 Marina. Marina: an establishment providing docking, moorage space and related activities limited to the provisioning or minor repair of pleasure boats and yachts; and accessory facilities including, but not limited to:A. Showers;B. Toilets; andC. Self-service laundries. (Ord. 10870 § 187, 1993).21A.06.738 Master program, shoreline. Master program, shoreline: the comprehensive shoreline use plan for King County consisting of:A. The King County shoreline management goals and policies, set forth in King County Comprehensive Plan Chapter 6, that guide environmental designations, shoreline protection, shoreline use and shoreline modifications; andB. The development regulations identified in K.C.C. 20.12.200. (Ord. 18767 § 2, 2018: Ord. 16985 § 80, 2010: Ord. 3688 § 228, 1978. Formerly K.C.C. 25.08.290).21A.06.740 Material error. Material error: substantive information upon which a permit decision is based that is submitted in error or is omitted at the time of permit application. (Ord. 10870 § 188, 1993).21A.06.742 Materials processing facility. Materials processing facility: A. A site or establishment, not accessory to a mineral extraction or sawmill use, that is primarily engaged in crushing, grinding, pulverizing or otherwise preparing earth materials, vegetation, organic waste, construction and demolition materials or source separated organic materials and that is not the final disposal site; andB. A site or establishment lawfully established before October 10, 2004, as an interim recycling facility for processing source separated, organic materials. (Ord. 17539 § 23, 2013: Ord. 15032 § 6, 2004)21A.06.743 Maximum extent practical. Maximum extent practical: the highest level of effectiveness that can be achieved through the use of best available science or technology. In determining what is the "maximum extent practical," the department shall consider, at a minimum, the effectiveness, engineering feasibility, commercial availability, safety and cost of the measures. (Ord. 15051 § 76, 2004).21A.06.745 Microwave. Microwave: electromagnetic waves with a frequency range of 300 megahertz (MHz) to 300 gigahertz (GHz). (Ord. 10870 § 189, 1993).21A.06.747 Midblock connection. Midblock connection: An at-grade pedestrian, cycling, or vehicle connection that is accessible to the public and extends through a block, parcel, or lot, and includes but is not limited to a walkway, path, street, or limited access route through public or private land. (Ord. 19687 § 6, 2023).21A.06.750 Mitigation. Mitigation: an action taken to compensate for adverse impacts to the environment resulting from a development activity or alteration. (Ord. 15051 § 77, 2004: Ord. 10870 § 190, 1993).21A.06.751 Mitigation bank. Mitigation bank: a property that has been protected in perpetuity and approved by appropriate county, state and federal agencies expressly for the purpose of providing compensatory mitigation in advance of authorized impacts through any combination of restoration, creation or enhancement of wetlands and, in exceptional circumstances, preservation of adjacent wetlands and wetland buffers or protection of other aquatic or wildlife resources. (Ord. 15051 § 78, 2004: Ord. 11621 § 26, 1994).21A.06.752 Mitigation banking. Mitigation banking: a system for providing compensatory mitigation in advance of authorized wetland impacts of development in King County in which credits are generated through restoration, creation, and/or enhancement of wetlands, and in exceptional circumstances, preservation of adjacent wetlands, wetland buffers, and/or other aquatic resources. (Ord. 11621 § 27, 1994). 21A.06.753 Mixed-use development. Mixed-use development: a combination of residential and non-residential uses within the same building or site as part of an integrated development project with functional interrelationships and coherent physical design. (Ord. 14045 § 5, 2001).21A.06.755 Mobile home. See manufactured home. (Ord. 15606 § 7, 2006: Ord. 10870 § 191, 1993).21A.06.760 Mobile home park. Mobile home park: a development with two or more improved pads or spaces designed to accommodate mobile homes. (Ord. 10870 § 192, 1993).21A.06.765 Monitoring. Monitoring: evaluating the impacts of development proposals on biologic, hydrologic and geologic systems and assessing the performance of required mitigation through the collection and analysis of data for the purpose of understanding and documenting changes in natural ecosystems, functions and features including, but not limited to, gathering baseline data. (Ord. 10870 § 193, 1993).21A.06.770 Monuments, tombstones, and gravestones sales. Monuments, tombstones, and gravestones sales: the retail sale of custom stonework products including only uses located in SIC Industry No. 5599-Monuments, finished to custom order, Tombstones and Gravestones finished. (Ord. 10870 § 194, 1993).21A.06.775 Motor vehicle, boat and mobile home dealer. Motor vehicle, boat and mobile home dealer: an establishment engaged in the retail sale of new and/or used automobiles, motor homes, motorcycles, trailers, boats or mobile homes, including only uses located in SIC Major Group and Industry Group Nos.:A. 55-Automotive Dealers and Gasoline Service Stations except: 1. 553-Auto and Home Supply Stores; 2. 554-Gasoline Service Stations; andB. Aircraft dealers found in 5599: 1. 527-Mobile Home Dealers; and 2. Yacht brokers found in 7389. (Ord. 10870 § 195, 1993).21A.06.780 Motor vehicle and bicycle manufacturing. Motor vehicle and bicycle manufacturing: fabricating or assembling complete passenger automobiles, trucks, commercial cars and buses, motorcycles, and bicycles, including only uses located in SIC Industry Group Nos.:A. 371-Motor Vehicles and Motor Vehicle Equipment; andB. 375-Motorcycles, Bicycles, and Parts. (Ord. 10870 § 196, 1993).21A.06.782 Mulch. Mulch: any material such as leaves, bark, straw left loose and applied to the soil surface to reduce evaporation. (Ord. 11210 § 29, 1994).21A.06.785 Municipal water production. Municipal water production: the collection and processing of surface water through means of dams or other methods of impoundment for municipal water systems. (Ord. 11157 § 7, 1993: Ord. 10870 § 197, 1993).21A.06.787 Music and dance entertainment venue. Music and dance entertainment venue: a business in which the primary purpose of the business is to provide entertainment to its patrons in the form of dancing and live or electronic music. (Ord. 17178 § 4, 2011).21A.06.790 Native vegetation. Native vegetation: plant species indigenous to the Puget Sound region that reasonably could be expected to naturally occur on the site. (Ord. 15051 § 79, 2004; Ord. 10870 § 198, 1993).21A.06.795 Naturalized species. Naturalized species: non-native species of vegetation that are adaptable to the climatic conditions of the coastal region of the Pacific Northwest. (Ord. 10870 § 199, 1993).21A.06.796 Navigability or navigable. Navigability or navigable: the capability of susceptibility of a body of water of having been or being used for the transport of useful commerce. The state of Washington considers all bodies of water meandered by government surveyors as navigable unless otherwise declared by a court. (Ord. 16985 § 81, 2010).21A.06.796A Nearshore. Nearshore: the area beginning at the crest of coastal bluffs and extending seaward through the marine photics zone, and to the head of tide in coastal rivers and streams. Nearshore includes estuaries. (Ord. 16985 § 82, 2010).21A.06.797 Net buildable area. Net buildable area: the "site area" less the following areas:A. Areas within a project site that are required to be dedicated for public rights-of-way in excess of sixty feet in width;B. Critical areas and their buffers to the extent they are required by K.C.C. chapter 21A.24 to remain undeveloped;C. Areas required for storm water control facilities other than facilities that are completely underground, including, but not limited to, retention or detention ponds, biofiltration swales and setbacks from such ponds and swales;D. Areas required to be dedicated or reserved as on-site recreation areas;E. Regional utility corridors; andF. Other areas, excluding setbacks, required to remain undeveloped. (Ord. 15051 § 80, 2004: Ord. 11798 § 3, 1995: Ord. 11555 § 2, 1994).21A.06.799 No net loss of shoreline ecological function. No net loss of shoreline ecological function: the maintenance of the aggregate total of King County shoreline ecological functions over time. The no net loss standard in WAC 173-26-186 requires that the impacts of shoreline use or development, whether permitted or exempt from permit requirements, be identified and mitigated such that there are no resulting adverse impacts on ecological functions or processes. (Ord. 16985 § 127, 2010).21A.06.799A Noncommercial native salmon net pens. Noncommercial native salmon net pens: underwater net facilities used for the raising of salmonid species indigenous to the Puget Sound region for the purposes of species recovery and restoration, or tribal or recreational catch. (Ord. 19034 § 12, 2019: Ord. 16985 § 127, 2010).21A.06.800 Nonconformance. Nonconformance: a use, improvement or structure established in conformance with King County's rules and regulations and other applicable local and state rules and regulations in effect at the time the use, improvement or structure was established that no longer conforms to King County's rules and regulations or other applicable local and state rules and regulations due to changes in the rules and regulations or their application to the subject property. (Ord. 17841 § 16, 2014: Ord. 10870 § 200, 1993).21A.06.805 Non-hydroelectric generation facility. Non-hydroelectric generation facility: an establishment for the generation of electricity by nuclear reaction, burning fossil fuels or other electricity generation methods, excluding renewable energy. (Ord. 19146 § 36, 2020: Ord. 10870 § 201, 1993).21A.06.810 Non-ionizing electromagnetic radiation ("NIER"). Non-ionizing electromagnetic radiation ("NIER"): electromagnetic radiation of low photon energy unable to cause ionization. (Ord. 10870 § 202, 1993).21A.06.812 Nonnative marine finfish aquaculture. Nonnative marine finfish aquaculture: the culture or farming of marine finfish that are not indigenous to the Puget Sound region. (Ord. 19034 § 11, 2019).21A.06.815 Noxious weed. Noxious weed: a plant species that is highly destructive, competitive or difficult to control by cultural or chemical practices, limited to any plant species listed on the state noxious weed list in chapter 16-750 WAC, regardless of the list's regional designation or classification of the species. (Ord. 15051 § 81, 2004: Ord. 10870 § 203, 1993).21A.06.817 Off-street required parking lot. Off-street required parking lot; parking facilities constructed to meet the off-street parking requirements of K.C.C. 21A.18 for land uses located on a lot separate from the parking facilities. (Ord. 13022 § 4, 1998).21A.06.819 Open space. Open space: areas left predominately in a natural state to create urban separators and greenbelts, sustain native ecosystems, connect and increase protective buffers for environmentally sensitive areas, provide a visual contrast to continuous development, reinforce community identity and aesthetics, or provide links between important environmental or recreational resources. (Ord. 14045 § 6, 2001).21A.06.820 Open-work fence. Open-work fence: a fence in which the solid portions are evenly distributed and constitute no more than fifty (50) percent of the total surface area. (Ord. 10870 § 204, 1993).21A.06.825 Ordinary high water mark. Ordinary high water mark: the mark found by examining the bed and banks of a stream, lake, pond or tidal water and ascertaining where the presence and action of waters are so common and long maintained in ordinary years as to mark upon the soil a vegetative character distinct from that of the abutting upland. In an area where the ordinary high water mark cannot be found, the line of mean high water in areas adjoining freshwater or mean higher high tide in areas adjoining saltwater is the "ordinary high water mark." In an area where neither can be found, the top of the channel bank is the "ordinary high water mark." In braided channels and alluvial fans, the ordinary high water mark or line of mean high water include the entire water or stream feature. (Ord. 15051 § 82, 2004: Ord. 10870 § 205, 1993).21A.06.830 Outdoor performance center. Outdoor performance center: an establishment for the performing arts with open-air seating for audiences. Such establishments may include related services such as food and beverage sales and other concessions. (Ord. 10870 § 206, 1993).21A.06.831 Overburden-cover-to-seam-thickness ratio. Overburden-cover-to-seam-thickness ratio: the thickness as measured from the ground surface to the top of the abandoned mine working divided by the extracted thickness of the coal seam, expressed as a ratio. A ten foot extracted coal seam will have a 10:1 overburden-cover-to-seam-thickness ratio at a depth of one hundred feet and a 15:1 overburden-cover-to-seam-thickness ratio at a depth of one hundred fifty feet. (Ord. 13319 § 4, 1998).21A.06.832 Overspray. Overspray: irrigation water applied beyond the landscape area. (Ord. 11210 § 30, 1994).21A.06.834 Paintball. A sport in which participants eliminate opponents from play by hitting them with paintballs shot from a compressed-gas-powered paintball gun. (Ord. 16267 § 14, 2008)21A.06.835 Park. Park: a site owned by the public for recreational, exercise or amusement purposes. Park facilities include, but are not limited to:A. Indoor facilities, such as: 1. Gymnasiums 2. Swimming pools; or 3. Activity centers;B. Outdoor facilities, such as: 1. Playfields; 2. Fishing areas; 3. Picnic and related outdoor activity areas; or 4. Approved campgrounds;C. Areas and trails for: 1. Hikers; 2. Equestrians; 3. Bicyclists; or 4. Off-road recreational vehicle users; andD. Facilities for on-site maintenance. (Ord. 17841 § 17, 2014: Ord. 13022 § 9, 1998: Ord. 10870 § 207, 1993).21A.06.837 Park, recreation or multiuse. Park, recreation or multiuse: a park owned by King County that is designated by the department of natural resources and parks in the recreation category or the multiuse category. (Ord. 17841 § 18, 2014).21A.06.840 Park service area. Park service area: established by the department, within which the dedications of land and fees received from new residential developments for the benefit of residents within such service area. (Ord. 10870 § 208, 1993).21A.06.845 Parking lot aisle. Parking lot aisle: that portion of the off-street parking area used exclusively for the maneuvering and circulation of motor vehicles and in which parking is prohibited. (Ord. 10870 § 209, 1993).21A.06.850 Parking lot unit depth. Parking lot unit depth: the linear distance within which one parking aisle is flanked by accessible rows of parking stalls as measured perpendicular to the parking aisle. (Ord. 10870 § 210, 1993).21A.06.855 Parking space. Parking space: an area accessible to vehicles, improved, maintained and used for the sole purpose of parking a motor vehicle. (Ord. 10870 § 211, 1993).21A.06.860 Parking space angle. Parking space angle: the angle measured from a reference line, generally the property line or center line of an aisle, at which motor vehicles are to be parked. (Ord. 10870 § 212, 1993).21A.06.865 Party of record. Party of record ("POR"): a person who has submitted written comments, testified, asked to be notified or is the sponsor of a petition entered as part of the official county record on a specific development proposal. (Ord. 10870 § 213, 1993).21A.06.870 Peak hour. Peak hour: the hour during the morning or afternoon when the most critical level of service occurs for a particular roadway or intersection. (Ord. 10870 § 214, 1993).21A.06.875 Permanent school facilities. Permanent school facilities: facilities of a school district with a fixed foundation which are not relocatable facilities. (Ord. 10870 § 215, 1993).21A.06.880 Personal medical supply store. Personal medical supply store: an establishment engaged in the retail sale of eyeglasses, contact lenses, hearing aids, and artificial limbs, including only uses located in SIC Industry Nos.:A. 5995-Optical Goods Stores; andB. 5999-Hearing Aids and Orthopedic and Artificial Limb Stores. (Ord. 10870 § 216, 1993).21A.06.882 Personal wireless services. Personal wireless services: commercial mobile radio services, unlicensed wireless services, and common carrier wireless exchange access services, as defined by federal laws and regulations. (Ord. 17191 § 25, 2011).21A.06.885 Pet shop. Pet shop: an establishment engaged in the retail sale of pets, small animals, pet supplies, or grooming of pets, including only uses located in SIC Industry No. 5999-Pet shops. (Ord. 10870 § 217, 1993).21A.06.887 Petroleum refining and related industries. Petroleum refining and related industries: uses in SIC Industry No. 2911, excluding fossil fuel facilities. (Ord. 19146 § 37, 2020).21A.06.890 Photographic and electronic shop. Photographic and electronic shop: an establishment engaged in the retail sale of cameras and photographic supplies, and a variety of household electronic equipment, including only uses located in SIC Industry No.:A. 5946 - Camera and Photographic Supply Stores;B. 5999 - Binoculars and Telescopes;C. 5731 - Radio, Television, and Consumer Electronics Stores; andD. 5734 - Computer and Computer Software Stores. (Ord. 10870 § 218, 1993).21A.06.892 Pier or dock. Pier or dock: a structure built in or over, or floating upon, the water extending from the shore, that may be used as a landing place for air or water craft or recreational activities. (Ord. 16985 § 84, 2010: Ord. 3688 § 234, 1978. Formerly K.C.C. 25.08.370).21A.06.895 Plant associations of infrequent occurrence. Plant associations of infrequent occurrence: one or more plant species of a landform type which does not often occur in King County because of the rarity of the habitat and/or the species involved or for other botanical or environmental reasons. (Ord. 10870 § 219, 1993).21A.06.897 Plant factor. a factor which when multiplied by reference evapotranspiration, estimates the amount of water used by plants. (Ord. 11210 § 31, 1994).21A.06.899 Potable water. Potable water: water suitable for human consumption. (Ord. 11210 § 32, 1994).21A.06.899C Preliminary Flood Insurance Rate Map. Preliminary Flood Insurance Rate Map: the initial map issued by FEMA for public review and comment that delineates areas of flood hazard. (Ord. 15051 § 83, 2004).21A.06.899E. Preliminary Flood Insurance Study. Preliminary Flood Insurance Study: the preliminary report provided by FEMA for public review and comment that includes flood profiles, text, data tables and photographs. (Ord. 15051 § 84, 2004).21A.06.900 Private. Private: solely or primarily for the use of residents or occupants of the premises; e.g., a non-commercial garage used solely by residents or their guests is a private garage. (Ord. 10870 § 220, 1993).21A.06.908 Processing operation, waste materials. Processing operation waste materials: a site or establishment, accessory to mineral extraction or sawmill use, that is primarily engaged in crushing, grinding, pulverizing or otherwise preparing earth materials, vegetation, organic waste, construction and demolition materials or recycled and source separated nonhazardous waste materials and that is not the final disposal site. (Ord. 15032 § 7, 2004).21A.06.910 Professional office. Professional office: an office used as a place of business by licensed professionals, or persons in other generally recognized professions, which use training or knowledge of a technical, scientific or other academic discipline as opposed to manual skills, and which does not involve outside storage or fabrication, or on-site sale or transfer of commodities; including only the following SIC Major Group and Industry Nos.:A. 64-Insurance Agents, Brokers and Service;B. 653-Real Estate Agents and Directors;C. 7291-Income Tax Return Preparation Services;D. 81-Legal Services;E. 871-Engineering, Architectural and Surveying Services;F. 872-Accounting, Auditing and Bookkeeping Services; andG. 874-Management and Public Relations Services. (Ord. 10870 § 222, 1993).21A.06.913 Public access. Public access: the ability of the general public to reach, touch or enjoy the water's edge, to travel on the waters of the state and to view the water and the shoreline from adjacent locations. (Ord. 18767 § 3, 2018: Ord. 16985 § 86, 2010: Ord. 3688 § 201, 1978. Formerly K.C.C. 25.08.020).21A.06.915 Public agency. Public agency: any agency, political subdivision or unit of local government of this state including, but not limited to, municipal corporations, special purpose districts and local service districts, any agency of the State of Washington, the United States or any state thereof or any Indian tribe recognized as such by the federal government. (Ord. 10870 § 223, 1993).21A.06.920 Public agency animal control facility. Public agency animal control facility: a facility for the impoundment and disposal of stray or abandoned small animals. (Ord. 10870 § 224, 1993).21A.06.925 Public agency archive. Public agency archive: a facility for the enclosed storage of public agency documents or related materials, excluding storage of vehicles, equipment, or similar materials. (Ord. 10870 § 225, 1993).21A.06.930 Public agency or utility office. Public agency or utility office: an office for the administration of any governmental or utility activity or program, with no outdoor storage and including, but not limited to uses located in SIC Major Group, Industry Group and Industry Nos.:A. 91-Executive, Legislative, and General Government, except Finance;B. 93-Public Finance, Taxation, and Monetary Policy;C. 94-Administration of Human Resource Programs;D. 95-Administration of Environmental Quality and Housing Program;E. 96-Administration of Economic Programs;F. 972-International Affairs;G. 9222-Legal Counsel and Prosecution; andH. 9229-Public Order and Safety. (Ord. 10870 § 226, 1993).21A.06.935 Public agency or utility yard. Public agency or utility yard: a facility for open or enclosed storage, repair, and maintenance of vehicles, equipment, or related materials, excluding document storage. (Ord. 10870 § 227, 1993).21A.06.940 Public agency training facility. Public agency training facility: an establishment or school for training state and local law enforcement, fire safety, national guard or transit personnel and facilities including but not limited to:A. Dining and overnight accommodations;B. Classrooms;C. Shooting ranges;D. Auto test tracks; andE. Fire suppression simulations. (Ord. 10870 § 228, 1993).21A.06.942 Public road right-of-way structure. Public road right-of-way structure: the existing, maintained, improved road right-of-way, regional light rail transit or railroad or light rail transit prism and the roadway drainage features including ditches and the associated surface water conveyance system, flow control and water quality treatment facilities and other structures that are ancillary to those facilities including catch-basins, access holes and culverts. (Ord. 16985 § 118, 2010: Ord. 16267 § 16, 2008: Ord. 15051 § 86, 2004).21A.06.943 Public transportation amenities. Public transportation amenities: transfer of development rights (TDR) amenities financed by public transportation funds that shall provide transportation improvement or programs. (Ord. 14190 § 26, 2001: Ord. 13733 § 1, 2000).21A.06.944 Puget Sound counties. Puget Sound counties: the twelve counties that border the waters of Puget Sound. (Ord. 15032 § 8, 2004).21A.06.944C Racetrack. Racetrack: an establishment offering services and uses located in:A. SIC Industry No. 7948; orB. A regional motor sports facility. (Ord. 17287 § 8, 2012).21A.06.945 Radio frequency. Radio frequency: the number of times the current from a given source of non-ionizing electromagnetic radiation changes from a maximum positive level through a maximum negative level and back to a maximum positive level in one second; measured in cycles per second or Hertz ("Hz"). (Ord. 10870 § 229, 1993).21A.06.950 Reasonable use. Reasonable use: a legal concept articulated by federal and state courts in regulatory taking cases. (Ord. 10870 § 230, 1993).21A.06.955 Receiving site. Receiving site: land for which allowable residential density is increased over the base density permitted by the underlying zone, by virtue of permanently securing and dedicating to King County, or another qualifying agency, the development potential of an associated sending site. (Ord. 10870 § 231, 1993).21A.06.957 Reclamation. Reclamation: the final grading and restoration of a site to reestablish the vegetative cover, soil stability and surface water conditions to accommodate and sustain all permitted uses of the site and to prevent and mitigate future environmental degradation. (Ord. 15051 § 87, 2004).21A.06.958 Recreation, active. Recreation, active: structured individual or team activity that requires the use of special facilities, courses, fields or equipment. Active recreation requires a significant level of development, use and programming. Active recreation includes, but is not limited to, organized sporting events, such as baseball, football, soccer, golf, hockey, tennis and skateboarding, and to large-scale group picnics, gatherings and social events. (Ord. 15606 § 8, 2006).21A.06.9585 Recreation, passive. Recreation, passive: recreational activities that do not require prepared facilities like sports fields or pavilions. Passive recreational activities place minimal stress on a site's resources and are highly compatible with natural resource protection. Passive recreation include, but is not limited to, camping, hiking, wildlife viewing, observing and photographing nature, picnicking, walking, bird watching, historic and archaeological exploration, swimming, bicycling, running/jogging, climbing, horseback riding and fishing. (Ord. 15606 § 9, 2006).21A.06.959 Recreation facilities, passive. Recreation facilities, passive: facilities to support passive recreation that do not involve significant levels of infrastructure or development, including, but not limited to, open fields, trails, children's play equipment and picnic sites for a small number of people. (Ord. 15606 § 10, 2006).21A.06.960 Recreational vehicle ("RV"). Recreational vehicle ("RV"): a vehicle designed primarily for recreational camping, travel or seasonal use which has its own motive power or is mounted on or towed by another vehicle, including but not limited to:A. Travel trailer;B. Folding camping trailer;C. Park trailer;D. Truck camper;E. Park trailer;F. Motor home; andG. Multi-use vehicle. (Ord. 10870 § 232, 1993).21A.06.965 Recreational vehicle parks. Recreational vehicle parks: the use of land upon which two or more recreational vehicle sites, including hook up facilities, are located for occupancy by the general public of recreational vehicles as temporary living quarters for recreation or vacation purposes. (Ord. 10870 § 233, 1993).21A.06.970 Recyclable material. Recyclable material: a non-toxic, recoverable substance that can be re-processed for the manufacture of new products. (Ord. 10870 § 234, 1993).21A.06.971 Redesignation. Redesignation: a change in the shoreline environment designation by the procedures provided in K.C.C. chapter 20.18. (Ord. 16985 § 88, 2010: Ord. 3688 § 237, 1978. Formerly K.C.C. 25.08.400).21A.06.972 Reference evapotranspiration (Eto). Reference evapotranspiration (Eto): a standard measurement of environmental parameters which affect the water use of plants. (Ord. 11210 § 33, 1994).21A.06.973 Regional light rail transit. Regional light rail transit: A public rail transit line that operates at grade level, above grade level or in a tunnel and that provides high capacity, regional transit service owned or operated by a regional transit authority authorized under chapter 81.112 RCW. A regional light rail transit system may be designed to share a street right-of-way although it may also use a separate right-of-way. (Ord. 16985 § 117, 2010).21A.06.973C Regional motor sports facility.Regional motor sports facility. A racetrack established through a master planning demonstration project that may include only the following uses:A. Motor vehicle racing and driving, subject to the conditions established by the master planning demonstration project, and shall not exceed the following racing surfaces: 1. A road course; 2. A kart course; 3. A motocross course; 4. Five-sixteenth-mile oval track; and 5. Up to two drag strips;B. The following accessory uses, if authorized by the master planning demonstration project, shall be subject to the conditions established in the development and operating agreement: 1. Fire station; 2. Driving school; and 3. Police and fire safety training; andC. Limited uses accessory to racing activities may be allowed. Any accessory uses shall be limited to racing and racing-related vehicle uses and shall be appurtenant to the facility by providing either a service or product only to the facility or require use of the facility in connection with the use. Assembly-line or mass production, including but not limited to vehicles and vehicle parts, permanent lodging facilities and general commercial, industrial and manufacturing uses are not permitted. Accessory uses are limited to the following: 1. On-site sale of racing- or event-related items; 2. Repair, service, modification or storage of motor vehicles used primarily at the facility; 3. Custom fabrication of racing motor vehicles, or vehicle parts to be incorporated into those vehicles, that will be used primarily at the facility; 4. Motor vehicle fuel sales for event participants; 5. Daycare for people employed at the facility and event participants and spectators; 6. Food service and concessions for event participants and spectators; and 7. Short-term recreational vehicle parking for persons attending or participating in events at the facility. (Ord. 17287 § 9, 2012).21A.06.974 Regional road maintenance guidelines. Regional road maintenance guidelines: the National Marine Fisheries Service-published Regional Road Maintenance Endangered Species Act Program Guidelines. (Ord. 15051 § 88, 2004).21A.06.977 Regional transit authority facility. Regional transit authority facility: a light rail facility serving more than one jurisdiction. (Ord. 18671 § 2, 2018).21A.06.980 Regional utility corridor. Regional utility corridor: a right-of-way tract or easement other than a street right-of-way which contains transmission lines or pipelines for utility companies. Right-of-way tracts or easements containing lines serving individual lots or developments are not regional utility corridors. (Ord. 10870 § 236, 1993).21A.06.985 Relocatable facilities cost per student. Relocatable facilities cost per student: the estimated cost of purchasing and siting a relocatable facility in a school district for the grade span of school to be provided, as a function of the district's facilities standard per grade span and taking into account the requirements of students with special needs. (Ord. 10870 § 237, 1993).21A.06.990 Relocatable facility. Relocatable facility: any factory-built structure, transportable in one or more sections that is designed to be used as an education space and is needed to prevent the overbuilding of school facilities, to meet the needs of service areas within a district or to cover the gap between the time that families move into new residential developments and the date that construction is completed on permanent school facilities. (Ord. 10870 § 238, 1993).21A.06.995 Relocation facilities. Relocation facilities: housing units within King County that provide housing to persons who have been involuntarily displaced from other housing units within King County as a result of conversion of their housing unit to other land uses. (Ord. 10870 § 239, 1993).21A.06.996 Remote tasting room. Remote tasting room: A small facility licensed by the Washington state Liquor and Cannabis Board and limited to the following non-retail liquor licenses: a Craft Distillery; a Tasting Room - Additional Location for a winery licensed as a Domestic Winery; or a Microbrewery, including, but not limited to, a Microbrewery operating in accordance with an off-site tavern license subject to the retail sale limitations for a Microbrewery in WAC 314-20-015(1). "Remote tasting room" does not include any additional privileges allowed for such licenses or approvals or any use that would require a license under chapter 314-02 WAC, except as specifically set forth in this chapter. (Ord. 19030 § 13, 2019).21A.06.996C Renewable energy generation facility. Renewable energy generation facility: a solar energy system, including a community solar project, geothermal system or a wind generator, used for generating electricity. Renewable energy generation facility does not include consumer-scale renewable energy systems. (Ord. 19146 § 38, 2020).21A.06.997 Repair. Repair: to fix or restore to sound condition after damage. "Repair" does not include replacement of structures or systems. (Ord. 15051 § 90, 2004).21A.06.998 Replace. Replace: to take or fill the place of a structure, fence, deck or paved surface with an equivalent or substitute structure, fence, deck or paved surface that serves the same purpose. "Replacement" may or may not involve an expansion. (Ord. 15051 § 91, 2004).21A.06.1000 Restoration. Restoration: for purposes of critical areas regulation, an action that reestablishes the structure and functions of a critical area or any associated buffer that has been altered. (Ord. 15051 § 92, 2004: Ord. 10870 § 240, 1993).21A.06.1002 Resource land tract. Resource land tract: a tract of land, created through a subdivision or short subdivision cluster development in the RA zone, that may be used as a working forest or farm. (Ord. 14045 § 9, 2001).21A.06.1005 Retail, comparison. Retail, comparison: provides for the sale of comparison good and services and is centrally located in the community or region. (Ord. 10870 § 241, 1993).21A.06.1010 Retail, convenience. Retail, convenience: provides for daily living goods, is easy to access and use and is close to residential neighborhoods. (Ord. 10870 § 242, 1993).21A.06.10105 Retail nursery, garden center and farm supply store. Retail nursery, garden center and farm supply store: an establishment primarily engaged in retailing to the general public:A. Trees, shrubs, other plants, seeds, bulbs, mulches, soil conditioners, fertilizers, pesticides, garden tools, landscaping materials and other garden supplies; andB. Animal feeds, fertilizers, agricultural chemicals, pesticides, seeds and other farm supplies. (Ord. 15974 § 4, 2007).21A.06.1011 Retaining wall. Retaining wall: any wall used to resist the lateral displacement of any material. (Ord. 12987 § 2, 1998).21A.06.1011A Road amenities. Road amenities: transfer of development rights (TDR) amenities financed by road CIP or operating funds that shall provide transportation improvements or programs. (Ord. 14190 § 27, 2001: Ord. 13733 § 2, 2000).21A.06.1011C Roadway. Roadway: the maintained areas cleared and graded within a road right-of-way or railroad prism. For a road right-of-way, "roadway" includes all maintained and traveled areas, shoulders, pathways, sidewalks, ditches and cut and fill slopes. For a railroad prism, "roadway" includes the maintained railbed, shoulders, and cut and fill slopes. "Roadway" is equivalent to the "existing, maintained, improved road right-of-way or railroad prism" as defined in the regional road maintenance guidelines. (Ord. 15051 § 93, 2004).21A.06.1012 Runoff. Runoff: water not absorbed by the soil in the landscape area to which it is applied. (Ord. 11210 § 34, 1994).21A.06.1013 Rural equestrian community trail. Rural equestrian community trail: an existing trail within the Equestrian Community located in the A, F or RA zones that has historically been used by the public for riding horses, and that may also have historically been used by or is suitable for use by other non-motorized trail users. (Ord. 17841 § 19, 2014: Ord. 14045 § 7, 2001).21A.06.1014 Rural forest focus areas. Rural forest focus areas: Mapped geographic areas where special efforts to maintain forest cover and the practice of sustainable forestry are warranted. (Ord. 14045 § 8, 2001).21A.06.1014F Rural public infrastructure maintenance facility. Rural public infrastructure maintenance facility: a facility operated by a public agency primarily for the maintenance of public roads, parks, regional trails and other public infrastructure located outside of the urban growth area. Uses within the facility may include the following, if primarily devoted to rural public infrastructure maintenance:A. Public agency office;B. Public agency yard;C. Materials processing facility;D. Vactor waste receiving facility;E. Sand and gravel extraction;F. Soil recycling; andG. Renewable energy facilities, such as solar panels and wind turbines. (Ord. 15938 § 1, 2007). 21A.06.1015 Salmonid. Salmonid: a member of the fish family Salmonidae, including, but not limited to:A. Chinook, coho, chum, sockeye and pink salmon;B. Rainbow, steelhead and cutthroat salmon, which are also known as trout;C. Brown trout;D. Brook, bull trout, which is also known as char, and Dolly Varden char;E. Kokanee; andF. Pygmy whitefish. (Ord. 15051 § 94, 2004: Ord. 10870 § 243, 1993).21A.06.1020 School bus base. School bus base: an establishment for the storage, dispatch, repair and maintenance of coaches and other vehicles of a school transit system. (Ord. 10870 § 244, 1993).21A.06.1025 School district. School district: any school district in King County whose boundaries include unincorporated areas of the county. (Ord. 10870 § 245, 1993).21A.06.1030 School district support facility. School district support facility: uses (excluding schools and bus bases) that are required for the operation of a school district. This term includes school district administrative offices, centralized kitchens, and maintenance or storage facilities. (Ord. 10870 § 246, 1993).21A.06.1035 Schools, elementary, and middle/junior high. Schools, elementary, and middle/junior high: public or private institutions of learning offering instruction in the several branches of learning and study required by the Education Code of the State of Washington in grades kindergarten through nine, including associated meeting rooms, auditoriums and athletic facilities. (Ord. 17191 § 26, 2011: Ord. 10870 § 247, 1993).21A.06.1040 Schools, secondary or high school. Schools, secondary or high school: public or private institutions of learning offering instruction in the several branches of learning and study required by the Education Code of the State of Washington in grades nine through twelve, including associated meeting rooms, auditoriums and athletic facilities. (Ord. 17191 § 27, 2011: Ord. 10870 § 248, 1993).21A.06.1043 Secure community transition facility ("SCTF"). Secure community transition facility ("SCFT"): A facility for persons civilly committed and conditionally released to a less restrictive alternative in accordance with chapter 71.09 RCW. A secure community transition facility has supervision and security, and either provides or ensures the provision of sex offender treatment services. (Ord. 14503 § 2, 2002).21A.06.1044 Sea level rise protection elevation. Sea level rise protection elevation: three feet above the base flood elevation identified in the Flood Insurance Study and Flood Insurance Rate Map, dated August 19, 2020, for the adjacent coastal high hazard area flood zone. The sea level rise protection elevation only applies to Vashon-Maury Island. (Ord. 19146 § 39, 2020).21A.06.1044C Sea level rise risk area. Sea level rise risk area: lands on Vashon-Maury Island adjacent to a coastal high hazard area that extend landward to an elevation three feet above the base flood elevation identified in the Flood Insurance Study and Flood Insurance Rate Map, dated August 19, 2020, for the adjacent coastal high hazard area flood zone. (Ord. 19146 § 40, 2020).21A.06.1044H Search and rescue facility. Search and rescue facility: a multiuse facility operated by a nonprofit organization or organizations that, under direction from or in collaboration with a law enforcement agency, utilize emergency workers to conduct search and rescue operations as described in chapter 118-04 WAC. A search and rescue facility may include areas and spaces used for search and rescue activities and operations, such as:A. Indoor and outdoor training areas;B. Administrative offices and associated food preparation and dining facilities;C. Equipment storage and maintenance areas;D. Vehicle storage and maintenance areas;E. Meeting space; F. An assembly hall, which is a large room used for the assembly of persons without fixed seats or a permanent stage; andG. Helistops and helicopter fueling, maintenance and storage, including hangars. (Ord. 19331 § 2, 2021)21A.06.1045 Seismic hazard area. Seismic hazard area: an area subject to severe risk of earthquake damage from seismically induced settlement or lateral spreading as a result of soil liquefaction in an area underlain by cohesionless soils of low density and usually in association with a shallow groundwater table. (Ord. 15051 § 95, 2004: Ord. 10870 § 249, 1993).21A.06.1050 Self-service storage facility. Self-service storage facility: an establishment containing separate storage spaces that are leased or rented as individual units. (Ord. 10870 § 250, 1993).21A.06.1055 Sending site. Sending site: land designated in K.C.C. 21A.36 as capable of providing a public benefit if permanently protected by virtue of having its zoned development potential transferred to another property. (Ord. 10870 § 251, 1993).21A.06.1060 Senior citizen. Senior citizen: a person aged 62 or older. (Ord. 11157 § 8, 1993: Ord. 10870 § 252, 1993).21A.06.1062 Senior citizen assisted housing. Senior citizen assisted housing: housing in a building consisting of two or more dwelling units or sleeping units restricted to occupancy by at least one senior citizen per unit, and may include the following support services, as deemed necessary:A. Food preparation and dining areas;B. Group activity areas;C. Medical supervision; andD. Similar activities. (Ord. 11157 § 9, 1993: Ord. 10870 § 634 (part), 1993 [Originally Ord. 10870 § 112]).21A.06.1070 Setback. Setback: the minimum required distance between a structure and a specified line such as a lot, easement or buffer line that is required to remain free of structures. (Ord. 10870 § 254, 1993).21A.06.1075 Shelters for temporary placement. Shelters for temporary placement: housing units within King County that provide housing to persons on a temporary basis for a duration not to exceed four weeks. (Ord. 10870 § 255, 1993).21A.06.1080 Shooting range. Shooting range: a facility designed to provide a confined space for safe target practice with firearms, archery equipment, or other weapons. (Ord. 10870 § 256, 1993).21A.06.1081 Shorelands. Shorelands:A. Lands extending landward two hundred feet in all directions as measured on a horizontal plane from the ordinary high water mark;B. Floodways and contiguous floodplain areas landward two hundred feet from such floodways;C. All wetlands and river deltas associated with streams, lakes and tidal waters; andD. The one-hundred-year floodplain. (Ord. 19034 § 13, 2019: Ord. 16985 § 89, 2010).21A.06.1082 Shoreline. Shoreline: all of the water areas of the state, including reservoirs, and their associated shorelands, together with the lands underlying them; except:A. Shorelines of statewide significance;B. Shorelines on segments of streams upstream of a point where the mean annual flow is twenty cubic feet per second or less and the wetlands associated with such upstream segments; andC. Shorelines on lakes less than twenty acres in size and wetlands associated with such small lakes. (Ord. 19034 § 14, 2019: Ord. 15051 § 97, 2004).21A.06.1082A Shoreline conditional use. Shoreline conditional use: a shoreline use that is allowed only if it meets the criteria established in K.C.C. 21A.44.100. (Ord. 18767 § 4, 2018: Ord. 16985 § 91, 2010: Ord. 3688 § 247, 1978. Formerly K.C.C. 25.08.460).21A.06.1082B Shoreline jurisdiction. Shoreline jurisdiction: all shorelines of the state, including shorelines, shorelines of statewide significance, shorelands and the one-hundred-year floodplain. (Ord. 19034 § 15, 2019: Ord. 16985 § 92, 2010).21A.06.1082C Shoreline stabilization. Shoreline stabilization: a structure or device, including, but not limited to, breakwaters, bulkheads, jetties, groins and riprap, that is placed so as to prevent erosion or to alter the normal currents, wave actions or other natural forces or actions of a waterbody. Shoreline stabilization does not include flood protection facilities. (Ord. 16985 § 94, 2010: Ord. 3688 § 251, 1978. Formerly K.C.C. 25.08.480).21A.06.1082D Shoreline variance. Shoreline variance: an adjustment in the application of the regulations of the shoreline management master program consistent with WAC 173-27-170 and K.C.C. 21A.44.090. (Ord. 19034 § 16, 2019: Ord. 16985 § 96, 2010: Ord. 3688 § 248, 1978. Formerly K.C.C. 25.08.470).21A.06.1083A Shorelines of statewide significance. Shorelines of statewide significance: those shorelines described in RCW 90.58.030(2)(f) that are within the unincorporated portion of King County. (Ord. 19034 § 19, 2019: Ord. 16985 § 100, 2010: Ord. 3688 § 249, 1978. Formerly K.C.C. 25.08.510).21A.06.1083B Shorelines of the state. Shorelines of the state: the total of all shorelines and shorelines of statewide significance, including the one hundred year floodplain. (Ord. 19034 § 18, 2019).21A.06.1084 Side channel. Side channel: a channel that is secondary to and carries water to or from the main channel of a stream or the main body of a lake or estuary, including a back-watered channel or area and oxbow channel that is still connected to a stream by one or more aboveground channel connections or by inundation at the base flood. (Ord. 15051 § 98, 2004).21A.06.1085 Sign. Sign: any device, structure, fixture, or placard that is visible from a public right-of-way or surrounding properties and uses graphics, symbols, or written copy for the purpose of advertising or identifying any establishment, product, goods, or service. (Ord. 10870 § 257, 1993).21A.06.1090 Sign, awning. Sign, awning: a sign painted on or attached directly to and supported by an awning. An awning may be constructed of rigid or non-rigid materials and may be retractable or non-retractable. (Ord. 13014 § 1, 1998: Ord. 10870 § 258, 1993).21A.06.1095 Sign, changing message center. Sign, changing message center: an electrically controlled sign that contains advertising messages that changes more frequently than once every three minutes. (Ord. 16267 § 15, 2008: Ord. 10870 § 259, 1993).21A.06.1100 Sign, community bulletin board. Sign, community bulletin board: a permanent sign used to notify the public of community events and public services, and which contains no commercial advertising. (Ord. 10870 § 260, 1993).21A.06.1105 Sign, directional. Sign, directional: a sign designed to guide or direct pedestrian or vehicular traffic to an area, place or convenience, and may include incidental graphics such as trade names and trademarks. (Ord. 10870 § 261, 1993).21A.06.1110 Sign, freestanding. Sign, freestanding: a sign standing directly upon the ground or having one or more supports standing directly upon the ground, and being detached from any building or fence. (Ord. 10870 § 262, 1993).21A.06.1115 Sign, fuel price. Sign, fuel price: a sign utilized to advertise the price of gasoline and/or diesel fuel. (Ord. 10870 § 263, 1993).21A.06.1120 Sign, incidental. Sign, incidental: a sign, emblem or decal designed to inform the public of goods, facilities, or services available on the premises, and may include but not limited to signs designating:A. Restrooms;B. Hours of operation;C. Acceptable credit cards;D. Property ownership or management;E. Phone booths; andF. Recycling containers. (Ord. 10870 § 264, 1993).21A.06.1125 Sign, indirectly illuminated. Sign, indirectly illuminated: a sign that is illuminated entirely from an external artificial source. (Ord. 10870 § 265, 1993).21A.06.1130 Sign, monument. Sign, monument: a freestanding sign that is above ground level and is anchored to the ground by a solid base, with no open space between the sign and the ground. (Ord. 10870 § 266, 1993).21A.06.1135 Sign, off-premise directional. Sign, off-premise directional: a sign which contains no advertising of a commercial nature which is used to direct pedestrian or vehicular traffic circulation to a facility, service or business located on other premises within six hundred and sixty feet of the sign. (Ord. 10870 § 267, 1993).21A.06.1140 Sign, on-premise. Sign, on-premise: a sign which displays a message which is incidental to and directly associated with the use of the property on which it is located. (Ord. 10870 § 268, 1993).21A.06.1145 Sign, permanent residential development identification. Sign, permanent residential development identification: a permanent sign identifying the residential development upon which the sign is located. (Ord. 10870 § 269, 1993).21A.06.1150 Sign, portable. Sign, portable: a sign which is capable of being moved and is not permanently affixed to the ground, a structure or building. (Ord. 10870 § 270, 1993).21A.06.1155 Sign, projecting. Sign, projecting: any sign which is attached to and supported by the exterior wall of a building with the exposed face of the sign on a plane perpendicular to the wall of the building; projecting more than one foot from the wall of a building and vertical to the ground. (Ord. 13014 § 2, 1998: Ord. 10870 § 271, 1993).21A.06.1160 Sign, time and temperature. Sign, time and temperature: an electrically controlled sign that contains messages for date, time, and temperature, which changes at intervals of one minute or less. (Ord. 10870 § 272, 1993).21A.06.1165 Sign, wall. Sign, wall: any sign painted on, or attached directly to and supported by, a building or structure; with the exposed face of the sign on a plane parallel to the portion of the building or structure to which it is attached; projecting no more than one foot from the building or structure; including window signs which are permanently attached. (Ord. 13014 § 3, 1998: Ord. 10870 § 273, 1993).21A.06.1167 Significant tree: an existing healthy tree that is not a hazard tree (i.e. a tree that does not have a high probability of imminently falling due to a debilitating disease or structural defect) and that, when measured four and one-half feet above grade, has a minimum diameter of:A. Eight inches for evergreen trees; orB. Twelve inches for deciduous trees. (Ord. 13576 § 1, 1999).21A.06.1170 Site. Site: A single lot, or two or more contiguous lots that are under common ownership or documented legal control, used as a single parcel for a development proposal in order to calculate compliance with the standards and regulations of this title. (Ord. 11922 § 2, 1995).21A.06.1172 Site area. Site area: the total horizontal area of a project site. (Ord. 15051 § 99, 2004: Ord. 11555 § 1, 1994).21A.06.1175 Site cost per student. Site cost per student: the estimated cost of a site in the district for the grade span of school to be provided, as a function of the district's facilities standard per grade span and taking into account the requirements of students with special needs. (Ord. 10870 § 275, 1993).21A.06.1180 Ski area. Ski area: an establishment for cross-country or downhill ski runs and including, but not limited to:A. Chair lifts;B. Warming huts; andC. Supporting services. (Ord. 10870 § 276, 1993).21A.06.1182 Slope. Slope: an inclined ground surface, the inclination of which is expressed as a ratio of horizontal distance to vertical distance. (Ord. 16267 § 17, 2008: Ord. 15051 § 100, 2004).21A.06.1185 Soil recycling facility. Soil recycling facility: an establishment engaged in the collection, storage and treatment of contaminated soils to remove and reuse organic contaminants. (Ord. 10870 § 277, 1993).21A.06.1190 Source-separated organic material. Source-separated organic material: vegetative material, scrap lumber or wood, or other materials that provide a source for recycled or composted products. This does not include chemically treated wood products and/or toxic organic substances. (Ord. 10870 § 278, 1993).21A.06.1195 Special use permit. Special use permit: a permit granted by the County to locate a regional land use at a particular location, subject to conditions placed on the proposed use to ensure compatibility with adjacent land uses. (Ord. 10870 § 279, 1993).21A.06.1200 Specialized instruction school. Specialized instruction school: establishments engaged in providing specialized instruction in a designated field of study, rather than a full range of courses in unrelated areas; including, but not limited to:A. Art;B. Dance;C. Music;D. Cooking; and E. Driving. (Ord. 15032 § 9, 2004: Ord. 10870 § 280, 1993).21A.06.1205 Specified sexual activities. Specified sexual activities: human genitalia in a state of sexual stimulation or arousal; acts of human masturbation, sexual intercourse or sodomy; or erotic fondling, touching or display of human genitalia, pubic region, buttock or breast. (Ord. 18683 § 51, 2018: Ord. 10870 § 281, 1993).21A.06.1210 Sporting goods store. Sporting goods store: an establishment engaged in the retail sale of sporting goods and equipment, including only uses located in SIC Industry Nos.:A. 5941-Sporting Goods Stores and Bicycle Shops; andB. 5999-Tent Shops and Trophy Shops. (Ord. 10870 § 282, 1993).21A.06.1215 Sports club. Sports club: an establishment engaged in operating physical fitness facilities and sports and recreation clubs, including only uses located in SIC Industry Nos.:A. 7991-Physical Fitness Facilities; andB. 7997-Membership Sports and Recreation Clubs. (Ord. 10870 § 283, 1993).21A.06.1220 Stable. Stable: a structure or facility in which horses or other livestock are kept for:A. Boarding;B. Training;C. Riding lessons;D. Breeding;E. Rental; orF. Personal use. (Ord. 10870 § 284, 1993).21A.06.1225 Standard of service, school districts. Standard of service, school districts: the standard adopted by each school district which identifies the program year, the class size by grade span and taking into account the requirements of students with special needs, the number of classrooms, the types of facilities the district believes will best serve its student population, and other factors as identified by the school district. The district's standard of service shall not be adjusted for any portion of the classrooms housed in relocatable facilities which are used as transitional facilities or for any specialized facilities housed in relocatable facilities. Except as otherwise defined by the school board pursuant to a board resolution, transitional facilities shall mean those facilities that are used to cover the time required for the construction of permanent facilities; provided that, the "necessary financial commitments" as defined in Section 21A.28 are in place to complete the permanent facilities called for in the capital plan. (Ord. 10870 § 285, 1993).21A.06.1230 Steep slope hazard area. Steep slope hazard area: an area on a slope of forty percent inclination or more within a vertical elevation change of at least ten feet. For the purpose of this definition, a slope is delineated by establishing its toe and top and is measured by averaging the inclination over at least ten feet of vertical relief. Also for the purpose of this definition:A. The "toe" of a slope means a distinct topographic break in slope that separates slopes inclined at less than forty percent from slopes inclined at forty percent or more. Where no distinct break exists, the "toe" of a slope is the lower most limit of the area where the ground surface drops ten feet or more vertically within a horizontal distance of twenty five feet; andB. The "top" of a slope is a distinct topographic break in slope that separates slopes inclined at less than forty percent from slopes inclined at forty percent or more. Where no distinct break exists, the "top" of a slope is the upper-most limit of the area where the ground surface drops ten feet or more vertically within a horizontal distance of twenty-five feet. (Ord. 15051 § 101, 2004: Ord. 10870 § 286, 1993).21A.06.1235 Stream functions. Stream functions: natural processes performed by streams including functions which are important in facilitating food chain production, providing habitat for nesting, rearing and resting sites for aquatic, terrestrial and avian species, maintaining the availability and quality of water, such as purifying water, acting as recharge and discharge areas for groundwater aquifers, moderating surface and storm water flows and maintaining the free flowing conveyance of water, sediments and other organic matter. (Ord. 10870 § 287, 1993).21A.06.1240 Stream. Stream: an aquatic area where surface water produces a channel, not including a wholly artificial channel, unless it is:A. Used by salmonids; orB. Used to convey a stream that occurred naturally before construction of the artificial channel. (Ord. 15051 § 102, 2004: Ord. 10870 § 288, 1993).21A.06.1245 Street. Street: a public or recorded private thoroughfare providing pedestrian and vehicular access through neighborhoods and communities and to abutting property. (Ord. 10870 § 289, 1993).21A.06.1250 Street frontage. Street frontage: any portion of a lot or combination of lots which directly abut a public right-of-way. (Ord. 10870 § 290, 1993).21A.06.1255 Structure. Structure: anything permanently constructed in or on the ground, or over the water; excluding fences six feet or less in height, decks less than 18 inches above grade, paved areas, and structural or non-structural fill. (Ord. 12987 § 3, 1998: Ord. 10870 § 291, 1993).21A.06.1260 Student factor. Student factor: the number derived by a school district to describe how many students of each grade span are expected to be generated by a dwelling unit. Student factors shall be based on district records of average actual student generated rates for new developments constructed over a period of not more than five years prior to the date of the fee calculation; if such information is not available in the district, data from adjacent districts, districts with similar demographics, or county wide averages must be used. Student factors must be separately determined for single family and multifamily dwelling units, and for grade spans. (Ord. 10870 § 292, 1993).21A.06.1263 Subdivision or residential subdivision. Subdivision or residential subdivision: Unless the context clearly indicates otherwise, includes a subdivision as defined in K.C.C. 19A.04.320 and a short subdivision as defined K.C.C. 19A.04.310. (Ord. 17191 § 28, 2011: Ord. 16950 § 13, 2010).21A.06.1265 Submerged land. Submerged land: any land at or below the ordinary high water mark of an aquatic area. (Ord. 15051 § 103, 2004: Ord. 10870 § 293, 1993).21A.06.1268 Substantial development. Substantial development: any development that requires a shoreline substantial development permit, as defined in WAC 173-27-040. (Ord. 19034 § 20, 2019: Ord. 16985 § 102, 2010: Ord. 3688 § 255, 1978. Formerly K.C.C. 25.08.570).21A.06.1270 Substantial improvement. Substantial improvement:A.1. Any maintenance, repair, structural modification, addition or other improvement of a structure, the cost of which equals or exceeds fifty percent of the market value of the structure either: a. before the improvement or repair is started; or b. if the structure has been damaged and is being restored, before the damage occurred. 2. For purposes of this definition, the cost of any improvement is considered to begin when the first alteration of any wall, ceiling, floor or other structural part of the building begins, whether or not that alteration affects the external dimensions of the structure; andB. Does not include: 1. Improvement of a structure to correct existing violations of state or local health, sanitary or safety code specifications that have been identified by the local code enforcement official and that are the minimum necessary to ensure safe living conditions; or 2. Alteration of a structure listed on the national Register of Historic Places or a state or local inventory of historic resources. (Ord. 19128 § 16, 2020: Ord. 17191 § 29, 2011: Ord. 15051 § 104, 2004: Ord. 10870 § 294, 1993).21A.06.1271 Surface water conveyance. Surface water conveyance: a drainage facility designed to collect, contain and provide for the flow of surface water from the highest point on a development site to receiving water or another discharge point, connecting any required flow control and water quality treatment facilities along the way. "Surface water conveyance" includes but is not limited to, gutters, ditches, pipes, biofiltration swales and channels. (Ord. 15051 § 105, 2004).21A.06.1272 Surface water discharge. Surface water discharge: the flow of surface water into receiving water or another discharge point. (Ord. 15051 § 106, 2004).21A.06.1273 TDR. TDR transfer of development rights. (Ord. 14190 § 28, 2001: Ord. 13733 § 3, 2000).21A.06.1273A TDR amenities. TDR amenities: improvements or programs that are implemented to facilitate increased densities on or near receiving sites inside cities or in the urban unincorporated area. (Ord. 14190 § 29, 2001: Ord. 13733 § 4, 2000).21A.06.1273B TDR bank fund. TDR bank fund: the fund established under K.C.C. 4.08.327*. (Ord. 14190 § 30, 2001: Ord. 13733 § 5, 2000).*Reviser's note: K.C.C.4.08.327 was recodified as K.C.C. 4A.200.730 and renamed the transfer of development rights bank fund by Ordinance 17527.21A.06.1273C TDR conversion ratio. TDR conversion ratio: the ratio by which development rights purchased from a sending site are converted into additional development capacity for use on a receiving site. (Ord. 14190 § 31, 2001: Ord. 13733 § 6, 2000).21A.06.1273D TDR executive board. TDR executive board: the board established K.C.C. chapter 21A.37. (Ord. 14190 § 32, 2001: Ord. 13733 § 7, 2000).21A.06.1274 TDR extinguishment document. TDR extinguishment document: a document prepared by King County and signed and recorded by the owner of transfer of development rights (TDR) that documents the transfer of development rights from one property to another and permanently prohibits any future use of these rights. (Ord. 14190 § 20, 2001).21A.06.1274A Temporary farm worker housing. Temporary farm worker housing: a place, area or piece of land, where sleeping places or housing sites are provided for temporary, seasonal occupancy by an agricultural employer for the employer's agricultural employees or by another person who is providing such accommodations for agricultural employees. (Ord. 17539 § 24, 2013). 21A.06.1275 Temporary use permit. Temporary use permit: permit to allow a use of limited duration and/or frequency, or to allow multiple related events over a specified period. (Ord. 10870 § 295, 1993).21A.06.1277 Theater. Theater: an establishment primarily engaged in the indoor exhibition of motion pictures or of live theatrical presentations. (Ord. 13022 § 5, 1998).21A.06.1278 Theatrical production services. Theatrical production services: an establishment engaged in uses located in SIC Industry No. 792 - Theatrical Producers (Except Motion Picture), Bands, Orchestras, and Entertainers, except establishments primarily engaged in providing live theatrical presentations, such as road companies and summer theaters. (Ord. 13022 § 6, 1998).21A.06.1280 Tightline sewer. Tightline sewer: a sewer trunk line designed and intended specifically to serve only a particular facility or place, and whose pipe diameter should be sized appropriately to ensure service only to that facility or place. It may occur outside the local service area for sewers, but does not amend the local service area. (Ord. 10870 § 296, 1993).21A.06.1285 Trails. Trails: human-made pathways, including elevated boardwalks, bridges and stairs, designed and intended for use by pedestrians, bicyclists, equestrians and other nonmotorized recreational users. (Ord. 18767 § 5, 2018: Ord. 18683 § 52, 2018: Ord. 16267 § 18, 2008: Ord. 10870 § 297, 1993).21A.06.1290 Transfer station. Transfer station: a staffed collection and transportation facility used by private individuals and route collection vehicles to deposit solid waste collected off-site into larger transfer vehicles for transport to permanent disposal sites; and may also include recycling facilities involving collection or processing for shipment. (Ord. 10870 § 298, 1993).21A.06.1295 Transit base. Transit base: an establishment for the storage, dispatch, repair and maintenance of coaches, light rail trains, and other vehicles of a public transit system. (Ord. 10870 § 299, 1993).21A.06.1297 Transit comfort facility. Transit comfort facility: a restroom for public transit employees. (Ord. 18861 § 1, 2019).21A.06.1305 Transitional housing facilities. Transitional housing facilities: housing units within King County owned by public housing authorities, nonprofit organizations or other public interest groups that provide housing to persons on a temporary basis for a duration not to exceed 24 months in conjunction with job training, self sufficiency training, and human services counseling; the purpose of which is to help persons make the transition from homelessness to placement in permanent housing. (Ord. 10870 § 301, 1993).21A.06.1310 Transmission equipment. Transmission equipment: equipment, such as antennae and satellite, or point-to-point microwave dishes, that transmit or receive radio signals. (Ord. 10870 § 302, 1993).21A.06.1315 Transmission line booster station. Transmission line booster station: an establishment containing equipment designed to increase voltage of electrical power transported through transmission and/or distribution lines to compensate for power loss due to resistance. (Ord. 10870 § 303, 1993).21A.06.1320 Transmission support structure. Transmission support structure: a pole or lattice-work structure specifically designed and intended to support antenna and related communication equipment. The term does not include poles or lattice-work towers supporting above-ground distribution or transmission lines for utility services such as electric, telephone, cable, etc. (Ord. 13129 § 19, 1998: Ord. 10870 § 304, 1993).21A.06.1325 Transmitter building. Transmitter building: building used to contain communication transmission equipment. (Ord. 10870 § 305, 1993).21A.06.1330 Transportation system management ("TSM"). Transportation System Management ("TSM"): low-cost projects that can be implemented in a short time frame designed to increase the efficiency of existing transportation facilities. This also includes transit and/or ride sharing measures to decrease single occupancy vehicle trips. (Ord. 10870 § 306, 1993).21A.06.1331 Tree, hazard. Tree, hazard: any tree with a structural defect, combination of defects or disease resulting in structural defect that, under the normal range of environmental conditions at the site, will result in the loss of a major structural component of that tree in a manner that will:A. Damage a residential structure or accessory structure, place of employment or public assembly or approved parking for a residential structure or accessory structure or place of employment or public assembly;B. Damage an approved road or utility facility; orC. Prevent emergency access in the case of medical hardship. (Ord. 15051 § 107, 2004).21A.06.1331C Tree canopy spread. Tree canopy spread: Diameter of the tree crown delineated by the outermost branches of the tree. (Ord. 19687 § 7, 2023).21A.06.1332 Trough subsidence. Trough subsidence: a readily predictable or historically observed surface depression phenomena caused by coal extraction which is generally characterized by a gentle and continuous dish shape which may extend beyond the subsurface area in which coal mining has occurred. (Ord. 13319 § 5, 1998).21A.06.1335 Ultimate roadway section. Ultimate roadway section: a designation by King County that the maximum roadway or intersection capacity has been reached and further right-of-way acquisition and/or improvements are not feasible to increase peak hour vehicle capacity. (Ord. 10870 § 307, 1993).21A.06.1340 Urban Plan Development (UPD). Urban Plan Development: a site specific project consisting of conceptual site plan(s), development standards, processing and other elements. (Ord. 10870 § 308, 1993).21A.06.1345 Use. Use: the purpose for which land or a structure is designed, built, arranged, intended, occupied, maintained, let or leased. (Ord. 17841 § 20, 2014: Ord. 10870 § 309, 1993).21A.06.1347 Use, established. Use, established: a use that has been in continuous operation for more than sixty days and that conformed to King County's rules and regulations and to other applicable local and state rules and regulations at the time it began operation and throughout the sixty days. (Ord. 17841 § 21, 2014).21A.06.1348 Utility corridor. Utility corridor: a narrow strip of land containing underground or above-ground utilities and the area necessary to maintain those utilities. A "utility corridor" is contained within and is a portion of any utility right-of-way or dedicated easement. (Ord. 15051 § 108, 2004).21A.06.1350 Utility facility. Utility facility: a facility for the distribution or transmission of services, including:A. Telephone exchanges;B. Water pipelines, pumping or treatment stations;C. Electrical substations;D. Water storage reservoirs or tanks;E. Municipal groundwater well-fields;F. Regional surface water flow control and water quality facilities;G. Natural gas pipelines, gate stations and limiting stations, limited to local distribution service and excluding fossil fuel facilities;H. Propane, compressed natural gas and liquefied natural gas storage tanks serving multiple lots or uses from which fuel is distributed directly to individual users, limited to local distribution service and excluding fossil fuel facilities;I. Wastewater pipelines, lift stations, pump stations, regulator stations or odor control facilities; andJ. Communication cables, electrical wires and associated structural supports. (Ord. 19146 § 41, 2020: Ord. 15051 § 109, 2004: Ord. 10870 § 310, 1993).21A.06.1352 Vactor waste. Vactor waste means liquid or solid waste material collected from catch basins, retention/detention facilities or drainage pipes. (Ord. 12018 § 1, 1995).21A.06.1353 Vactor waste receiving facility. Vactor waste receiving facility means a facility where vactor waste is brought for treatment and storage prior to final disposal. (Ord. 12018 § 2, 1995).21A.06.1355 Variance. Variance: an adjustment in the application of standards of a zoning code to a particular property. (Ord. 10870 § 311, 1993).21A.06.1360 Vegetation. Vegetation: any and all plant life growing at, below or above the soil surface. (Ord. 10870 § 312, 1993).21A.06.1365 Vocational school. Vocational school: establishments offering training in a skill or trade to be pursued as a career, including only uses located in SIC Industry Group No.:A. 824-Vocational Schools; andB. 8222-Technical Institutes. (Ord. 10870 § 313, 1993).21A.06.1370 Volcanic hazard area. Volcanic hazard area: an area subject to inundation by mudflows, lahars or related flooding resulting from volcanic activity on Mount Rainier, delineated based on recurrence of an event equal in magnitude to the prehistoric Electron mudflow. (Ord. 15051 § 110, 2004: Ord. 10870 § 314, 1993).21A.06.1375 Warehousing and wholesale trade. Warehousing and wholesale trade: establishments involved in the storage and/or sale of bulk goods for resale or assembly, excluding establishments offering the sale of bulk goods to the general public which is classified as a retail use in K.C.C. 21A.08.070 and excluding local distribution [gas storage tanks]*. These establishments shall include only SIC Major Group Nos. 50 and 51 and SIC Industry Group Nos. 422 and 423, excluding fossil fuels and fossil fuel facilities. (Ord. 19146 § 42, 2020: Ord. 10870 § 315, 1993).*Reviser's note: Added but not underlined in Ordinance 19146. See K.C.C. 1.24.075.21A.06.1380 Wastewater treatment facility. Wastewater treatment facility: a plant for collection, decontamination and disposal of sewage, including residential, industrial and agricultural liquid wastes, and including any physical improvement within the scope of the definition of "water pollution control facility" set forth in WAC 173-90-015(4) as amended. (Ord. 10870 § 316, 1993).21A.06.1382 Water budget. Water budget: the upper limit of irrigation water applied to the established landscape area. (Ord. 11210 § 35, 1994).21A.06.1385 Water dependent use. Water dependent use: a use or portion of a use that cannot exist in a location that is not adjacent to the water and is dependent on the water by reason of the intrinsic nature of its operations. (Ord. 118767 § 6, 2018: Ord. 17485 § 16, 2012: Ord. 10870 § 317, 1993).21A.06.1386 Water enjoyment use. Water enjoyment use: a recreational use or other use that facilitates public access to the shoreline as a primary characteristic of the use; or a use that provides for recreational use or aesthetic enjoyment of the shoreline for a substantial number of people as a general characteristic of the use and which through location, design and operation ensures the public's ability to enjoy the physical and aesthetic qualities of the shoreline. A water enjoyment use must be open to the general public and the shoreline-oriented space within the project must be devoted to the specific aspects of the use that fosters shoreline enjoyment. (Ord. 16985 § 105, 2010).21A.06.1388 Water oriented use. Water oriented use: a use that is water dependent, water related or water enjoyment, or a combination of such uses. (Ord. 16985 § 106, 2010).21A.06.1389 Water related use. Water related use: a use or portion of a use that is not intrinsically dependent on a waterfront location but whose economic viability is dependent upon a waterfront location because:A. The use has functional requirement for a waterfront location, such as the arrival or shipment of materials by water or the need for large quantities of water; orB. The use provides a necessary service supportive of the water-dependent uses and the proximity of the use to its customers makes it services less expensive or more convenient, or both. (Ord. 16985 § 108, 2010: Ord. 3688 § 258, 1978. Formerly K.C.C. 25.08.600).21A.06.1390 Wet meadow, grazed or tilled. Wet meadow, grazed or tilled: an emergent wetland that has grasses, sedges, rushes or other herbaceous vegetation as its predominant vegetation and has been previously converted to agricultural activities. (Ord. 15051 § 111, 2004: Ord. 10870 § 318, 1993).21A.06.1391 Wetland. Wetland:A. An area that is inundated or saturated by ground or surface water at a frequency and duration sufficient to support, and under normal circumstances does support, a prevalence of vegetation typically adapted for life in saturated soil conditions.B. Wetlands generally include swamps, marshes, bogs and similar areas. Wetlands may include those artificial wetlands intentionally created from nonwetland areas created to mitigateconversion of wetlands.C. Wetlands do not include those artificially created wetlands intentionally created from nonwetlands sites, including, but not limited to: 1. Surface water conveyances for drainage or irrigation; 2. Grass-lined swales; 3. Canals; 4. [A]* flow control facilities or wetponds; 5. Wastewater treatment facilities; 6. Farm ponds; 7. Landscape amenities; or 9. Those wetlands created after July 1, 1990, that were unintentionally created as a result of the construction of a road, street or highway. (Ord. 19034 § 21, 2019: Ord. 16985 § 119, 2010: Ord. 15051 § 119, 2004: Ord. 12122 § 1, 1996: Ord. 11621 § 34, 1994: 10870 § 323, 1993).*Reviser's note: Changed to "Detention facilities such as" without showing the amendment as required under K.C.C. 1.24.075, in Ordinance 19034.21A.06.1392 Wetland complex. Wetland complex: a grouping of two or more wetlands, not including grazed wet meadows, that meet the following criteria:A. Each wetland included in the complex is within five hundred feet of the delineated edge of at least one other wetland in the complex;B. The complex includes at least: 1. one wetland classified category I or II; 2. three wetlands classified category III; or 3. four wetlands classified category IV;C. The area between each wetland and at least one other wetland in the complex is predominately vegetated with shrubs and trees; andD. There are not any barriers to migration or dispersal of amphibian, reptile or mammal species that are commonly recognized to exclusively or partially use wetlands and wetland buffers during a critical life cycle stage, such as breeding, rearing or feeding. (Ord. 15051 § 112, 2004).21A.06.1393 Wetland creation. Wetland creation: For purposes of wetland mitigation, the manipulation of the physical, chemical or biological characteristics present to develop a wetland on an upland or deepwater site, where a wetland did not previously exist. Activities to create a wetland typically involve excavation of upland soils to elevations that will produce a wetland hydroperiod, create hydric soils and support the growth of hydrophytic plant species. Wetland creation results in a gain in wetland acres. (Ord. 15051 § 113, 2004).21A.06.1395 Wetland edge. Wetland edge: the line delineating the outer edge of a wetland, consistent with the wetland delineation manual required by RCW 90.58.380. (Ord. 19034 § 22, 2019: Ord. 15051 § 114, 2004: Ord. 11977 § 1, 1995: Ord. 10870 § 319, 1993).21A.06.1397 Wetland enhancement. Wetland enhancement: The manipulation of the physical, chemical, or biological characteristics of a wetland site to heighten, intensify or improve specific functions or to change the growth state or composition of the vegetation present. Enhancement is undertaken for specified purposes such as water quality improvement, flood water retention or wildlife habitat. Wetland enhancement activities typically consist of planting vegetation, controlling nonnative or invasive species, modifying site elevations or the proportion of open water to influence hydroperiods or some combination of these. Wetland enhancement results in a change in some wetland functions and can lead to a decline in other wetland functions, but does not result in a gain in wetland acres. (Ord. 15051 § 115, 2004).21A.06.1400 Wetland, forested. Wetland, forested: a wetland that is dominated by mature woody vegetation or a wetland vegetation class that is characterized by woody vegetation at least twenty feet tall. (Ord. 15051 § 116, 2004: Ord. 10870 § 320, 1993).21A.06.1405 Wetland functions. Wetland functions: natural processes performed by wetlands including functions which are important in facilitating food chain production, providing habitat for nesting, rearing and resting sites for aquatic, terrestrial and avian species, maintaining the availability and quality of water, acting as recharge and discharge areas for groundwater aquifers and moderating surface and storm water flows, as well as performing other functions including, but not limited to, those set forth in 33 CFR 320.4(b)(2), 1988. (Ord. 10870 § 321, 1993).21A.06.1414 Wetland reestablishment. Wetland reestablishment: For purposes of wetland mitigation, the manipulation of the physical, chemical, or biological characteristics of a site with the goal of returning natural or historic functions to a former wetland. Activities to reestablish a wetland include removing fill material, plugging ditches, or breaking drain tiles. Wetland reestablishment results in a gain in wetland acres. (Ord. 15051 § 120, 2004).21A.06.1416 Wetland rehabilitation. Wetland rehabilitation: For purposes of wetland mitigation, the manipulation of the physical, chemical, or biological characteristics of a site with the goal of repairing natural or historic functions of a degraded wetland. Activities to rehabilitate a wetland include breaching a dike to reconnect wetlands to a floodplain or return tidal influence to a wetland. Wetland rehabilitation results in a gain in wetland function but does not result in a gain in wetland acres. (Ord. 15051 § 121, 2004).21A.06.1418 Wetland vegetation class. Wetland vegetation class: a wetland community classified by its vegetation including aquatic bed, emergent, forested and shrub-scrub. To constitute a separate wetland vegetation class, the vegetation must be at least partially rooted within the wetland and must occupy the uppermost stratum of a contiguous area or comprise at least thirty percent areal coverage of the entire wetland. (Ord. 15051 § 122, 2004).21A.06.1420 Wetpond. Wetpond: an artificial water body constructed as a part of a surface water management system. (Ord. 10870 § 324, 1993).21A.06.1422 Wildlife. Wildlife: birds, fish and animals, that are not domesticated and are considered to be wild. (Ord. 15051 § 123, 2004).21A.06.1423 Wildlife habitat conservation area. Wildlife habitat conservation area: an area for a species whose habitat the King County Comprehensive Plan requires the county to protect that includes an active breeding site and the area surrounding the breeding site that is necessary to protect breeding activity. (Ord. 15051 § 124, 2004).21A.06.1424 Wildlife habitat network. Wildlife habitat network: the official wildlife habitat network defined and mapped in the King County Comprehensive Plan that links wildlife habitat with critical areas, critical area buffers, priority habitats, trails, parks, open space and other areas to provide for wildlife movement and alleviate habitat fragmentation. (Ord. 15051 § 125, 2004).21A.06.1425 Wildlife shelter. Wildlife shelter: a facility for the temporary housing of sick, wounded or displaced wildlife. (Ord. 10870 § 325, 1993).21A.06.1427A Winery, brewery, distillery facility I. Winery, brewery, distillery facility I: A very small-scale production facility licensed by the state of Washington to produce adult beverages such as wine, cider, beer and distilled spirits, and that includes an adult beverage production use such as crushing, fermentation, distilling, barrel or tank aging, and finishing. A winery, brewery, distillery facility I may include additional production-related uses such as vineyards, orchards, wine cellars or similar product-storage areas as authorized by state law. On-site tasting of products or retail sales are not allowed. "Winery, brewery, distillery facility I" does not include any retail liquor licenses that would be authorized by chapter 314-02 WAC. (Ord. 19030 § 14, 2019).21A.06.1427B Winery, brewery, distillery facility II. Winery, brewery, distillery facility II: A small-scale production facility licensed by the state of Washington to produce adult beverages such as wine, cider, beer and distilled spirits and that includes an adult beverage production use such as crushing, fermentation, distilling, barrel or tank aging, and finishing. A winery, brewery, distillery facility II may include additional production-related uses such as vineyards, orchards, wine cellars or similar product-storage areas as authorized by state law, on-site tasting of products and sales as authorized by state law and sales of merchandise related to products available for tasting as authorized by state law. "Winery, brewery, distillery facility II" does not include any retail liquor licenses that would be authorized by chapter 314-02 WAC. (Ord. 19030 § 15, 2019).21A.06.1427C Winery, brewery, distillery facility III. Winery, brewery, distillery facility III: A production facility licensed by the state of Washington to produce adult beverages such as wine, cider, beer and distilled spirits and that includes an adult beverage production use such as crushing, fermentation, distilling, barrel or tank aging, and finishing. A winery, brewery, distillery facility III may include additional production-related uses such as vineyards, orchards, wine cellars or similar product-storage areas as authorized by state law, on-site tasting of products and sales as authorized by state law and sales of merchandise related to products available as authorized by state law. "Winery, brewery, distillery facility III" does not include any retail liquor licenses that would be authorized by chapter 314-02 WAC. (Ord. 19030 § 16, 2019).21A.06.1430 Work release facility. Work release facility: a facility which allows the opportunity for convicted persons to be employed outside of the facility, but requires confinement within the facility when not in the place of employment. (Ord. 10870 § 326, 1993).21A.06.1432 Wrecked, dismantled or inoperative vehicle. Wrecked, dismantled or inoperative vehicle: a motor vehicle as defined in RCW 46.04.320 or a boat that meets at least three of the following:A. Is three years old or older;B. Is extensively damaged, with the damage including, but not limited, to: 1. A broken window or windshield; or 2. Missing wheels, tires, motor or transmission;C. Is apparently inoperable; andD. Has an approximate fair market value equal only to the approximate value of the scrap in it.(Ord. 17539 § 25, 2013: Ord. 14309 § 14, 2002: Ord. 12024 § 11, 1995).21A.06.1435 Yard or organic waste processing facility. Yard or organic waste processing facility: a site where yard and garden wastes, including wood and landclearing debris, are processed into new products such as soil amendments and wood chips. (Ord. 11157 § 10, 1993: Ord. 10870 § 327, 1993).21A.06.1440 Zoo animal breeding facility. Zoo animal breeding facility: a non-profit farm which is owned by an American Zoo and Aquarium Association (AZA) accredited zoo, is accredited by the AZA and is operated in conformance with all licensing requirements of the United States Department of Agriculture for the purposes of long-term species survival, propagation, conservation, research, and husbandry of native and exotic wildlife and for training zoo professionals, biologists, veterinarians and other zoo-related researchers. (Ord. 12709 § 3, 1997).21A.08PERMITTED USESSections:21A.08.010Uses are subject to other rules and regulations.21A.08.020Interpretation of land use tables.21A.08.025Accessory uses prohibited if not expressly permitted.21A.08.030Residential land uses.21A.08.040Recreational/cultural land uses.21A.08.050General services land uses.21A.08.060Government/business service land uses.21A.08.070Retail land uses.21A.08.080Manufacturing land uses.21A.08.090Resource land uses.21A.08.100Regional land uses.21A.08.110Shoreline jurisdiction - permitted uses - exceptions.21A.08.900Applicability - Ordinance 13694.21A.08.010 Uses are subject to other rules and regulations. Uses permitted under this chapter are subject to all applicable King County rules and regulations and other applicable local, state or federal rules and regulations. (Ord. 17841 § 22, 2014: Ord. 10870 § 328, 1993).21A.08.020 Interpretation of land use tables.A. The land use tables in this chapter determine whether a specific use is allowed in a zone district. The zone district is located on the vertical column and the specific use is located on the horizontal row of these tables.B. If no symbol appears in the box at the intersection of the column and the row, the use is not allowed in that district, except for certain temporary uses.C. If the letter "P" appears in the box at the intersection of the column and the row, the use is allowed in that district subject to the review procedures specified in K.C.C. 21A.42 and the general requirements of the code.D. If the letter "C" appears in the box at the intersection of the column and the row, the use is allowed subject to the conditional use review procedures specified in K.C.C. 21A.42 and the general requirements of the code.E. If the letter "S" appears in the box at the intersection of the column and the row, the regional use is permitted subject to the special use permit review procedures specified in K.C.C. 21A.42 and the general requirements of the code.F. If a number appears in the box at the intersection of the column and the row, the use may be allowed subject to the appropriate review process indicated above, the general requirements of the code and the specific conditions indicated in the development condition with the corresponding number immediately following the land use table.G. If more than one letter-number combination appears in the box at the intersection of the column and the row, the use is allowed in that zone subject to different sets of limitation or conditions depending on the review process indicated by the letter, the general requirements of the code and the specific conditions indicated in the development condition with the corresponding number immediately following the table.H. All applicable requirements shall govern a use whether or not they are cross-referenced in a section. (Ord. 10870 § 329, 1993).21A.08.025 Accessory uses prohibited if not expressly permitted. Any accessory use not expressly permitted by this chapter or by the director shall be prohibited. The director may determine whether any accessory use on a site is incidental or subordinate to a principal use on the same site and whether uses not listed as accessory uses are customarily associated with a principal use. The director shall consider the purpose of the zone in K.C.C. chapter 21A.04 in making these determinations. (Ord. 17841 § 23, 2014).21A.08.030 Residential land uses.A. Residential land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC #SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOIDWELLING UNITS, TYPES:*Single DetachedP C12P2PC12PC12PC12PC12P15*TownhouseC4C4P11C12PP3P3P3P3*ApartmentC4C4P5 C5PP3P3P3P3*Mobile Home ParkS13C8P*Cottage HousingP15GROUP RESIDENCES:*Community Residential Facility-ICCP14.a CPP3P3P3P3*Community Residential Facility-IIP14.bPP3P3P3P3*DormitoryC6C6C6P*Senior Citizen Assisted HousingP4P4PP3P3P3P3ACCESSORY USES:*Residential Accessory UsesP7 P7P7P7P7P7P7P7P7P7*Home OccupationP18P18P18P18P18P18P18P18P18P18*Home IndustryCCCCTEMPORARY LODGING:7011Hotel/Motel (1)PPP*Bed and Breakfast GuesthouseP9P9P9P9P9P9P10P107041Organization Hotel/Lodging HousesP17PB. Development conditions. 1. Except bed and breakfast guesthouses. 2. In the forest production district, the following conditions apply: a. Site disturbance associated with development of any new residence shall be limited to three acres. Site disturbance shall mean all land alterations including, but not limited to, grading, utility installation, landscaping, clearing for crops, on-site sewage disposal systems, and driveways. Additional site disturbance for agriculture, including raising livestock, up to the smaller of thirty-five percent of the lot or seven aces, may be approved only if a farm management plan is prepared in accordance with K.C.C. chapter 21A.30. Animal densities shall be based on the area devoted to animal care and not the total area of the lot; b. A forest management plan shall be required for any new residence in the forest production district, that shall be reviewed and approved by the King County department of natural resources and parks before building permit issuance; and c. The forest management plan shall incorporate a fire protection element that includes fire safety best management practices developed by the department. 3. Only as part of a mixed use development subject to the conditions of K.C.C. chapter 21A.14, except that in the NB zone on properties with a land use designation of commercial outside of center (CO) in the urban areas, stand-alone townhouse developments are permitted subject to K.C.C. 21A.12.040, 21A.14.030, 21A.14.060 and 21A.14.180. 4. Only in a building listed on the National Register as an historic site or designated as a King County landmark subject to K.C.C. chapter 21A.32. 5.a. In the R-1 zone, apartment units are permitted, if: (1) At least fifty percent of the site is constrained by unbuildable critical areas. For purposes of this subsection, unbuildable critical areas includes wetlands, aquatic areas, and slopes forty percent or steeper and associated buffers; and (2) The density does not exceed a density of eighteen units per acre of net buildable area. b. In the R-4 through R-8 zones, apartment units are permitted if the density does not exceed a density of eighteen units per acre of net buildable area. c. If the proposal will exceed base density for the zone in which it is proposed, a conditional use permit is required. 6. Only as accessory to a school, college, university or church. 7.a. Accessory dwelling units are subject to the following standards: (1) Only one accessory dwelling per primary single detached dwelling or townhouse unit; (2) Only allowed in the same building as the primary dwelling unit, except that detached accessory dwelling units are allowed when there is no more than one primary dwelling unit on the lot, and the following conditions are met: (a) the lot must be three thousand two hundred square feet or greater if located in the urban area or a rural town; or (b) the lot must meet the minimum lot area for the applicable zone if located in the rural area but not in a rural town, except that if one transferable development right is purchased from the Rural Area or Natural Resource Lands under K.C.C. chapter 21A.37, a detached accessory dwelling unit is allowed on a RA-5 zoned lot that is two and one-half acres or greater; (3) The accessory dwelling unit shall not exceed one thousand square feet of heated floor area and one thousand square feet of unheated floor area except: (a) when the accessory dwelling unit is wholly contained within a basement or attic, this limitation does not apply; (b) for detached accessory dwelling units, the floor area contained in a basement does not count toward the floor area maximum; or (c) on a site zoned RA if one transferable development right is purchased from the Rural Area or Natural Resource Lands under K.C.C. chapter 21A.37, the accessory dwelling unit is permitted a maximum heated floor area of one thousand five hundred square feet and one thousand five-hundred square feet of unheated floor area; (4) Accessory dwelling units that are not wholly contained within an existing dwelling unit shall not exceed the base height established in 21A.12.030; (5) When the primary and accessory dwelling units are located in the same building, or in multiple buildings connected by a breezeway or other structure, only one entrance may front a street; (6) No additional off-street parking spaces are required for accessory dwelling units; (7) The primary dwelling unit or the accessory dwelling unit shall be occupied either by the owner of the primary dwelling unit or by an immediate family member of the owner. Immediate family members are limited to spouses, siblings, parents, grandparents, children, and grandchildren, either by blood, adoption, or marriage, of the owner. The accessory dwelling unit shall be converted to another permitted use or shall be removed if neither dwelling unit is occupied by the owner or an immediate family member; (8) An applicant seeking to build an accessory dwelling unit shall file a notice approved by the department of executive services, records and licensing services division, that identifies the dwelling unit as accessory. The notice shall run with the land. The applicant shall submit proof that the notice was filed before the department approves any permit for the construction of the accessory dwelling unit. The required contents and form of the notice shall be set forth in administrative rules; (9) Accessory dwelling units are not allowed in the F zone; (10) Accessory dwelling units should be designed to be compatible with the primary dwelling unit and the surrounding properties, including material, colors, and building forms; and (11) The applicant should consider a siting alternatives study that analyzes placement options of the accessory dwelling unit on the property to minimize impacts to privacy and views for surrounding property owners. b. Accessory living quarters: (1) are limited to one per lot; (2) are allowed only on lots of three thousand two hundred square feet or greater when located in the urban area or a rural town; (3) shall not exceed the base height as established in K.C.C. 21A.12.030; (4) shall not exceed one thousand square feet of heated floor area and one thousand square feet of unheated floor area; and (5) are not allowed in the F zone. c. One single or twin engine, noncommercial aircraft shall be permitted only on lots that abut, or have a legal access that is not a county right-of-way, to a waterbody or landing field, but only if there are: (1) no aircraft sales, service, repair, charter, or rental; and (2) no storage of aviation fuel except that contained in the tank or tanks of the aircraft. d. Battery energy storage systems are considered a residential accessory use when the total system capacity is two megawatts or less, and: (1) the system provides electricity for on-site use only, with "on-site use" including net metering as well as charging of vehicles on-site or in the right-of-way immediately adjacent to the site; or (2) the system is intended primarily for on-site use, but also participates in load sharing or another grid-connected electricity-sharing arrangement. e. Buildings for residential accessory uses in the RA and A zone shall not exceed five thousand square feet of gross floor area, except for buildings related to agriculture or forestry. 8. Mobile home parks shall not be permitted in the R-1 zones. 9. Only as accessory to the permanent residence of the operator, and: a. Serving meals shall be limited to paying guests; and b. The number of persons accommodated per night shall not exceed five, except that a structure that satisfies the standards of the International Building Code as adopted by King County for R-1 occupancies may accommodate up to ten persons per night. 10. Only if part of a mixed use development, and subject to the conditions of subsection B.9. of this section. 11. Townhouses are permitted, but shall be subject to a conditional use permit if exceeding base density. 12. Required before approving more than one dwelling on individual lots, except on lots in subdivisions, short subdivisions, or binding site plans approved for multiple unit lots, and except as provided for accessory dwelling units in subsection B.7. of this section. 13. No new mobile home parks are allowed in a rural zone. 14.a. Limited to domestic violence shelter facilities. b. Limited to domestic violence shelter facilities with no more than eighteen residents or staff. 15. Only in the R4-R8 zones subject to the following standards: a. Developments shall contain only cottage housing units with no fewer than three units. If the site contains an existing home that is not being demolished, the existing house is not required to comply with the height limitation in K.C.C. 21A.12.020.B.25. or the floor area and footprint limits in K.C.C. 21A.14.025.B.; b. Cottage housing developments should consider including a variety of housing sizes, such as units with a range of bedroom sizes or total floor area; and c. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 16. The development for a detached single-family residence shall be consistent with the following: a. The lot must have legally existed before March 1, 2005; b. The lot has a Comprehensive Plan land use designation of Rural Neighborhood Commercial Center or Rural Area; and c. The standards of this title for the RA-5 zone shall apply. 17. Only in the R-1 zone as an accessory to a golf facility and consistent with K.C.C. 21A.08.040. 18. Allowed if consistent with K.C.C. chapter 21A.30.(Ord. 19824 § 6, 2024: Ord. 19146 § 43, 2020: Ord. 19040 § 1, 2019: Ord. 18626 § 1, 2017: Ord. 18427 § 9, 2016: Ord. 17841 § 24, 2014: Ord. 17539 § 26, 2013: Ord. 17191 § 30, 2011: Ord. 16950 § 14, 2010: Ord. 16267 § 19, 2008: Ord. 16040 § 3, 2008: Ord. 15974 § 6, 2007: Ord. 15971 § 93, 2007: Ord. 15606 § 11, 2006: Ord. 15032 § 10, 2004: Ord. 14279 § 1, 2002: Ord. 14199 § 232, 2001: Ord. 14045 § 10, 2001: Ord. 12786 § 2, 1997: Ord. 12596 § 3, 1997: Ord. 12522 § 3, 1996: Ord. 12273 § 1, 1996: Ord. 12243 § 1, 1996: Ord. 11621 § 135, 1994: Ord. 11157 § 11, 1993: Ord. 10870 § 330, 1993).21A.08.040 Recreational/cultural land uses.A. Recreational/cultural land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC#SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOIPARK/RECREATION:*Park P1P1P1P1P1P1P1PPPPP13*TrailsPPPPPPPPPPPP*CampgroundsP16 C16aP16P16 C16aP16 C16aP16 C16a*Destination ResortsSS18CC*MarinaC 3C4C4C4C4P5PPPP*Recreational Vehicle ParkP19P19C2 and 18 P19C2 P19*Sports Club (17)C4 and18C4C4C4CPP*Ski AreaSS18*Recreational CampCP24 CAMUSEMENT/ENTERTAINMENT:*Adult Entertainment BusinessP6P6P6*TheaterPPPP257833Theater, Drive-inC793Bowling CenterPPP*Golf FacilityC7 and 18P7P7P77999(14)Amusement and Recreation ServicesP21P21P8 P21 C15 and 18P8 P21 P22 C15P8 P21 P22 C15P8 P21 P22 C15P21 P22PPP21P21*Indoor Paintball RangeP26P26P26*Outdoor Paintball RangeC27C27*Shooting RangeC9C9 and18C10P10*Amusement ArcadesPP7996Amusement ParkC*Outdoor Performance CenterSC12 S18P20P20SCULTURAL:823LibraryP11P11 CP11 CP28PPPP841MuseumC23C23P11P11 CP11 CP28PPPPP842ArboretumPPPPPPPPPP*Conference CenterP29C12P29C12P29CP29CPPPPB. Development conditions. 1. The following conditions and limitations shall apply, where appropriate: a. No stadiums on sites less than ten acres; b. Lighting for structures and fields shall be directed away from rural area and residential zones; c. Structures or service yards shall maintain a minimum distance of fifty feet from property lines adjoining rural area and residential zones, except for fences and mesh backstops; d. Facilities in the A zone shall be limited to trails and trailheads, including related accessory uses such as parking and sanitary facilities; and e. Overnight camping is allowed only in an approved campground. 2. Recreational vehicle parks are subject to the following conditions and limitations: a. The maximum length of stay of any vehicle shall not exceed one hundred eighty days during a three-hundred-sixty-five-day period; b. The minimum distance between recreational vehicle pads shall be no less than ten feet; and c. Sewage shall be disposed in a system approved by the Seattle-King County health department. 3. Limited to day moorage. The marina shall not create a need for off-site public services beyond those already available before the date of application. 4. Not permitted in the RA-10 or RA-20 zones. Limited to recreation facilities subject to the following conditions and limitations: a. The bulk and scale shall be compatible with residential or rural character of the area; b. For sports clubs, the gross floor area shall not exceed ten thousand square feet unless the building is on the same site or adjacent to a site where a public facility is located or unless the building is a nonprofit facility located in the urban area; and c. Use is limited to residents of a specified residential development or to sports clubs providing supervised instructional or athletic programs. 5. Limited to day moorage. 6.a. Adult entertainment businesses shall be prohibited within three hundred thirty feet of any property zoned RA, UR or R or containing schools, licensed daycare centers, public parks or trails, community centers, public libraries or churches. In addition, adult entertainment businesses shall not be located closer than three thousand feet to any other adult entertainment business. These distances shall be measured from the property line of the parcel or parcels proposed to contain the adult entertainment business to the property line of the parcels zoned RA, UR or R or that contain the uses identified in this subsection B.6.a. b. Adult entertainment businesses shall not be permitted within an area likely to be annexed to a city subject to an executed interlocal agreement between King County and a city declaring that the city will provide opportunities for the location of adult businesses to serve the area. The areas include those identified in the maps attached to Ordinance 13546. 7.a. Clubhouses, maintenance buildings, equipment storage areas and driving range tees shall be at least fifty feet from rural area and residential zoned property lines. Lighting for practice greens and driving range ball impact areas shall be directed away from adjoining rural area and residential zones. Applications shall comply with adopted best management practices for golf course development. Within the RA zone, those facilities shall be permitted only in the RA-5 and RA-2.5 zones. Not permitted in designated rural forest focus area, regionally significant resource areas or locally significant resource areas. Ancillary facilities associated with a golf course are limited to practice putting greens, maintenance buildings and other structures housing administrative offices or activities that provide convenience services to players. These convenience services are limited to a pro shop, food services and dressing facilities and shall occupy a total of no more than ten thousand square feet. Furthermore, the residential density that is otherwise permitted by the zone shall not be used on other portions of the site through clustering or on other sites through the transfer of density provision. This residential density clustering or transfer limitation shall be reflected in a deed restriction that is recorded at the time applicable permits for the development of the golf course are issued; and b. In addition to ancillary facilities, an organizational hotel/lodging house shall be allowed as an accessory use, subject to the following: (1) only allowed in the R-1 zone; (2) only allowed with a privately owned golf facility that legally existed as of January 1, 2019; (3) only allowed as an incidental or subordinate use to a principal golf facility use; (4) a maximum of twenty-four sleeping units is allowed; and (5) shall be connected to and served by public sewer. 8. Limited to golf driving ranges, only as: a. accessory to golf courses; or b. accessory to a recreation or multiuse park. 9.a. New structures and outdoor ranges shall maintain a minimum distance of fifty feet from property lines adjoining rural area and residential zones, but existing facilities shall be exempt. b. Ranges shall be designed to prevent stray or ricocheting projectiles, pellets or arrows from leaving the property. c. Site plans shall include: safety features of the range; provisions for reducing sound produced on the firing line; elevations of the range showing target area, backdrops or butts; and approximate locations of buildings on adjoining properties. d. Subject to the licensing provisions of K.C.C. Title 6. 10.a. Only in an enclosed building, and subject to the licensing provisions of K.C.C. Title 6; b. Indoor ranges shall be designed and operated so as to provide a healthful environment for users and operators by: (1) installing ventilation systems that provide sufficient clean air in the user's breathing zone, and (2) adopting appropriate procedures and policies that monitor and control exposure time to airborne lead for individual users. 11. Only as accessory to a park or in a building listed on the National Register as an historic site or designated as a King County landmark subject to K.C.C. chapter 21A.32. 12.a. Only as accessory to a nonresidential use established through a discretionary permit process, if the scale is limited to ensure compatibility with surrounding neighborhoods; and b. In the UR zone, only if the property is located within a designated unincorporated rural town. 13. Subject to the following: a. The park shall abut an existing park on one or more sides, intervening roads notwithstanding; b. No bleachers or stadiums are permitted if the site is less than ten acres, and no public amusement devices for hire are permitted; c. Any lights provided to illuminate any building or recreational area shall be so arranged as to reflect the light away from any premises upon which a dwelling unit is located; and d. All buildings or structures or service yards on the site shall maintain a distance not less than fifty feet from any property line and from any public street. 14.a. Excluding amusement and recreational uses classified elsewhere in this chapter. b. Fireworks display services, also known as public displays of fireworks, are allowed in all zones, subject to the requirements of K.C.C. chapter 17.11. 15. For amusement and recreation services not otherwise provided for in this chapter: a. In the RA zones, not subject to regulation under K.C.C. Title 6 and only on sites at least five acres or larger; b. Retail sales are limited to incidental sales to patrons of the amusement or recreation service; and c. Does not involve the operation of motor vehicles or off-road vehicles, including, but not limited to, motorcycles and gocarts. 16. Subject to the following conditions: a. The length of stay per party in campgrounds shall not exceed one hundred eighty days during a three-hundred-sixty-five-day period; and b. Only for campgrounds that are part of a proposed or existing county park, that are subject to review and public meetings through the department of natural resources and parks. 17. Only for stand-alone sports clubs that are not part of a park. 18. Subject to review and approval of conditions to comply with trail corridor provisions of K.C.C. chapter 21A.14 when located in an RA zone. 19. Only as an accessory to a recreation or multiuse park. 20. Only as an accessory to a recreation or multiuse park of at least twenty acres located within the urban growth area or on a site immediately adjacent to the urban growth area with the floor area of an individual outdoor performance center stage limited to three thousand square feet. 21. Limited to rentals of sports and recreation equipment with a total floor area of no more than seven hundred fifty square feet and only as accessory to a park, or in the RA zones, to a recreation or multiuse park. 22. Only as accessory to a large active recreation and multiuse park and limited to: a. water slides, wave pools and associated water recreation facilities; and b. rentals of sports and recreation equipment. 23. Limited to natural resource and heritage museums and only allowed in a farm or forestry structure, including but not limited to barns or sawmills, existing as of December 31, 2003. 24. Use is permitted without a conditional use permit only when in compliance with all of the following conditions: a. The use is limited to camps for youths or for persons with special needs due to a disability, as defined by the American With Disabilities Act of 1990, or due to a medical condition and including training for leaders for those who use the camp; b. Active recreational activities shall not involve the use of motorized vehicles such as cross-country motorcycles or all-terrain vehicles or the use of firearms. The prohibition on motorized vehicles does not apply to such vehicles that may be necessary for operation and maintenance of the facility or to a client-specific vehicle used as a personal mobility device; c.(1) Except as provided in subsection B.24.c.(2)(b) of this section, the number of overnight campers, not including camp personnel, in a new camp shall not exceed: (a) one hundred and fifty for a camp between twenty and forty acres; or (b) for a camp greater than forty acres, but less than two hundred and fifty acres, the number of users allowed by the design capacity of a water system and on-site sewage disposal system approved by the department of health, Seattle/King County, up to a maximum of three hundred and fifty; and (2) Existing camps shall be subject to the following: (a) For a camp established before August 11, 2005, with a conditional use permit and that is forty acres or larger, but less than one hundred and sixty acres, the number of overnight campers, not including camp personnel, may be up to one hundred and fifty campers over the limit established by subsection B.24.c.(1)(b) of this section. (b) For a camp established before August 11, 2005, with a conditional use permit and that is one hundred and sixty acres or larger, but less than two hundred acres, the number of overnight campers, not including camp personnel, may be up to three hundred and fifty campers over the limit established by subsection B.24.c.(1)(b) of this section. The camp may terminate operations at its existing site and establish a new camp if the area of the camp is greater than two hundred and fifty acres and the number of overnight campers, not including camp personnel, shall not exceed seven hundred. d. The length of stay for any individual overnight camper, not including camp personnel, shall not exceed ninety days during a three-hundred-sixty-five-day period; e. The camp facilities, such as a medical station, food service hall, and activity rooms, shall be of a scale to serve overnight camp users; f. The minimum size of parcel for such use shall be twenty acres; g. Except for any permanent caretaker residence, all new structures where camp users will be housed, fed or assembled shall be no less than fifty feet from properties not related to the camp; h. In order to reduce the visual impacts of parking areas, sports and activity fields or new structures where campers will be housed, fed or assembled, the applicant shall provide a Type 3 landscape buffer no less than twenty feet wide between the nearest property line and such parking area, field, or structures, by retaining existing vegetation or augmenting as necessary to achieve the required level of screening; i. If the site is adjacent to an arterial roadway, access to the site shall be directly onto said arterial unless direct access is unsafe due inadequate sight distance or extreme grade separation between the roadway and the site; j. If direct access to the site is via local access streets, transportation demand management measures, such as use of carpools, buses or vans to bring in campers, shall be used to minimize traffic impacts; k. Any lights provided to illuminate any building or recreational area shall be so arranged as to reflect the light away from any adjacent property; and l. A community meeting shall be convened by the applicant before submittal of an application for permits to establish a camp, or to expand the number of camp users on an existing camp site as provided in subsection B.24.c.(2)(b) of this section. Notice of the meeting shall be provided at least two weeks in advance to all property owners within five hundred feet, or at least twenty of the nearest property owners, whichever is greater. The notice shall at a minimum contain a brief description of the project and the location, as well as, contact persons and numbers. 25. Limited to theaters primarily for live productions located within a Rural Town designated by the King County Comprehensive Plan. 26.a. Only in an enclosed building; and b. A copy of the current liability policy of not less than one million dollars for bodily injury or death shall be maintained in the department. 27. Minimum standards for outdoor paintball recreation fields: a. The minimum site area is twenty-five acres; b. Structure shall be no closer than one hundred feet from any lot line adjacent to a rural area or residential zoned property; c. The area where paintballs are discharged shall be located more than three hundred feet of any lot line and more than five hundred feet from the lot line of any adjoining rural area or residential zoned property. The department may allow for a lesser setback if it determines through the conditional use permit review that the lesser setback in combination with other elements of the site design provides adequate protection to adjoining properties and rights-of-ways; d. A twenty-foot high nylon mesh screen shall be installed around all play areas and shall be removed at the end of each day when the play area is not being used.? The department may allow for the height of the screen to be lowered to no less than ten feet if it determines through the conditional use permit review that the lower screen in combination with other elements of the site design provides adequate protection from discharged paintballs; e. All parking and spectator areas, structures and play areas shall be screened from adjoining rural area or residential zoned property and public rights of way with Type 1 landscaping at least ten feet wide; f. Any retail sales conducted on the property shall be accessory and incidental to the permitted activity and conducted only for the participants of the site; g. A plan of operations specifying days and hours of operation, number of participants and employees, types of equipment to be used by users of the site, safety procedures, type of compressed air fuel to be used on the site and storage and maintenance procedures for the compressed air fuel shall be provided for review in conjunction with the conditional use permit application. All safety procedures shall be reviewed and approved by department of public safety before submittal of the conditional use permit application. All activities shall be in compliance with National Paintball League standards; h. The hours of operation shall be limited to Saturdays and Sundays and statutory holidays from 8:30 A.M. to 8:30 P.M., and further restricted as applicable to daylight hours; i. No more than one hundred paintball players shall be allowed on the site at any one time; j. No outdoor lights or amplified sounds shall be permitted; k. The facility shall have direct access to a road designated as a major collector (or higher) in the Comprehensive Plan unless the department determines through the conditional use permit review that the type and amount of traffic generated by the facility is such that it will not cause an undue impact on the neighbors or adversely affect safety of road usage; l. The facility shall be secured at the close of business each day; m. All equipment and objects used in the paintball activities shall be removed from the site within ninety days of the discontinuance of the paintball use; and n. A copy of the current liability policy of not less than one million dollars for bodily injury or death shall be submitted with the conditional use permit application and shall be maintained in the department. 28. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 29. Only as accessory to a recreation or multiuse park of least twenty acres located within the urban growth area or on a site immediately adjacent to the urban growth area or in a building listed on the National Register as an historic site or designated as a King County landmark subject to K.C.C. chapter 21A.32. (Ord. 19276 § 11, 2021: Ord. 19040 § 2, 2019: Ord. 18626 § 2, 2017: Ord. 17841 § 25, 2014: Ord. 17539 § 27, 2013: Ord. 17191 § 31, 2011: Ord. 16950 § 15, 2010: Ord. 16333 § 2, 2008: Ord. 16267 § 20, 2008: Ord. 15606 § 12, 2006: Ord. 15245 § 3, 2005: Ord. 15032 § 11, 2004: Ord. 14807 § 4, 2003: Ord. 14185 § 2, 2001: Ord. 14045 § 11, 2001: Ord. 13546 § 3, 1999: Ord. 13278 § 3, 1998: Ord. 13022 § 11, 1998: Ord. 12930 § 1, 1997: Ord. 12596 § 4, 1997: Ord. 12303 § 1, 1996: Ord. 12243 § 3, 1996: Ord. 11821 § 1, 1995: Ord. 11621 § 35, 1994: Ord. 11288 § 1, 1994: Ord. 11177 § 2, 1993: Ord. 10870 § 331, 1993).21A.08.050 General services land uses.A. General services land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC#SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOIPERSONAL SERVICES:72General Personal ServiceC25C37C25C37PPPP3P37216Drycleaning PlantsP7218Industrial LaunderersP7261Funeral Home/CrematoryC4C4C4PP*Cemetery, Columbarium or MausoleumP24 C5 and 31P24 C5P24 C5P24 C5P24P24P24 C5P24*Day Care IP6P6P6P6PPPPP7P7*Day Care IIP8 CP8 CP8 CP8 CPPPP7P7074Veterinary ClinicP9P9 C10 and 31P9 C10P10P10P10P753Automotive Repair (1)P11PPP754Automotive ServiceP11PPP76Miscellaneous Repair (44)P32 P32P32P32P32PPP866Church, Synagogue, TempleP12 C27 and 31P12 CP12 CP12 CPPPP83Social Services (2)P12 P13 C31P12 P13CP12 P13 CP12 P13CPPPP0752Animal specialty servicesC P35 P36CPPPPP*StableP14 CP14 C31P14 CP 14 C*Commercial Kennel or Commercial CatteryP42C43C43C43P43*Theatrical Production ServicesP30P28*Artist StudiosP28P28P28P28PPPP29P*Interim Recycling FacilityP21P21P21P21P22P22PP21P*Dog training facilityC34C34C34PPPPHEALTH SERVICES:801-04Office/Outpatient ClinicP12 C 13aP12 C13aP12 C13aC37P12 C13aC37PPPPP805Nursing and Personal Care FacilitiesCPP806HospitalC13aC13aPPC807Medical/Dental LabPPPP808-09Miscellaneous HealthPPPEDUCATION SERVICES:*Elementary SchoolP39P40PPPP16P40P16P40P16P40*Middle/Junior High SchoolP40C39and31PPPP16C40P16C40P16C40*Secondary or High SchoolC39 and 31C41 and 31P26P26P26P16C15P16C15P16*Vocational SchoolP13aCP13aCP13aCP15P17P*Specialized Instruction SchoolP18P19 C20 and 31P19 C20P19 C20P19 C20PPPP17P38*School District Support FacilityP23CP23CP23CC15P15P15P15P15B. Development conditions. 1. Except SIC Industry No. 7534-Tire Retreading, see manufacturing permitted use table. 2. Except SIC Industry Group Nos.: a. 835-Day Care Services, and b. Community residential facilities. 3. Limited to SIC Industry Group and Industry Nos.: a. 723-Beauty Shops; b. 724-Barber Shops; c. 725-Shoe Repair Shops and Shoeshine Parlors; d. 7212-Garment Pressing and Agents for Laundries and Drycleaners; and e. 217-Carpet and Upholstery Cleaning. 4. Only as accessory to a cemetery, and prohibited from the UR zone only if the property is located within a designated unincorporated Rural Town. 5. Structures shall maintain a minimum distance of one hundred feet from property lines adjoining rural area and residential zones. 6. Only as accessory to residential use, and: a. Outdoor play areas shall be completely enclosed by a solid wall or fence, with no openings except for gates, and have a minimum height of six feet; and b. Outdoor play equipment shall maintain a minimum distance of twenty feet from property lines adjoining rural area and residential zones. 7. Permitted as an accessory use. See commercial/industrial accessory, K.C.C. 21A.08.060.A. 8. Only as a reuse of a public school facility subject to K.C.C. chapter 21A.32, or an accessory use to a school, church, park, sport club or public housing administered by a public agency, and: a. Outdoor play areas shall be completely enclosed by a solid wall or fence, with no openings except for gates and have a minimum height of six feet; b. Outdoor play equipment shall maintain a minimum distance of twenty feet from property lines adjoining rural area and residential zones; c. Direct access to a developed arterial street shall be required in any residential zone; and d. Hours of operation may be restricted to assure compatibility with surrounding development. 9. As a home occupation only, but the square footage limitations in K.C.C. chapter 21A.30 for home occupations apply only to the office space for the veterinary clinic, and: a. Boarding or overnight stay of animals is allowed only on sites of five acres or more; b. No burning of refuse or dead animals is allowed; c. The portion of the building or structure in which animals are kept or treated shall be soundproofed. All run areas, excluding confinement areas for livestock, shall be surrounded by an eight-foot-high solid wall and the floor area shall be surfaced with concrete or other impervious material; and d. The provisions of K.C.C. chapter 21A.30 relative to animal keeping are met. 10.a. No burning of refuse or dead animals is allowed; b. The portion of the building or structure in which animals are kept or treated shall be soundproofed. All run areas, excluding confinement areas for livestock, shall be surrounded by an eight-foot-high solid wall and the floor area shall be surfaced with concrete or other impervious material; and c. The provisions of K.C.C. chapter 21A.30 relative to animal keeping are met. 11. The repair work or service shall only be performed in an enclosed building, and no outdoor storage of materials. SIC Industry No. 7532-Top, Body, and Upholstery Repair Shops and Paint Shops is not allowed. 12. Only as a reuse of a public school facility subject to K.C.C. chapter 21A.32. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 13.a. Except as otherwise provided in subsection B.13.b. of this section, only as a reuse of a surplus nonresidential facility subject to K.C.C. chapter 21A.32. b. Allowed for a social service agency on a site in the NB zone that serves transitional or low-income housing located within three hundred feet of the site on which the social service agency is located. c. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 14. Covered riding arenas are subject to K.C.C. 21A.30.030 and shall not exceed twenty thousand square feet, but stabling areas, whether attached or detached, shall not be counted in this calculation. 15. If located outside of the urban growth area, limited to projects that are of a size and scale designed to primarily serve the Rural Area and Natural Resource Lands and shall be located within a rural town. 16. If located outside of the urban growth area, shall be designed to primarily serve the Rural Area and Natural Resource Lands and shall be located within a rural town. In CB, RB and O, for K-12 schools with no more than one hundred students. 17. All instruction must be within an enclosed structure. 18. Limited to resource management education programs. 19. Only as accessory to residential use, and: a. Students shall be limited to twelve per one-hour session; b. Except as provided in subsection B.19.c. of this section, all instruction must be within an enclosed structure; c. Outdoor instruction may be allowed on properties at least two and one-half acres in size. Any outdoor activity must comply with the requirements for setbacks in K.C.C. chapter 21A.12; and d. Structures used for the school shall maintain a distance of twenty-five feet from property lines adjoining rural area and residential zones. 20. Subject to the following: a. Structures used for the school and accessory uses shall maintain a minimum distance of twenty-five feet from property lines adjoining residential zones; b. On lots over two and one-half acres: (1) Retail sale of items related to the instructional courses is permitted, if total floor area for retail sales is limited to two thousand square feet; (2) Sale of food prepared in the instructional courses is permitted with Seattle-King County department of public health approval, if total floor area for food sales is limited to one thousand square feet and is located in the same structure as the school; and (3) Other incidental student-supporting uses are allowed, if such uses are found to be both compatible with and incidental to the principal use; and c. On sites over ten acres, located in a designated Rural Town and zoned any one or more of UR, R-1 and R-4: (1) Retail sale of items related to the instructional courses is permitted, provided total floor area for retail sales is limited to two thousand square feet; (2) Sale of food prepared in the instructional courses is permitted with Seattle-King County department of public health approval, if total floor area for food sales is limited to one thousand seven hundred fifty square feet and is located in the same structure as the school; (3) Other incidental student-supporting uses are allowed, if the uses are found to be functionally related, subordinate, compatible with and incidental to the principal use; (4) The use shall be integrated with allowable agricultural uses on the site; (5) Advertised special events shall comply with the temporary use requirements of this chapter; and (6) Existing structures that are damaged or destroyed by fire or natural event, if damaged by more than fifty percent of their prior value, may reconstruct and expand an additional sixty-five percent of the original floor area but need not be approved as a conditional use if their use otherwise complies with development condition in subsection B.20.c. of this section and this title. 21. Limited to: a. drop box facilities accessory to a public or community use such as a school, fire station or community center; or b. in the RA zone, a facility accessory to a retail nursery, garden center and farm supply store that accepts earth materials, vegetation, organic waste, construction and demolition materials or source separated organic materials, if: (1) the site is five acres or greater; (2) all material is deposited into covered containers or onto covered impervious areas; (3) the facility and any driveways or other access to the facility maintain a setback of at least twenty five feet from adjacent properties; (4) the total area of the containers and covered impervious area is ten thousand square feet or less; (5) ten feet of type II landscaping is provided between the facility and adjacent properties; (6) no processing of the material is conducted on site; and (7) access to the facility is not from a local access street. 22. With the exception of drop box facilities for the collection and temporary storage of recyclable materials, all processing and storage of material shall be within enclosed buildings. Yard waste processing is not permitted. 23. Only if adjacent to an existing or proposed school. 24. Limited to columbariums accessory to a church, but required landscaping and parking shall not be reduced. 25. Not permitted in R-1 and limited to a maximum of five thousand square feet per establishment and subject to the additional requirements in K.C.C. 21A.12.230. 26.a. New high schools permitted in the rural and the urban residential and urban reserve zones shall be subject to the review process in K.C.C. 21A.42.140. b. Renovation, expansion, modernization, or reconstruction of a school, or the addition of relocatable facilities, is permitted. 27. Limited to projects that do not require or result in an expansion of sewer service outside the urban growth area. In addition, such use shall not be permitted in the RA-20 zone. 28. Only as a reuse of a surplus nonresidential facility subject to K.C.C. chapter 21A.32 or as a joint use of an existing public school facility. 29. All studio use must be within an enclosed structure. 30. Adult use facilities shall be prohibited within six hundred sixty feet of any rural area and residential zones, any other adult use facility, school, licensed daycare centers, parks, community centers, public libraries or churches that conduct religious or educational classes for minors. 31. Subject to review and approval of conditions to comply with trail corridor provisions of K.C.C. chapter 21A.14 when located in an RA zone. 32. Limited to repair of sports and recreation equipment: a. as accessory to a recreation or multiuse park in the urban growth area; or b. as accessory to a park and limited to a total floor area of seven hundred fifty square feet. 33. Repealed. 34. Subject to the following: a. the lot is at least five acres; b. in the A zones, area used for dog training shall be located on portions of agricultural lands that are unsuitable for other agricultural purposes, such as areas within the already developed portion of such agricultural lands that are not available for direct agricultural production or areas without prime agricultural soils; c. structures and areas used for dog training shall maintain a minimum distance of seventy-five feet from property lines; and d. all training activities shall be conducted within fenced areas or in indoor facilities. Fences must be sufficient to contain the dogs. 35. Limited to animal rescue shelters and provided that: a. the property shall be at least four acres; b. buildings used to house rescued animals shall be no less than fifty feet from property lines; c. outdoor animal enclosure areas shall be located no less than thirty feet from property lines and shall be fenced in a manner sufficient to contain the animals; d. the facility shall be operated by a nonprofit organization registered under the Internal Revenue Code as a 501(c)(3) organization; and e. the facility shall maintain normal hours of operation no earlier than 7 a.m. and no later than 7 p.m. 36. Limited to kennel-free dog boarding and daycare facilities, and: a. the property shall be at least four and one-half acres; b. buildings housing dogs shall be no less than seventy-five feet from property lines; c. outdoor exercise areas shall be located no less than thirty feet from property lines and shall be fenced in a manner sufficient to contain the dogs; d. the number of dogs allowed on the property at any one time shall be limited to the number allowed for hobby kennels, as provided in K.C.C. 11.04.060.B; and e. training and grooming are ancillary services that may be provided only to dogs staying at the facility; and f. the facility shall maintain normal hours of operation no earlier than 7 a.m. and no later than 7 p.m. 37. Not permitted in R-1 and subject to the additional requirements in K.C.C. 21A.12.250. 38. Driver training is limited to driver training schools licensed under chapter 46.82 RCW. 39. A school may be located outside of the urban growth area only if allowed under King County Comprehensive Plan policies. 40. Only as a reuse of an existing public school. 41. A high school may be allowed as a reuse of an existing public school if allowed under King County Comprehensive Plan policies. 42. Commercial kennels and commercial catteries in the A zone are subject to the following: a. Only as a home occupation, but the square footage limitations in K.C.C. chapter 21A.30.085 for home occupations apply only to the office space for the commercial kennel or commercial cattery; and b. Subject to K.C.C. 21A.30.020, except: (1) A building or structure used for housing dogs or cats and any outdoor runs shall be set back one hundred and fifty feet from property lines; (2) The portion of the building or structure in which the dogs or cats are kept shall be soundproofed; (3) Impervious surface for the kennel or cattery shall not exceed twelve thousand square feet; and (4) Obedience training classes are not allowed except as provided in subsection B.34. of this section. 43. Commercial kennels and commercial catteries are subject to K.C.C. 21A.30.020. 44. If the miscellaneous repair is associated with agriculture activities it will be reviewed in accordance with K.C.C. 21A.08.090. (Ord. 18626 § 3, 2017: Ord. 18427 § 10, 2016: Ord. 17841 § 26, 2014: Ord. 17539 § 28, 2013: Ord. 17485 § 20, 2012: Ord. 17191 § 32, 2011: Ord. 16950 § 16, 2010: Ord. 16594 § 1, 2009: Ord. 16267 § 21, 2008: Ord. 15974 § 7, 2007: Ord. 15816 § 1, 2007: Ord. 15606 § 13, 2006: Ord. 15245 § 4, 2005: Ord. 15032 § 12, 2004: Ord. 14807 § 5, 2003: Ord. 14678 § 1, 2003: Ord. 14429 § 1, 2002: Ord. 14045 § 12, 2001: Ord. 13278 § 4, 1998: Ord. 13022 § 12, 1998: Ord. 12642 § 1, 1997: Ord. 12596 § 5, 1997: Ord. 12588 § 1, 1997: Ord. 12374 § 1, 1996: Ord. 11621 § 36, 1994: Ord. 11157 § 12, 1993: Ord. 11113 § 9, 1993: Ord. 10870 § 332, 1993).21A.08.060 Government/business services land uses.A. Government/business services land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC#SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOI (30)GOVERNMENT SERVICES:*Public agency or utility officeP3 C5P3 C5P3 CP3 CPPPPP16*Public agency or utility yardP27P27P27P27PP*Public agency archivesPPP921CourtP4PP9221Police FacilityP7P7P7P7P7PPPP9224Fire FacilityC6 and33C6C6C6PPPPP*Utility FacilityP29 C28P29 C28P29 C28P29 C28 and 33P29 C28P29 C28P29 C28PPPPP*Commuter Parking LotC 33 P19C P19C P19C 19PPPPP35*Private Stormwater Management FacilityP8P8P8P8P8P8P8P8P8P8P8P8*Vactor Waste Receiving FacilityPPPP18P18P18P18P31P31P31P31PBUSINESS SERVICES:*Construction and TradeP34PP9P*Individual Transportation and TaxiP25PP10P421Trucking and Courier ServiceP11P12P13P*Warehousing, (1) and Wholesale TradeP*Self-service StorageP14P37PPPP4221 4222Farm Product Warehousing, Refrigeration and Storage (38)P*Log Storage (38)PP26 and 33P47Transportation ServiceP39473Freight and Cargo ServicePPP472Passenger Transportation ServicePPP 48 Communication OfficesPPP482Telegraph and other CommunicationsPPPP*General Business ServicePPPPP16*Professional OfficePPPPP167312Outdoor Advertising ServicePP17P735Miscellaneous Equipment RentalP17PP17P751Automotive Rental and LeasingPPP752Automotive ParkingP20aP20bP21P20aP*Off-Street Required Parking LotP32P32P32P32P32P32P32P32P327941Professional Sport Teams/PromotersPP873Research, Development and TestingP2P2P2*Heavy Equipment and Truck Repair PACCESSORY USES:*Commercial/Industrial Accessory UsesP41P22P41P22P41P22P41P41P41P41*Helistop40C23C233C23C23C23C24C23C24B. Development conditions. 1. Except self-service storage. 2. Except SIC Industry No. 8732-Commercial Economic, Sociological, and Educational Research, see general business service/office. 3.a. Only as a reuse of a public school facility or a surplus nonresidential facility subject to K.C.C. chapter 21A.32; or b. only when accessory to a fire facility and the office is no greater than one thousand five hundred square feet of floor area. 4. Only as a reuse of a surplus nonresidential facility subject to K.C.C. chapter 21A.32. 5. New utility office locations only if there is no commercial/industrial zoning in the utility district, and not in the RA-10 or RA-20 zones unless it is demonstrated that no feasible alternative location is possible, and provided further that this condition applies to the UR zone only if the property is located within a designated unincorporated Rural Town. 6.a. All buildings and structures shall maintain a minimum distance of twenty feet from property lines adjoining rural area and residential zones; b. Any buildings from which fire-fighting equipment emerges onto a street shall maintain a distance of thirty-five feet from such street; c. No outdoor storage; and d. Excluded from the RA-10 and RA-20 zones unless it is demonstrated that no feasible alternative location is possible. 7. Limited to storefront police offices. Such offices shall not have: a. holding cells; b. suspect interview rooms (except in the NB zone); or c. long-term storage of stolen properties. 8. Private stormwater management facilities serving development proposals located on commercial/industrial zoned lands shall also be located on commercial/industrial lands, unless participating in an approved shared facility drainage plan. Such facilities serving development within an area designated urban in the King County Comprehensive Plan shall only be located in the urban area. 9. No outdoor storage of materials. 10. Limited to office uses. 11. Limited to self-service household moving truck or trailer rental accessory to a gasoline service station. 12. Limited to self-service household moving truck or trailer rental accessory to a gasoline service station and SIC Industry No. 4215-Courier Services, except by air. 13. Limited to SIC Industry No. 4215-Courier Services, except by air. 14. Accessory to an apartment development of at least twelve units provided: a. The gross floor area in self service storage shall not exceed the total gross floor area of the apartment dwellings on the site; b. All outdoor lights shall be deflected, shaded, and focused away from all adjoining property; c. The use of the facility shall be limited to dead storage of household goods; d. No servicing or repair of motor vehicles, boats, trailers, lawn mowers, or similar equipment; e. No outdoor storage or storage of flammable liquids, highly combustible or explosive materials, or hazardous chemicals; f. No residential occupancy of the storage units; g. No business activity other than the rental of storage units; and h. A resident director shall be required on the site and shall be responsible for maintaining the operation of the facility in conformance with the conditions of approval. i. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 15. Repealed. 16. Only as an accessory use to another permitted use. 17. No outdoor storage. 18. Only as an accessory use to a public agency or utility yard, or to a transfer station. 19. Limited to new commuter parking lots designed for thirty or fewer parking spaces or commuter parking lots located on existing parking lots for churches, schools, or other permitted nonresidential uses that have excess capacity available during commuting; provided that the new or existing lot is adjacent to a designated arterial that has been improved to a standard acceptable to the department of local services; 20.a. No tow-in lots for damaged, abandoned, or otherwise impounded vehicles,and b. Tow-in lots for damaged, abandoned, or otherwise impounded vehicles shall be: (1) permitted only on parcels located within Vashon Town Center; (2) accessory to a gas or automotive service use; and (3) limited to no more than ten vehicles. 21. No dismantling or salvage of damaged, abandoned, or otherwise impounded vehicles. 22. Storage limited to accessory storage of commodities sold at retail on the premises or materials used in the fabrication of commodities sold on the premises. 23. Limited to emergency medical evacuation sites in conjunction with police, fire or health service facility. Helistops are prohibited from the UR zone only if the property is located within a designated unincorporated Rural Town. 24. Allowed as accessory to an allowed use. 25. Limited to private road ambulance services with no outside storage of vehicles. 26. Limited to two acres or less. 27a. Utility yards only on sites with utility district offices; or b. Public agency yards are limited to material storage for road maintenance facilities. 28. Limited to local distribution gas storage tanks that pipe to individual residences but excluding liquefied natural gas storage tanks. 29. Excluding local distribution gas storage tanks. 30. For I-zoned sites located outside the urban growth area designated by the King County Comprehensive Plan, uses shall be subject to the provisions for rural industrial uses in K.C.C. chapter 21A.12. 31. Vactor waste treatment, storage, and disposal shall be limited to liquid materials. Materials shall be disposed of directly into a sewer system, or shall be stored in tanks (or other covered structures), as well as enclosed buildings. 32. Provided: a. Off-street required parking for a land use located in the urban area must be located in the urban area; b. Off-street required parking for a land use located in the rural area must be located in the rural area; and c.(1) Except as provided in subsection B.32.c.(2) of this section, off-street required parking must be located on a lot that would permit, either outright or through a land use permit approval process, the land use the off-street parking will serve. (2) For a social service agency allowed under K.C.C. 21A.08.050B.13.b. to be located on a site in the NB zone, off-street required parking may be located on a site within three hundred feet of the social service agency, regardless of zoning classification of the site on which the parking is located. 33. Subject to review and approval of conditions to comply with trail corridor provisions of K.C.C. chapter 21A.14 when located in an RA zone. 34. Limited to landscape and horticultural services (SIC 078) that are accessory to a retail nursery, garden center, and farm supply store. Construction equipment for the accessory use shall not be stored on the premises. 35. Allowed as a primary or accessory use to an allowed industrial-zoned land use. 36. Repealed. 37. Use shall be limited to the NB zone on parcels outside of the Urban Growth Area, Rural Towns and Rural Neighborhoods and the building floor area devoted to such use shall not exceed ten thousand square feet. 38. If the farm product warehousing, refrigeration and storage, or log storage, is associated with agriculture activities it will be reviewed in accordance with K.C.C. 21A.08.090. 39. Excluding fossil fuel facilities. 40. Helistops are not allowed in the RA zone as an accessory to a government or business services use, but may be allowed in that zone as part of a search and rescue facility, subject to K.C.C. 21A.08.100.B.30. 41. Battery energy storage systems are considered a commercial/industrial accessory use when the total system capacity is two megawatts or less, and: a. the system provides electricity for on-site use only, with "on-site use" including net metering as well as charging of vehicles on-site or in the right-of-way immediately adjacent to the site; or b. the system is intended primarily for on-site use, but also participates in load sharing or another grid-connected electricity-sharing arrangement. (Ord. 19824 § 7, 2024: Ord. 19331 § 3, 2021: Ord. 19146 § 44, 2020: Ord. 18791 § 166, 2018: Ord. 18626 § 4, 2017: Ord. 17841 § 27, 2014: Ord. 17539 § 29, 2013: Ord. 16950 § 17, 2010: Ord. 16594 § 2, 2009: Ord. 16267 § 79, 2008: Ord. 15974 § 8, 2007: Ord. 15606 § 14, 2006: Ord. 15245 § 6, 2005: Ord. 15032 § 13, 2004: Ord. 14254 § 1, 2001: Ord. 14045 § 13, 2001: Ord. 13278 § 5, 1998: Ord. 13190 § 15, 1998: Ord. 13022 § 13, 1998: Ord. 12596 § 6, 1997: Ord. 12243 § 2, 1996: Ord. 12018 § 3, 1995: Ord. 11621 § 37, 1994: Ord. 11157 § 13, 1993: Ord. 10870 § 333, 1993).21A.08.070 Retail land uses.A. Retail land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC#SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOI (30)*Building Materials and Hardware StoresP23P2PP*Retail Nursery, Garden Center and Farm Supply StoresP1 C1P1 C1PPP*Forest Products SalesP3 and 4P4P3 and 4P* Department and Variety StoresC14aP14P5PP54Food StoresC15aP15PPPCP6*Agricultural Product Sales (28)P25P25P25P25P25P25*Farmers MarketP24P24P24P24P24P24P24P24P24P24P24*Motor Vehicle and Boat DealersP8P553Auto Supply StoresP9P9P554Gasoline Service StationsPPPP56Apparel and Accessory StoresPP*Furniture and Home Furnishings StoresPP58Eating and Drinking PlacesP21 C19P20 C16P20 P16P10PPPP*Remote Tasting RoomP13P7P7*Drug StoresC15P15PPPC*Marijuana retailerP26 C27P26 C27592Liquor StoresPP593Used Goods: Antiques/ Secondhand ShopsPP*Sporting Goods and Related StoresP22 and 29P22 and 29P22 and 29P22 and 29P22 and 29P22 and 29P29P29P22 and 29P22 and 29*Book, Stationery, Video and Art Supply StoresC15aP15PPP*Jewelry StoresPP*Monuments, Tombstones, and GravestonesP*Hobby, Toy, Game ShopsPPP*Photographic and Electronic ShopsPPP*Fabric ShopsPP598Fuel DealersC11PP*Florist ShopsC15aP15PPPP*Personal Medical Supply StoresPP*Pet ShopsPPP*Bulk RetailPP*Auction HousesP12P*Livestock Sales (28)PB. Development conditions. 1.a. As a permitted use, covered sales areas shall not exceed a total area of two thousand square feet, unless located in a building designated as historic resource under K.C.C. chapter 20.62. With a conditional uses permit, covered sales areas of up to three thousand five hundred square feet may be allowed. Greenhouses used for the display of merchandise other than plants shall be considered part of the covered sales area. Uncovered outdoor areas used to grow or display trees, shrubs, or other plants are not considered part of the covered sales area; b. The site area shall be at least four and one-half acres; c. Sales may include locally made arts and crafts; and d. Outside lighting is permitted if no off-site glare is allowed. 2. Only hardware stores. 3.a. Limited to products grown on site. b. Covered sales areas shall not exceed a total area of five hundred square feet. 4. No permanent structures or signs. 5. Limited to SIC Industry No. 5331-Variety Stores, and further limited to a maximum of two thousand square feet of gross floor area. 6. Limited to a maximum of five thousand square feet of gross floor area. 7. Off-street parking is limited to a maximum of one space per fifty square feet of tasting and retail areas. 8. Excluding retail sale of trucks exceeding one-ton capacity. 9. Only the sale of new or reconditioned automobile supplies is permitted. 10. Excluding SIC Industry No. 5813-Drinking Places. 11. No outside storage of fuel trucks and equipment. 12. Excluding vehicle and livestock auctions. 13. Permitted as part of the demonstration project authorized by K.C.C. 21A.55.110. 14.a. Not in R-1 and limited to SIC Industry No. 5331-Variety Stores, limited to a maximum of five thousand square feet of gross floor area, and subject to K.C.C. 21A.12.230; and b. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 15.a. Not permitted in R-1 and limited to a maximum of five thousand square feet of gross floor area and subject to K.C.C. 21A.12.230; and b. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 16.a. Not permitted in R-1 and excluding SIC Industry No. 5813-Drinking Places, and limited to a maximum of five thousand square feet of gross floor area and subject to K.C.C. 21A.12.230, except as provided in subsection B.20. of this section; and b. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. 17. Repealed. 18. Repealed. 19. Only as: a. an accessory use to a permitted manufacturing or retail land use, limited to espresso stands to include sales of beverages and incidental food items, and not to include drive-through sales; or b. an accessory use to a recreation or multiuse park, limited to a total floor area of three thousand five hundred square feet. 20. Only as: a. an accessory use to a recreation or multiuse park; or b. an accessory use to a park and limited to a total floor area of one thousand five hundred square feet. 21. Accessory to a park, limited to a total floor area of seven hundred fifty square feet. 22. Only as an accessory use to: a. a large active recreation and multiuse park in the urban growth area; or b. a park, or a recreation or multiuse park in the RA zones, and limited to a total floor area of seven hundred and fifty square feet. 23. Only as accessory to SIC Industry Group No. 242-Sawmills and SIC Industry No. 2431-Millwork and; a. limited to lumber milled on site; and b. the covered sales area is limited to two thousand square feet. The covered sales area does not include covered areas used to display only milled lumber. 24. Requires at least five farmers selling their own products at each market and the annual value of sales by farmers should exceed the annual sales value of nonfarmer vendors. 25. Limited to sites located within the urban growth area and: a. The sales area shall be limited to three hundred square feet and must be removed each evening; b. There must be legal parking that is easily available for customers; and c. The site must be in an area that is easily accessible to the public, will accommodate multiple shoppers at one time and does not infringe on neighboring properties. 26.a. Per lot, limited to a maximum aggregated total of two thousand square feet of gross floor area devoted to, and in support of, the retail sale of marijuana. b. Notwithstanding subsection B.26.a. of this section, the maximum aggregated total gross floor area devoted to, and in support of, the retail sale of marijuana may be increased to up to three thousand square feet if the retail outlet devotes at least five hundred square feet to the sale, and the support of the sale, of medical marijuana, and the operator maintains a current medical marijuana endorsement issued by the Washington state Liquor and Cannabis Board. c. Any lot line of a lot having any area devoted to retail marijuana activity must be one thousand feet or more from any lot line of any other lot having any area devoted to retail marijuana activity; and a lot line of a lot having any area devoted to new retail marijuana activity may not be within one thousand feet of any lot line of any lot having any area devoted to existing retail marijuana activity. d. Whether a new retail marijuana activity complies with this locational requirement shall be determined based on the date a conditional use permit application submitted to the department of local services, permitting division, became or was deemed complete, and: (1) if a complete conditional use permit application for the proposed retail marijuana use was not submitted, or if more than one conditional use permit application became or was deemed complete on the same date, then the director shall determine compliance based on the date the Washington state Liquor and Cannabis Board issues a Notice of Marijuana Application to King County; (2) if the Washington state Liquor and Cannabis Board issues more than one Notice of Marijuana Application on the same date, then the director shall determine compliance based on the date either any complete building permit or change of use permit application, or both, were submitted to the department declaring retail marijuana activity as an intended use; (3) if more than one building permit or change of use permit application was submitted on the same date, or if no building permit or change of use permit application was submitted, then the director shall determine compliance based on the date a complete business license application was submitted; and (4) if a business license application was not submitted or more than one business license application was submitted, then the director shall determine compliance based on the totality of the circumstances, including, but not limited to, the date that a retail marijuana license application was submitted to the Washington state Liquor and Cannabis Board identifying the lot at issue, the date that the applicant entered into a lease or purchased the lot at issue for the purpose of retail marijuana use and any other facts illustrating the timing of substantial investment in establishing a licensed retail marijuana use at the proposed location. e. Retail marijuana businesses licensed by the Washington state Liquor and Cannabis Board and operating within one thousand feet of each other as of August 14, 2016, and retail marijuana businesses that do not require a permit issued by King County, that received a Washington state Liquor and Cannabis Board license to operate in a location within one thousand feet of another licensed retail marijuana business prior to August 14, 2016, and that King County did not object to within the Washington state Liquor and Cannabis Board marijuana license application process, shall be considered nonconforming and may remain in their current location, subject to the provisions of K.C.C. 21A.32.020 through 21A.32.075 for nonconforming uses, except: (1) the time periods identified in K.C.C. 21A.32.045.C. shall be six months; and (2) the gross floor area of a nonconforming retail outlet may be increased up to the limitations in subsection B.26.a. and B.26.b. of this section. 27. Per lot, limited to a maximum aggregated total of five thousand square feet gross floor area devoted to, and in support of, the retail sale of marijuana, and; a. Any lot line of a lot having any area devoted to retail marijuana activity must be one thousand feet or more from any lot line of any other lot having any area devoted to retail marijuana activity; and any lot line of a lot having any area devoted to new retail marijuana activity may not be within one thousand feet of any lot line of any lot having any area devoted to existing retail marijuana activity; and b. Whether a new retail marijuana activity complies with this locational requirement shall be determined based on the date a conditional use permit application submitted to the department of local services, permitting division, became or was deemed complete, and: (1) if a complete conditional use permit application for the proposed retail marijuana use was not submitted, or if more than one conditional use permit application became or was deemed complete on the same date, then the director shall determine compliance based on the date the Washington state Liquor and Cannabis Board issues a Notice of Marijuana Application to King County; (2) if the Washington state Liquor and Cannabis Board issues more than one Notice of Marijuana Application on the same date, then the director shall determine compliance based on the date either any complete building permit or change of use permit application, or both, were submitted to the department declaring retail marijuana activity as an intended use; (3) if more than one building permit or change of use permit application was submitted on the same date, or if no building permit or change of use permit application was submitted, then the director shall determine compliance based on the date a complete business license application was submitted; and (4) if a business license application was not submitted or more than one business license application was submitted, then the director shall determine compliance based on the totality of the circumstances, including, but not limited to, the date that a retail marijuana license application was submitted to the Washington state Liquor and Cannabis Board identifying the lot at issue, the date that the applicant entered into a lease or purchased the lot at issue for the purpose of retail marijuana use, and any other facts illustrating the timing of substantial investment in establishing a licensed retail marijuana use at the proposed location; and c. Retail marijuana businesses licensed by the Washington state Liquor and Cannabis Board and operating within one thousand feet of each other as of August 14, 2016, and retail marijuana businesses that do not require a permit issued by King County, that received a Washington state Liquor and Cannabis Board license to operate in a location within one thousand feet of another licensed retail marijuana business prior to August 14, 2016, and that King County did not object to within the Washington state Liquor and Cannabis Board marijuana license application process, shall be considered nonconforming and may remain in their current location, subject to the provisions of K.C.C. 21A.32.020 through 21A.32.075 for nonconforming uses, except: (1) the time periods identified in K.C.C. 21A.32.045.C. shall be six months; and (2) the gross floor area of a nonconforming retail outlet may be increased up to the limitations in subsection B.27. of this section, subject to K.C.C. 21A.42.190. 28. If the agricultural product sales or livestock sales is associated with agricultural activities it will be reviewed in accordance with K.C.C. 21A.08.090. 29. Businesses selling firearms that have a storefront, have hours during which it is open for business, and post advertisements or signs observable to passersby that firearms are available for sale shall be located at least five hundred feet or more from any elementary, middle/junior high and secondary or high school properties. Businesses selling firearms in existence before June 30, 2020, shall be considered nonconforming and may remain in their current location, subject to the provisions of K.C.C. 21A.32.020 through 21A.32.075 for nonconforming uses. (Ord. 19146 § 45, 2020: Ord. 19030 § 17, 2019: Ord. 18791 § 167, 2018: Ord. 18626 § 5, 2017: Ord. 18326 § 13, 2016: Ord. 17841 § 28, 2014: Ord. 17710 § 7, 2013: Ord. 17539 § 30, 2013: Ord. 17191 § 33, 2011: Ord. 16950 § 18, 2010: Ord. 16267 § 22, 2008: Ord. 15974 § 9, 2007: Ord. 15606 § 15, 2006: Ord. 15032 § 14, 2004: Ord. 14807 § 6, 2003: Ord. 14781 § 1, 2003: Ord. 14045 § 14, 2001: Ord. 13546 § 4, 1999: Ord. 13022 § 14, 1998: Ord. 12596 § 7, 1997: Ord. 10870 § 334, 1993).21A.08.080 Manufacturing land uses.A. Manufacturing land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC #SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOI (11)20Food and Kindred Products (28)P2P2P2CP2 C*Winery/Brewery/Distillery Facility IP32*Winery/Brewery/Distillery Facility IIP3 P3C30P17P17P29P31Winery/Brewery/Distillery Facility IIIC12C12C29C29C29C31*Materials Processing FacilityP13 CP14C15P16 CP22Textile Mill ProductsC23Apparel and other Textile ProductsCP24Wood Products, except furnitureP4P18P4 P18C5P4P18 C5P4C6P25Furniture and FixturesP19P19CP26Paper and Allied ProductsC27Printing and PublishingP7P7P7CP7CP*Marijuana Processor IP20P27P21C22P21 C22*Marijuana Processor IIP23C24P23C24P25C2628Chemicals and Allied ProductsC2911Petroleum Refining and Related IndustriesC30Rubber and Misc. Plastics ProductsC31Leather and Leather GoodsCP32Stone, Clay, Glass and Concrete ProductsP6P9P33Primary Metal IndustriesC34Fabricated Metal ProductsP35Industrial and Commercial MachineryP351-55Heavy Machinery and EquipmentC357Computer and Office EquipmentCCP36Electronic and other Electric EquipmentCP374Railroad EquipmentC376Guided Missile and Space Vehicle PartsC379Miscellaneous Transportation VehiclesC38Measuring and Controlling InstrumentsCCP39Miscellaneous Light ManufacturingCP*Motor Vehicle and Bicycle ManufacturingC*Aircraft, Ship and Boat BuildingP10C7534Tire RetreadingCP781-82Movie Production/DistributionPPB. Development conditions. 1. Repealed. 2. Except slaughterhouses. 3.a. In the A zone, only allowed on sites where the primary use is SIC Industry Group No. 01-Growing and Harvesting Crops or No. 02-Raising Livestock and Small Animals; b. Only allowed on lots of at least two and one-half acres, except that this requirement shall not apply on Vashon-Maury Island to winery, brewery or distillery business locations in use and licensed to produce by the Washington state Liquor and Cannabis Board before January 1, 2019, and that in the RA zone, for sites that contain a building designated as historic resource under K.C.C. chapter 20.62, only allowed on lots of at least two acres; c. The aggregated floor area of structures and areas for winery, brewery, distillery facility uses shall not exceed three thousand five hundred square feet, unless located in whole or in part in a structure designated as historic resource under K.C.C. chapter 20.62, in which case the aggregated floor area of structures and areas devoted to winery, brewery, distillery facility uses shall not exceed seven thousand square feet in the RA zone and five thousand square feet in the A zone. Decks that are not occupied and not open to the public are excluded from the calculation for maximum aggregated floor area; d. Structures and parking areas for winery, brewery, distillery facility uses shall maintain a minimum distance of seventy-five feet from interior property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62, except that on Vashon-Maury Island this setback requirement shall not apply to structures and parking areas in use on December 4, 2019, by existing winery, brewery or distillery business locations licensed to produce by the Washington state Liquor and Cannabis Board before January 1, 2019; e. In the A zone, sixty percent or more of the products processed must be grown on-site. At the time of the initial application under K.C.C. chapter 6.74, the applicant shall submit a projection of the source of products to be produced; f. At least two stages of production of wine, beer, cider or distilled spirits, such as crushing, fermenting, distilling, barrel or tank aging, or finishing, as authorized by the Washington state Liquor and Cannabis Board production license, shall occur on-site. At least one of the stages of production occurring on-site shall include crushing, fermenting or distilling; g. In the A zone, structures and area for non-agricultural winery, brewery, distillery facility uses shall be located on portions of agricultural lands that are unsuitable for agricultural purposes, such as areas within the already developed portion of such agricultural lands that are not available for direct agricultural production, or areas without prime agricultural soils. No more than one acre of agricultural land may be converted to a nonagricultural accessory use; h. Tasting and retail sales of products produced on-site may occur only as accessory to the primary winery, brewery, distillery production use and may be provided in accordance with state law. The area devoted to on-site tasting or retail sales shall be limited to no more than thirty percent of the aggregated floor area and shall be included in the aggregated floor area limitation in subsection B.3.c. of this section. The limitation on tasting and retail sales of products produced on-site shall not apply on Vashon-Maury Island to winery, brewery, or distillery business locations in use and licensed to produce by the Washington state Liquor and Cannabis Board before January 1, 2019, or on sites in the RA zone that contain a building designated as historic resource under K.C.C. chapter 20.62. Incidental retail sales of merchandise related to the products produced on-site is allowed subject to the restrictions described in this subsection B.3. Hours of operation for on-site tasting of products shall be limited as follows: Mondays, Tuesdays, Wednesdays and Thursdays, tasting room hours shall be limited to 11:00 a.m. through 7:00 p.m.; and Fridays, Saturdays and Sundays, tasting room hours shall be limited to 11:00 a.m. through 9:00 p.m.; i. Access to the site shall be directly to and from an arterial roadway, except that this requirement shall not apply on Vashon-Maury Island to winery, brewery, distillery facility business locations in use and licensed to produce by the Washington state Liquor and Cannabis Board before January 1, 2019; j. Off-street parking is limited to a maximum of one hundred fifty percent of the minimum required for winery, brewery, distillery facilities in K.C.C. 21A.18.030; k. The business operator shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; l. Events may be allowed with an approved temporary use permit under K.C.C. chapter 21A.32 or in compliance with the exemption in K.C.C. 21A.32.110.E.; and m. The impervious surface associated with the winery, brewery, distillery facility use shall not exceed twenty-five percent of the site, or the maximum impervious surface for the zone in accordance with K.C.C. 21A.12.030.A. or 21A.12.040.A., whichever is less. 4. Limited to rough milling and planing of products grown on-site with portable equipment. 5. Limited to SIC Industry Group No. 242-Sawmills and SIC Industry No. 2431-Millwork. For RA zoned sites, if using lumber or timber grown off-site, the minimum site area is four and one-half acres. 6. Limited to uses found in SIC Industry No. 2434-Wood Kitchen Cabinets and No. 2431-Millwork, (excluding planing mills). 7. Limited to photocopying and printing services offered to the general public. 8. Only within enclosed buildings, and as an accessory use to retail sales. 9. Only within enclosed buildings. 10. Limited to boat building of craft not exceeding forty-eight feet in length. 11. For I-zoned sites located outside the urban growth area designated by the King County Comprehensive Plan, uses shown as a conditional use in the table of K.C.C. 21A.08.080.A. shall be prohibited, and all other uses shall be subject to the provisions for rural industrial uses as set forth in K.C.C. chapter 21A.12. 12.a. In the A zone, only allowed on sites where the primary use is SIC Industry Group No. 01-Growing and Harvesting Crops or No. 02-Raising Livestock and Small Animals; b. The aggregated floor area of structures and areas for winery, brewery, distillery facility uses shall not exceed a total of eight thousand square feet. Decks that are not occupied and not open to the public are excluded from the calculation for maximum aggregated floor area; c. Only allowed on lots of at least four and one-half acres. If the aggregated floor area of structures for winery, brewery, distillery uses exceeds six thousand square feet, the minimum site area shall be ten acres; d. Wineries, breweries and distilleries shall comply with Washington state Department of Ecology and King County board of health regulations for water usage and wastewater disposal, and must connect to an existing Group A water system. The definitions and limits of Group A water systems are described in K.C.C. 13.24.007, and provision of water service is described in K.C.C. 13.24.138, 13.24.140 and 13.24.142; e. Structures and parking areas for winery, brewery distillery facility uses shall maintain a minimum distance of seventy-five feet from interior property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62; f. In the A Zone, sixty percent or more of the products processed must be grown on-site. At the time of the initial application under K.C.C. chapter 6.74, the applicant shall submit a projection of the source of products to be processed; g. At least two stages of production of wine, beer, cider or distilled spirits, such as crushing, fermenting, distilling, barrel or tank aging, or finishing, as authorized by the Washington state Liquor and Cannabis Board production license, shall occur on-site. At least one of the stages of on-site production shall include crushing, fermenting or distilling; h. In the A zone, structures and areas for non-agricultural winery, brewery, distillery facility uses shall be located on portions of agricultural lands that are unsuitable for agricultural purposes, such as areas within the already developed portion of such agricultural lands that are not available for direct agricultural production, or areas without prime agricultural soils. No more than one acre of agricultural land may be converted to a nonagricultural accessory use; i. Tasting and retail sales of products produced on-site may occur only as accessory to the primary winery, brewery, distillery production use and may be provided in accordance with state law. The area devoted to on-site tasting or retail sales shall be limited to no more than thirty percent of the aggregated floor area and shall be included in the aggregated floor area limitation in subsection B.12.b. and c. of this section. Incidental retail sales of merchandise related to the products produced on-site is allowed subject to the restrictions described in this subsection. Hours of operation for on-site tasting of products shall be limited as follows: Mondays, Tuesdays, Wednesdays and Thursdays, tasting room hours shall be limited to 11:00 a.m. through 7:00 p.m.; and Fridays, Saturdays and Sundays, tasting room hours shall be limited to 11:00 a.m. through 9:00 p.m.; j. Access to the site shall be directly to and from an arterial roadway; k. Off-street parking maximums shall be determined through the conditional use permit process, and should not be more than one hundred fifty percent of the minimum required for winery, brewery, distillery facilities in K.C.C. 21A.18.030; l. The business operator shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; m. Events may be allowed with an approved temporary use permit under K.C.C. chapter 21A.32 or in compliance with the exemption in K.C.C. 21A.32.110.E.; and n. The impervious surface associated with the winery, brewery, distillery facility use shall not exceed twenty-five percent of the site, or the maximum impervious surface for the zone in accordance with K.C.C. 21A.12.030.A. or 21A.12.040.A., whichever is less. 13. Only on the same lot or same group of lots under common ownership or documented legal control, which includes, but is not limited to, fee simple ownership, a long-term lease or an easement: a. as accessory to a primary forestry use and at a scale appropriate to process the organic waste generated on the site; or b. as a continuation of a sawmill or lumber manufacturing use only for that period to complete delivery of products or projects under contract at the end of the sawmill or lumber manufacturing activity. 14. Only on the same lot or same group of lots under common ownership or documented legal control, which includes, but is not limited to, fee simple ownership, a long-term lease or an easement: a. as accessory to a primary mineral use; or b. as a continuation of a mineral processing use only for that period to complete delivery of products or projects under contract at the end of mineral extraction. 15. Continuation of a materials processing facility after reclamation in accordance with an approved reclamation plan. 16. Only a site that is ten acres or greater and that does not use local access streets that abut lots developed for residential use. 17.a. The aggregated floor area of structures and areas for winery, brewery, distillery facility uses shall not exceed three thousand five hundred square feet, unless located in whole or in part in a structure designated as historic resource under K.C.C. chapter 20.62, in which case the aggregated floor area of structures and areas devoted to winery, brewery, distillery facility uses shall not exceed five thousand square feet. Decks that are not occupied and not open to the public are excluded from the calculation for maximum aggregated floor area; b. Structures and parking areas for winery, brewery, distillery facility uses shall maintain a minimum distance of seventy-five feet from interior property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62; c. Tasting and retail sale of products produced on-site, and merchandise related to the products produced on-site, may be provided in accordance with state law. The area devoted to on-site tasting or retail sales shall be included in the aggregated floor area limitation in subsection B.17.a. of this section; d. Off-street parking for the tasting and retail areas shall be limited to a maximum of one space per fifty square feet of tasting and retail areas; e. The business operator shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; and f. Events may be allowed with an approved temporary use permit under K.C.C. chapter 21A.32. 18. Limited to: a. SIC Industry Group No. 242-Sawmills and SIC Industry No. 2431-Millwork, as follows: (1) If using lumber or timber grown off-site, the minimum site area is four and one-half acres; (2) The facility shall be limited to an annual production of no more than one hundred fifty thousand board feet; (3) Structures housing equipment used in the operation shall be located at least one-hundred feet from adjacent properties with residential or rural area zoning; (4) Deliveries and customer visits shall be limited to the hours of 8:00 a.m. to 7:00 p.m. on weekdays, and 9:00 a.m. to 5:00 p.m. on weekends; (5) In the RA zone, the facility's driveway shall have adequate entering sight distance required by the 2007 King County Road Design and Construction Standards. An adequate turn around shall be provided on-site to prevent vehicles from backing out on to the roadway that the driveway accesses; and (6) Outside lighting is limited to avoid off-site glare; and b. SIC Industry No. 2411-Logging. 19. Limited to manufacture of custom made wood furniture or cabinets. 20.a. Only allowed on lots of at least four and one-half acres; b. Only as an accessory use to a Washington state Liquor Control Board licensed marijuana production facility on the same lot; c. With a lighting plan, only if required by K.C.C. 21A.12.220.H.; d. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; and e. Accessory marijuana processing uses allowed under this section are subject to all limitations applicable to marijuana production uses under K.C.C. 21A.08.090. 21.a. Only in the CB and RB zones located outside the urban growth area; b. With a lighting plan, only if required by K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; d. Per lot, the aggregated total gross floor area devoted to the use of, and in support of, processing marijuana together with any separately authorized production of marijuana shall be limited to a maximum of two thousand square feet; and e. If the two-thousand-square-foot-per-lot threshold is exceeded, each and every marijuana-related entity occupying space in addition to the two-thousand-square-foot threshold area on that lot shall obtain a conditional use permit as set forth in subsection B.22. of this section. 22.a. Only in the CB and RB zones located outside the urban growth area; b. Per lot, the aggregated total gross floor area devoted to the use of, and in support of, processing marijuana together with any separately authorized production of marijuana shall be limited to a maximum of thirty thousand square feet; c. With a lighting plan, only if required by K.C.C. 21A.12.220.H.; and d. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site. 23.a. Only in the CB and RB zones located inside the urban growth area; b. With a lighting plan, only if required by K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; d. Per lot, the aggregated total gross floor area devoted to the use of, and in support of, processing marijuana together with any separately authorized production of marijuana shall be limited to a maximum of two thousand square feet; and e. If the two-thousand-square-foot-per-lot threshold is exceeded, each and every marijuana-related entity occupying space in addition to the two-thousand-square-foot threshold area on that lot shall obtain a conditional use permit as set forth in subsection B.24. of this section. 24.a. Only in the CB and RB zones located inside the urban growth area; b. With a lighting plan, only if required by K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; and d. Per lot, the aggregated total gross floor area devoted to the use of, and in support of, processing marijuana together with any separately authorized production of marijuana shall be limited to a maximum of thirty thousand square feet. 25.a. With a lighting plan, only if required by K.C.C. 21A.12.220.H.; b. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; and c. Per lot, limited to a maximum aggregate total of two thousand square feet of gross floor area devoted to, and in support of, the processing of marijuana together with any separately authorized production of marijuana. 26.a. With a lighting plan, only if required by K.C.C. 21A.12.220.H.; b. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; and c. Per lot, limited to a maximum aggregate total of thirty thousand square feet of gross floor area devoted to, and in support of, the processing of marijuana together with any separately authorized production of marijuana. 27.a. Marijuana processors in all RA zoned areas except for Vashon-Maury Island, that do not require a conditional use permit issued by King County, that receive a Washington state Liquor and Cannabis Board license business prior to October 1, 2016, and that King County did not object to within the Washington state Liquor and Cannabis Board marijuana license application process, shall be considered nonconforming as to subsection B.27.e. of this section, subject to the provisions of K.C.C. 21A.32.020 through 21A.32.075 for nonconforming uses; b. Only with a lighting plan that complies with K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; d. Only allowed on lots of at least four and on-half acres on Vashon-Maury Island; e. Only allowed in the RA-10 or the RA-20 zone, on lots of at least ten acres, except on Vashon-Maury Island; f. Only as an accessory use to a Washington state Liquor Cannabis Board licensed marijuana production facility on the same lot; and g. Accessory marijuana processing uses allowed under this section are subject to all limitations applicable to marijuana production uses under K.C.C. 21A.08.090. 28. If the food and kindred products manufacturing or processing is associated with agricultural activities it will be reviewed in accordance with K.C.C. 21A.08.090. 29.a. Tasting and retail sales of products produced on-site, and merchandise related to the products produced on-site, may be provided in accordance with state law; b. Structures and parking areas for winery, brewery, distillery facility uses shall maintain a minimum distance of seventy-five feet from interior property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62; c. For winery, brewery, distillery facility uses that do not require a conditional use permit, off-street parking for the tasting and retail areas shall be limited to a maximum of one space per fifty square feet of tasting and retail areas. For winery, brewery, distillery facility uses that do require a conditional use permit, off-street parking maximums shall be determined through the conditional use permit process, and off-street parking for the tasting and retail areas should be limited to a maximum of one space per fifty square feet of tasting and retail areas; d. The business operator shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; and e. Events may be allowed with an approved temporary use permit under K.C.C. chapter 21A.32. 30.a. Only allowed on lots of at least two and one-half acres; b. The aggregated floor area of structures and areas for winery, brewery, distillery facility uses shall not exceed three thousand five hundred square feet, unless located in whole or in part in a structure designated as historic resource under K.C.C. chapter 20.62, in which case the aggregated floor area of structures and areas devoted to winery, brewery, distillery facility uses shall not exceed five thousand square feet. Decks that are not occupied and not open to the public are excluded from the calculation for maximum aggregated floor area; c. Structures and parking areas for winery, brewery, distillery facility uses shall maintain a minimum distance of seventy-five feet from interior property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62; d. Tasting and retail sales of products produced on-site may only occur as accessory to the primary winery, brewery, distillery production use and may be provided in accordance with state law. The area devoted to on-site tasting or retail sales shall be limited to no more than thirty percent of the aggregated floor area and shall be included in the aggregated floor area limitation in subsection B.30.b. of this section. Incidental retail sales of merchandise related to the products produced on-site is allowed subject to the restrictions described in this subsection. Hours of operation for on-site tasting of products shall be limited as follows: Mondays, Tuesdays, Wednesdays and Thursdays, tasting room hours shall be limited to 11:00 a.m. through 7:00 p.m.; and Fridays, Saturdays and Sundays, tasting room hours shall be limited to 11:00 a.m. through 9:00 p.m.; e. Access to the site shall be directly to and from a public roadway; f. Off-street parking is limited to a maximum of one hundred fifty percent of the minimum required for winery, brewery, distillery facilities in K.C.C. 21A.18.030; g. The business operator shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; h. Events may be allowed with an approved temporary use permit under K.C.C. chapter 21A.32 or in compliance with the exemption in K.C.C. 21A.32.110.E.; i. At least two stages of production of wine, beer, cider or distilled spirits, such as crushing, fermenting, distilling, barrel or tank aging, or finishing, as authorized by the Washington state Liquor and Cannabis Board production license, shall occur on-site. At least one of the stages of production occurring on-site shall include crushing, fermenting or distilling; and j. The impervious surface associated with the winery, brewery, distillery facility use shall not exceed twenty-five percent of the site, or the maximum impervious surface for the zone in accordance with K.C.C. 21A.12.030.A. or 21A.12.040.A., whichever is less. 31.a. Limited to businesses with non-retail brewery and distillery production licenses from the Washington state Liquor and Cannabis board. Wineries and remote tasting rooms for wineries shall not be allowed; b. Tasting and retail sale of products produced on-site and merchandise related to the products produced on-site may be provided in accordance with state law. The area devoted to on-site tasting or retail sales shall not exceed one thousand five hundred square feet; c. Structures and parking areas for brewery and distillery facility uses shall maintain a minimum distance of seventy-five feet from interior property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62; d. For brewery and distillery facility uses that do not require a conditional use permit, off-street parking for the tasting and retail areas shall be limited to a maximum of one space per fifty square feet of tasting and retail areas. For brewery and distillery facility uses that do require a conditional use permit, off-street parking maximums shall be determined through the conditional use permit process, and off-street parking for the tasting and retail areas should be limited to a maximum of one space per fifty square feet of tasting and retail areas; e. The business operator shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; and f. Events may be allowed with an approved temporary use permit under K.C.C. chapter 21A.32. 32.a. The aggregated floor area of structures and areas for winery, brewery, distillery facility uses shall not exceed one thousand five hundred square feet; b. Structures and parking areas for winery, brewery, distillery facility uses shall maintain a minimum distance of seventy-five feet from interior property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62; c. One on-site parking stall shall be allowed for the winery, brewery, distillery facility I use; d. The business operator shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; e. At least two stages of production of wine, beer, cider or distilled spirits, such as crushing, fermenting, distilling, barrel or tank aging, or finishing, as authorized by the Washington state Liquor and Cannabis Board production license, shall occur on-site. At least one of the stages of production occurring on-site shall include crushing, fermenting or distilling; f. No product tasting or retail sales shall be allowed on-site; g. Events may be allowed in accordance with K.C.C. 21A.32.120.B.6; and h. The impervious surface associated with the winery, brewery, distillery facility use shall not exceed twenty-five percent of the site or the maximum impervious surface for the zone in accordance with K.C.C. 21A.12.030.A. or 21A.12.040.A., whichever is less. (Ord. 19824 § 8, 2024: Ord. 19030 § 18, 2019: Ord. 18626 § 6, 2017: Ord. 18326 § 14, 2016: Ord. 17841 § 29, 2014: Ord. 17725 § 2, 2013: Ord. 17710 § 8, 2013: Ord. 17539 § 31, 2013: Ord. 16950 § 19, 2010: Ord. 16028 § 1, 2008: Ord. 15974 § 10, 2007: Ord. 15032 § 15, 2004: Ord. 14781 § 2, 2003: Ord. 14045 § 15, 2001: Ord. 12596 § 8, 1997: Ord. 11621 § 38, 1994: Ord. 10870 § 335, 1993).21A.08.090 Resource land uses.A. Resource land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC#SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOI12Coal Mining13Oil and Gas ExtractionAGRICULTURE:01Growing and Harvesting CropsPPPPPP02Raising Livestock and Small Animals (6)PPPPP*Agricultural ActivitiesP24CP24CP24CP24C*Agricultural Support ServicesP25CP25CP26CP26CP26CP27 C28P27 C28*Marijuana producerP15C22P16 C17P18 C19P18 C19P20C21*Agriculture Training FacilityC10*Agriculture-related special needs campP12*Agricultural Anaerobic DigesterP13FORESTRY:08Growing & Harvesting Forest ProductionPPP7PPPP*Forest ResearchPPPP2PFISH AND WILDLIFE MANAGEMENT:0921Hatchery/Fish Preserve (1)PPPPCP0273Aquaculture (1)PPPPCP*Wildlife SheltersPPPPMINERAL:10, 14Mineral Extraction and ProcessingP9CP C112951,3271,3273Asphalt/Concrete Mixtures and BlockP8C11P8C11PACCESSORY USES:*Resource Accessory UsesP3P23P29P4P29P5P29P3P29P3P29P4P29*Farm Worker HousingP14P14B. Development conditions. 1. May be further subject to K.C.C. chapter 21A.25. 2. Only forest research conducted within an enclosed building. 3. Farm residences in accordance with K.C.C. 21A.08.030. 4. Excluding housing for agricultural workers. 5. Limited to either maintenance or storage facilities, or both, in conjunction with mineral extraction or processing operation. 6. Allowed in accordance with K.C.C. chapter 21A.30. 7. Only in conjunction with a mineral extraction site plan approved in accordance with K.C.C. chapter 21A.22. 8. Only on the same lot or same group of lots under common ownership or documented legal control, which includes, but is not limited to, fee simple ownership, a long-term lease or an easement: a. as accessory to a primary mineral extraction use; b. as a continuation of a mineral processing only for that period to complete delivery of products or projects under contract at the end of a mineral extraction; or c. for a public works project under a temporary grading permit issued in accordance with K.C.C. 16.82.152. 9. Limited to mineral extraction and processing: a. on a lot or group of lots under common ownership or documented legal control, which includes but is not limited to, fee simple ownership, a long-term lease or an easement; b. that are located greater than one-quarter mile from an established residence; and c. that do not use local access streets that abut lots developed for residential use. 10. Agriculture training facilities are allowed only as an accessory to existing agricultural uses and are subject to the following conditions: a. The impervious surface associated with the agriculture training facilities shall comprise not more than ten percent of the allowable impervious surface permitted under K.C.C. 21A.12.040; b. New or the expansion of existing structures, or other site improvements, shall not be located on class 1, 2 or 3 soils; c. The director may require reuse of surplus structures to the maximum extent practical; d. The director may require the clustering of new structures with existing structures; e. New structures or other site improvements shall be set back a minimum distance of seventy-five feet from property lines adjoining rural area and residential zones; f. Bulk and design of structures shall be compatible with the architectural style of the surrounding agricultural community; g. New sewers shall not be extended to the site; h. Traffic generated shall not impede the safe and efficient movement of agricultural vehicles, nor shall it require capacity improvements to rural roads; i. Agriculture training facilities may be used to provide educational services to the surrounding rural/agricultural community or for community events. Property owners may be required to obtain a temporary use permit for community events in accordance with K.C.C. chapter 21A.32; j. Use of lodging and food service facilities shall be limited only to activities conducted in conjunction with training and education programs or community events held on site; k. Incidental uses, such as office and storage, shall be limited to those that directly support education and training activities or farm operations; and l. The King County agriculture commission shall be notified of and have an opportunity to comment upon all proposed agriculture training facilities during the permit process in accordance with K.C.C. chapter 21A.40. 11. Continuation of mineral processing and asphalt/concrete mixtures and block uses after reclamation in accordance with an approved reclamation plan. 12.a. Activities at the camp shall be limited to agriculture and agriculture-oriented activities. In addition, activities that place minimal stress on the site's agricultural resources or activities that are compatible with agriculture are permitted. (1) passive recreation; (2) training of individuals who will work at the camp; (3) special events for families of the campers; and (4) agriculture education for youth. b. Outside the camp center, as provided for in subsection B.12.e. of this section, camp activities shall not preclude the use of the site for agriculture and agricultural related activities, such as the processing of local food to create value-added products and the refrigeration and storage of local agricultural products. The camp shall be managed to coexist with agriculture and agricultural activities both onsite and in the surrounding area. c. A farm plan shall be required for commercial agricultural production to ensure adherence to best management practices and soil conservation. d.(1) The minimum site area shall be five hundred acres. Unless the property owner has sold or transferred the development rights as provided in subsection B.12.c.(3) of this section, a minimum of five hundred acres of the site must be owned by a single individual, corporation, partnership, or other legal entity and must remain under the ownership of a single individual, corporation, partnership, or other legal entity for the duration of the operation of the camp. (2) Nothing in subsection B.12.d.(1) of this section prohibits the property owner from selling or transferring the development rights for a portion or all of the site to the King County farmland preservation program or, if the development rights are extinguished as part of the sale or transfer, to a nonprofit entity approved by the director; e. The impervious surface associated with the camp shall comprise not more than ten percent of the allowable impervious surface permitted under K.C.C. 21A.12.040; f. Structures for living quarters, dining facilities, medical facilities, and other nonagricultural camp activities shall be located in a camp center. The camp center shall be no more than fifty acres and shall depicted on a site plan. New structures for nonagricultural camp activities shall be clustered with existing structures; g. To the extent practicable, existing structures shall be reused. The applicant shall demonstrate to the director that a new structure for nonagricultural camp activities cannot be practicably accommodated within an existing structure on the site, though cabins for campers shall be permitted only if they do not already exist on site; h. Camp facilities may be used to provide agricultural educational services to the surrounding rural and agricultural community or for community events. If required by K.C.C. chapter 21A.32, the property owner shall obtain a temporary use permit for community events; i. Lodging and food service facilities shall only be used for activities related to the camp or for agricultural education programs or community events held on site; j. Incidental uses, such as office and storage, shall be limited to those that directly support camp activities, farm operations, or agricultural education programs; k. New nonagricultural camp structures and site improvements shall maintain a minimum set-back of seventy-five feet from property lines adjoining rural area and residential zones; l. Except for legal nonconforming structures existing as of January 1, 2007, camp facilities, such as a medical station, food service hall, and activity rooms, shall be of a scale to serve overnight camp users; m. Landscaping equivalent to a type III landscaping screen, as provided for in K.C.C. 21A.16.040, of at least twenty feet shall be provided for nonagricultural structures and site improvements located within two hundred feet of an adjacent rural area and residential zoned property not associated with the camp; n. New sewers shall not be extended to the site; o. The total number of persons staying overnight shall not exceed three hundred; p. The length of stay for any individual overnight camper, not including camp personnel, shall not exceed ninety days during a three-hundred-sixty-five-day period; q. Traffic generated by camp activities shall not impede the safe and efficient movement of agricultural vehicles nor shall it require capacity improvements to rural roads; r. If the site is adjacent to an arterial roadway, access to the site shall be directly onto the arterial unless the county road engineer determines that direct access is unsafe; s. If direct access to the site is via local access streets, transportation management measures shall be used to minimize adverse traffic impacts; t. Camp recreational activities shall not involve the use of motor vehicles unless the motor vehicles are part of an agricultural activity or are being used for the transportation of campers, camp personnel, or the families of campers. Camp personnel may use motor vehicles for the operation and maintenance of the facility. Client-specific motorized personal mobility devices are allowed; and u. Lights to illuminate the camp or its structures shall be arranged to reflect the light away from any adjacent property. 13. Limited to digester receiving plant and animal and other organic waste from agricultural activities, and including electrical generation, as follows: a. the digester must be included as part of a Washington state Department of Agriculture approved dairy nutrient plan; b. the digester must process at least seventy percent livestock manure or other agricultural organic material from farms in the vicinity, by volume; c. imported organic waste-derived material, such as food processing waste, may be processed in the digester for the purpose of increasing methane gas production for beneficial use, but not shall exceed thirty percent of volume processed by the digester; and d. the use must be accessory to an operating dairy or livestock operation. 14. Farm worker housing. Either: a. Temporary farm worker housing subject to the following conditions: (1) The housing must be licensed by the Washington state Department of Health under chapter 70.114A RCW and chapter 246-358 WAC; (2) Water supply and sewage disposal systems must be approved by the Seattle King County department of health; (3) To the maximum extent practical, the housing should be located on nonfarmable areas that are already disturbed and should not be located in the floodplain or in a critical area or critical area buffer; and (4) The property owner shall file with the department of executive services, records and licensing services division, a notice approved by the department identifying the housing as temporary farm worker housing and that the housing shall be occupied only by agricultural employees and their families while employed by the owner or operator or on a nearby farm. The notice shall run with the land; or b. Housing for agricultural employees who are employed by the owner or operator of the farm year-round as follows: (1) Not more than: (a) one agricultural employee dwelling unit on a site less than twenty acres; (b) two agricultural employee dwelling units on a site of at least twenty acres and less than fifty acres; (c) three agricultural employee dwelling units on a site of at least fifty acres and less than one-hundred acres; and (d) four agricultural employee dwelling units on a site of at least one-hundred acres, and one additional agricultural employee dwelling unit for each additional one hundred acres thereafter; (2) If the primary use of the site changes to a nonagricultural use, all agricultural employee dwelling units shall be removed; (3) The applicant shall file with the department of executive services, records and licensing services division, a notice approved by the department that identifies the agricultural employee dwelling units as accessory and that the dwelling units shall only be occupied by agricultural employees who are employed by the owner or operator year-round. The notice shall run with the land. The applicant shall submit to the department proof that the notice was filed with the department of executive services, records and licensing services division, before the department approves any permit for the construction of agricultural employee dwelling units; (4) An agricultural employee dwelling unit shall not exceed a floor area of one thousand square feet and may be occupied by no more than eight unrelated agricultural employees; (5) To the maximum extent practical, the housing should be located on nonfarmable areas that are already disturbed; (6) One off-street parking space shall be provided for each agricultural employee dwelling unit; and (7) The agricultural employee dwelling units shall be constructed in compliance with K.C.C. Title 16. 15. Marijuana production by marijuana producers licensed by the Washington state Liquor and Cannabis Board is subject to the following standards: a. Only allowed on lots of at least four and one-half acres; b. With a lighting plan, only if required by and that complies with K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; d. Production is limited to outdoor, indoor within marijuana greenhouses, and within structures that are nondwelling unit structures that exist as of October 1, 2013, subject to the size limitations in subsection B.15.e. of this section; e. Per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080 shall be limited to a maximum aggregated total of two thousand square feet and shall be located within a fenced area or marijuana greenhouse that is no more than ten percent larger than that combined area, or may occur in nondwelling unit structures that exist as of October 1, 2013; f. Outdoor production area fencing as required by the Washington state Liquor and Cannabis Board, marijuana greenhouses and nondwelling unit structures shall maintain a minimum street setback of fifty feet and a minimum interior setback of thirty feet; and g. If the two-thousand-square-foot-per-lot threshold of plant canopy combined with area used for processing under K.C.C. 21A.08.080 is exceeded, each and every marijuana-related entity occupying space in addition to the two-thousand-square-foot threshold area on that lot shall obtain a conditional use permit as set forth in subsection B.22. of this section. 16. Marijuana production by marijuana producers licensed by the Washington state Liquor and Cannabis Board is subject to the following standards: a. Marijuana producers in all RA zoned areas except for Vashon-Maury Island, that do not require a conditional use permit issued by King County, that receive a Washington state Liquor and Cannabis Board license business before October 1, 2016, and that King County did not object to within the Washington state Liquor and Cannabis Board marijuana license application process, shall be considered nonconforming as to subsection B.16.d. and h. of this section, subject to the provisions of K.C.C. 21A.32.020 through 21A.32.075 for nonconforming uses; b. In all rural area zones, only with a lighting plan that complies with K.C.C. 21A.12.220.H.; c. Only allowed on lots of at least four and one-half acres on Vashon-Maury Island; d. Only allowed in the RA-10 or the RA-20 zone, on lots of at least ten acres, except on Vashon-Maury Island; e. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; f. Production is limited to outdoor, indoor within marijuana greenhouses, and within nondwelling unit structures that exist as of October 1, 2013, subject to the size limitations in subsection B.16.g. of this section; and g. Per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080 shall be limited to a maximum aggregated total of two thousand square feet and shall be located within a fenced area or marijuana greenhouse, that is no more than ten percent larger than that combined area, or may occur in nondwelling unit structures that exist as of October 1, 2013; h. Outdoor production area fencing as required by the Washington state Liquor and Cannabis Board and marijuana greenhouses shall maintain a minimum street setback of fifty feet and a minimum interior setback of one hundred feet; and a minimum setback of one hundred fifty feet from any existing residence; and i. If the two-thousand-square-foot-per-lot threshold of plant canopy within fenced areas or marijuana greenhouses is exceeded, each and every marijuana-related entity occupying space in addition to the two-thousand-square-foot threshold area on that lot shall obtain a conditional use permit as set forth in subsection B.17. of this section. 17. Marijuana production by marijuana producers licensed by the Washington state Liquor and Cannabis Board is subject to the following standards: a. Only allowed on lots of at least four and one-half acres on Vashon-Maury Island; b. Only allowed in the RA-10 or the RA-20 zone, on lots of at least ten acres, except on Vashon-Maury Island; c. In all rural area zones, only with a lighting plan that complies with K.C.C. 21A.12.220.H.; d. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; e. Production is limited to outdoor and indoor within marijuana greenhouses subject to the size limitations in subsection B.17.f. of this section; f. Per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080 shall be limited to a maximum aggregated total of thirty thousand square feet and shall be located within a fenced area or marijuana greenhouse that is no more than ten percent larger than that combined area; and g. Outdoor production area fencing as required by the Washington state Liquor and Cannabis Board, and marijuana greenhouses shall maintain a minimum street setback of fifty feet and a minimum interior setback of one hundred feet, and a minimum setback of one hundred fifty feet from any existing residence. 18.a. Production is limited to indoor only; b. With a lighting plan only as required by and that complies with K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; and d. Per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080, shall be limited to a maximum aggregated total of two thousand square feet and shall be located within a building or tenant space that is no more than ten percent larger than the plant canopy and separately authorized processing area; and e. If the two-thousand-square-foot-per-lot threshold is exceeded, each and every marijuana-related entity occupying space in addition to the two-thousand-square foot threshold area on that parcel shall obtain a conditional use permit as set forth in subsection B.19. of this section. 19.a. Production is limited to indoor only; b. With a lighting plan only as required by and that complies with K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; and d. Per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080, shall be limited to a maximum aggregated total of thirty thousand square feet and shall be located within a building or tenant space that is no more than ten percent larger than the plant canopy and separately authorized processing area. 20.a. Production is limited to indoor only; b. With a lighting plan only as required by and that complies with K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; d. Per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080, shall be limited to a maximum aggregated total of two thousand square feet and shall be located within a building or tenant space that is no more than ten percent larger than the plant canopy and separately authorized processing area; and e. If the two-thousand-square-foot-per-lot threshold is exceeded, each and every marijuana-related entity occupying space in addition to the two-thousand-square-foot threshold area on that lot shall obtain a conditional use permit as set forth in subsection B.21. of this section. 21.a. Production is limited to indoor only; b. With a lighting plan only as required by and that complies with K.C.C. 21A.12.220.H.; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; and d. Per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080, shall be limited to a maximum aggregated total of thirty thousand square feet and shall be located within a building or tenant space that is no more than ten percent larger than the plant canopy and separately authorized processing area. 22. Marijuana production by marijuana producers licensed by the Washington state Liquor and Cannabis Board is subject to the following standards: a. With a lighting plan only as required by and that complies with K.C.C. 21A.12.220.H.; b. Only allowed on lots of at least four and one-half acres; c. Only with documentation that the operator has applied for a Puget Sound Clean Air Agency Notice of Construction Permit. All department permits issued to either marijuana producers or marijuana processors, or both, shall require that a Puget Sound Clean Air Agency Notice of Construction Permit be approved before marijuana products are imported onto the site; d. Production is limited to outdoor, indoor within marijuana greenhouses, and within structures that are nondwelling unit structures that exist as of October 1, 2013, subject to the size limitations in subsection B.22. e. and f. of this section; e. On lots less than ten acres, per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080 shall be limited to a maximum aggregated total of five thousand square feet and shall be located within a fenced area or marijuana greenhouse that is no more than ten percent larger than that combined area, or may occur in nondwelling unit structures that exist as of October 1, 2013; f. On lots ten acres or more, per lot, the plant canopy, as defined in WAC 314-55-010, combined with any area used for processing under K.C.C. 21A.08.080 shall be limited to a maximum aggregated total of ten thousand square feet, and shall be located within a fenced area or marijuana greenhouse that is no more than ten percent larger than that combined area, or may occur in nondwelling unit structures that exist as of October 1, 2013; and g. Outdoor production area fencing as required by the Washington state Liquor and Cannabis Board, marijuana greenhouses and nondwelling unit structures shall maintain a minimum street setback of fifty feet and a minimum interior setback of one hundred feet, and a minimum setback of one hundred fifty feet from any existing residence. 23. The storage and processing of non-manufactured source separated organic waste that originates from agricultural operations and that does not originate from the site, if: a. agricultural is the primary use of the site; b. the storage and processing are in accordance with best management practices included in an approved farm plan; and c. except for areas used for manure storage, the areas used for storage and processing do not exceed three acres and ten percent of the site. 24.a. For activities relating to the processing of crops or livestock for commercial purposes, including associated activities such as warehousing, storage, including refrigeration, and other similar activities and excluding winery, brewery, distillery facility I, II, III and remote tasting room: (1) limited to agricultural products and sixty percent or more of the products processed must be grown in the Puget Sound counties. At the time of initial application, the applicant shall submit a projection of the source of products to be produced; (2) in the RA and UR zones, only allowed on sites of at least four and one-half acres; (3)(a) as a permitted use, the floor area devoted to all processing shall not exceed two thousand square feet, unless located in a building designated as an historic resource under K.C.C. chapter 20.62. The agricultural technical review committee, as established in K.C.C. 21A.42.300, may review and approve an increase in the processing floor area as follows: up to three thousand five hundred square feet of floor area may be devoted to all processing in the RA zones or on farms less than thirty-five acres located in the A zones or up to seven thousand square feet on farms greater than thirty-five acres in the A zone; and (b) as a permitted use, the floor area devoted to all warehousing, refrigeration, storage, or other similar activities shall not exceed two thousand square feet, unless located in a building designated as historic resource under K.C.C. chapter 20.62. The agricultural technical review committee, as established in K.C.C. 21A.42.300, may review and approve an increase of up to three thousand five hundred square feet of floor area devoted to all warehouseing, storage, including refrigeration, or other similar activities in the RA zones, or on farms less than thirty-five acres located in the A zones or up to seven thousand square feet on farms greater than thirty-five acres in the A zone; (4) in the A zone, structures and areas used for processing, warehousing, refrigeration, storage, and other similar activities shall be located on portions of agricultural lands that are unsuitable for other agricultural purposes, such as areas within the already developed portion of such agricultural lands that are not available for direct agricultural production, or areas without prime agricultural soils; and (5) structures and areas used for processing, warehousing, storage, including refrigeration, and other similar activities shall maintain a minimum distance of seventy-five feet from property lines adjoining rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62. b. For activities relating to the retail sale of agricultural products, except livestock: (1) sales shall be limited to agricultural products and locally made arts and crafts; (2) in the RA and UR zones, only allowed on sites at least four and one-half acres; (3) as a permitted use, the covered sales area shall not exceed two thousand square feet, unless located in a building designated as a historic resource under K.C.C. chapter 20.62. The agricultural technical review committee, as established in K.C.C. 21A.42.300, may review and approve an increase of up to three thousand five hundred square feet of covered sales area; (4) forty percent or more of the gross sales of agricultural product sold through the store must be sold by the producers of primary agricultural products; (5) sixty percent or more of the gross sales of agricultural products sold through the store shall be derived from products grown or produced in the Puget Sound counties. At the time of the initial application, the applicant shall submit a reasonable projection of the source of product sales; (6) tasting of products, in accordance with applicable health regulations, is allowed; (7) storage areas for agricultural products may be included in a farm store structure or in any accessory building; and (8) outside lighting is permitted if there is no off-site glare. c. Retail sales of livestock is permitted only as accessory to raising livestock. d. Farm operations, including equipment repair and related facilities, except that: (1) the repair of tools and machinery is limited to those necessary for the operation of a farm or forest; (2) in the RA and UR zones, only allowed on sites of at least four and one-half acres; (3) the size of the total repair use is limited to one percent of the farm size in the A zone, and up to one percent of the size in other zones, up to a maximum of five thousand square feet unless located within an existing farm structure, including but not limited to barns, existing as of December 31, 2003; and (4) Equipment repair shall not be permitted in the Forest zone. e. The agricultural technical review committee, as established in K.C.C. 21A.42.300, may review and approve reductions of minimum site sizes in the rural and residential zones and minimum setbacks from rural and residential zones. 25. The department may review and approve establishment of agricultural support services in accordance with the code compliance review process in K.C.C. 21A.42.300 only if: a. project is sited on lands that are unsuitable for direct agricultural production based on size, soil conditions, or other factors and cannot be returned to productivity by drainage maintenance; and b. the proposed use is allowed under any Farmland Preservation Program conservation easement and zoning development standards. 26. The agricultural technical review committee, as established in K.C.C. 21A.42.300, may review and approve establishment of agricultural support services only if the project site: a. adjoins or is within six hundred sixty feet of the agricultural production district; b. has direct vehicular access to the agricultural production district; c. except for farmworker housing, does not use local access streets that abut lots developed for residential use; and b. has a minimum lot size of four and one-half acres. 27. The agricultural technical review committee, as established in K.C.C. 21A.42.300, may review and approve establishment of agricultural support services only if the project site: a. is outside the urban growth area, b. adjoins or is within six hundred sixty feet of the agricultural production district, c. has direct vehicular access to the agricultural production district, d. except for farmworker housing, does not use local access streets that abut lots developed for residential use; and e. has a minimum lot size of four and one-half acres. 28. Only allowed on properties that are outside the urban growth area. 29. Battery energy storage systems are considered a resource accessory use when the total system capacity is two megawatts or less, and: (1) the system provides electricity for on-site use only, with "on-site use" including net metering as well as charging of vehicles on-site or in the right-of-way immediately adjacent to the site; or (2) the system is intended primarily for on-site use, but also participates in load sharing or another grid-connected electricity-sharing arrangement. (Ord. 19824 § 9, 2024: Ord. 19146 § 46, 2020: Ord. 19030 § 19, 2019: Ord. 18626 § 7, 2017: Ord. 18326 § 16, 2016: Ord. 17841 § 30, 2014: Ord. 17725 § 3, 2013: Ord. 17710 § 9, 2013: Ord. 17539 § 32, 2013: Ord. 16267 § 23, 2008: Ord. 15909 § 2, 2007: Ord. 15032 § 16, 2004: Ord. 14045 § 16, 2001: Ord. 12691 § 3, 1997: Ord. 12596 § 9, 1997: Ord. 11938 § 1, 1995: Ord. 11621 § 39, 1994: Ord. 11157 § 14, 1993: Ord. 10870 § 336, 1993).21A.08.100 Regional land uses.A. Regional land uses.P-Permitted UseC-Conditional UseS-Special UseRESOURCERURALRESIDENTIALCOMMERCIAL/INDUSTRIALSIC#SPECIFIC LAND USEAFMRAURR1-8R12-48NBCBRBOI (15)*JailSSSSSSS*Jail Farm/CampSSSS*Work Release FacilityS19S19SSSSSS*Public Agency Animal Control FacilitySSSSP*Public Agency Training FacilitySS3S3S3S3C4*Hydroelectric Generation FacilityC14 SC14 SC14 SC14 S*Nonhydroelectric Generation FacilityC12 S29C12 S29C12 S29C12 S29C12 S29C12 S29C12 S29C12 S29C12 S29C12 S29C12 S29P12 S29*Renewable Energy Generation FacilityC28C28CCCCCCCCCC*Fossil Fuel FacilityS27*Battery Energy Storage System (30)SPPPCCPPPPP*Communication Facility (17)C6c SPC6c SC6c SC6c SC6c SC6c SPPPP*Earth Station P6b CPC6a SC6a SC6a SC6a SP6b CPPPP*Energy Resource Recovery FacilitySSSSSSSSSSS*Soil Recycling FacilitySSSC*LandfillSSSSSSSSSSS*Transfer StationSSSSSSSSP*Wastewater Treatment FacilitySSSSSSSSC*Municipal Water ProductionSP13 SSSSSSSSSSS*Airport/HeliportS7S7SSSSSSSSS*Search and Rescue FacilityC31S31*Regional Transit Authority Facility P25*Rural Public Infrastructure Maintenance FacilityC23P*Transit Bus BaseSSSSSSP*Transit Comfort FacilityP26P26P26P26P26P26P26P26*School Bus BaseC5 S20C5 SC5 SC5 SSSSSP7948RacetrackS8S8S8S8S8S8S8S8S24*Regional Motor Sports FacilityP*County Fairgrounds FacilityP21 S22*FairgroundSSS8422Zoo/Wildlife Exhibit(2)S9S9SSSSS7941Stadium/ArenaSS8221-8222College/University(1)P10P10P10 C11 S18P10 C11 S18P10 C11 SP10C11 SP10 C11 SPPPP*Zoo Animal Breeding FacilityP16P16P16B. Development conditions. 1. Except technical institutions. See vocational schools on general services land use table, K.C.C. 21A.08.050. 2. Except arboretum. See K.C.C. 21A.08.040, recreation/cultural land use table. 3. Except weapons armories and outdoor shooting ranges. 4. Except outdoor shooting range. 5. Only in conjunction with an existing or proposed school. 6.a. Limited to no more than three satellite dish antennae. b. Limited to one satellite dish antenna. c. Limited to tower consolidations. 7. Limited to landing field for aircraft involved in forestry or agricultural practices or for emergency landing sites. 8. Except racing of motorized vehicles. 9. Limited to wildlife exhibit. 10. Only as a reuse of a public school facility subject to K.C.C. chapter 21A.32. 11. Only as a reuse of a surplus nonresidential facility subject to K.C.C. chapter 21A.32. 12. Limited to gas extraction as an accessory use to a waste management process, such as wastewater treatment, landfill waste management, livestock manure and composting processes. 13. Excluding impoundment of water using a dam. 14. Limited to facilities that comply with the following: a. Any new diversion structure shall not: (1) exceed a height of eight feet as measured from the streambed; or (2) impound more than three surface acres of water at the normal maximum surface level; b. There shall be no active storage; c. The maximum water surface area at any existing dam or diversion shall not be increased; d. An exceedance flow of no greater than fifty percent in mainstream reach shall be maintained; e. Any transmission line shall be limited to a: (1) right-of-way of five miles or less; and (2) capacity of two hundred thirty KV or less; f. Any new, permanent access road shall be limited to five miles or less; and g. The facility shall only be located above any portion of the stream used by anadromous fish. 15. For I-zoned sites located outside the urban growth area designated by the King County Comprehensive Plan, uses shown as a conditional or special use in K.C.C. 21A.08.100.A, except for waste water treatment facilities and racetracks, shall be prohibited. All other uses, including waste water treatment facilities, shall be subject to the provisions for rural industrial uses in K.C.C. chapter 21A.12. 16. The operator of such a facility shall provide verification to the department of natural resources and parks or its successor organization that the facility meets or exceeds the standards of the Animal and Plant Health Inspection Service of the United States Department of Agriculture and the accreditation guidelines of the American Zoo and Aquarium Association. 17. The following provisions of the table apply only to major communication facilities. Minor communication facilities shall be reviewed in accordance with the processes and standard outlined in K.C.C. chapter 21A.27. 18. Only for facilities related to resource-based research. 19. Limited to work release facilities associated with natural resource-based activities. 20. Limited to projects which do not require or result in an expansion of sewer service outside the urban growth area, unless a finding is made that no cost-effective alternative technologies are feasible, in which case a tightline sewer sized only to meet the needs of the school bus base and serving only the school bus base may be used. Renovation, expansion, modernization, or reconstruction of a school bus base is permitted but shall not require or result in an expansion of sewer service outside the urban growth area, unless a finding is made that no cost-effective alternative technologies are feasible, in which case a tightline sewer sized only to meet the needs of the school bus base. 21. Only in conformance with the King County Site Development Plan Report, through modifications to the plan of up to ten percent are allowed for the following: a. building square footage; b. landscaping; c. parking; d. building height; or e. impervious surface. 22. A special use permit shall be required for any modification or expansion of the King County fairgrounds facility that is not in conformance with the King County Site Development Plan Report or that exceeds the allowed modifications to the plan identified in subsection B.21. of this section. 23. The facility shall be primarily devoted to rural public infrastructure maintenance and is subject to the following conditions: a. The minimum site area shall be ten acres, unless: (1) the facility is a reuse of a public agency yard; or (2) the site is separated from a county park by a street or utility right-of-way; b. Type 1 landscaping as provided in K.C.C. chapter 21A.16 shall be provided between any stockpiling or grinding operations and adjacent residential zoned property; c. Type 2 landscaping as provided in K.C.C. chapter 21A.16 shall be provided between any office and parking lots and adjacent residential zoned property; d. Access to the site does not use local access streets that abut residential zoned property, unless the facility is a reuse of a public agency yard; e. Structural setbacks from property lines shall be as follows: (1) Buildings, structures, and stockpiles used in the processing of materials shall be no closer than: (a) one hundred feet from any residential zoned properties, except that the setback may be reduced to fifty feet when the grade where the building or structures are proposed is fifty feet or greater below the grade of the residential zoned property; (b) fifty feet from any other zoned property, except when adjacent to a mineral extraction or materials processing site; (c) the greater of fifty feet from the edge of any public street or the setback from residential zoned property on the far side of the street; and (2) Offices, scale facilities, equipment storage buildings, and stockpiles shall not be closer than fifty feet from any property line except when adjacent to M or F zoned property or when a reuse of an existing building. Facilities necessary to control access to the site, when demonstrated to have no practical alternative, may be located closer to the property line; f. On-site clearing, grading or excavation, excluding that necessary for required access, roadway, or storm drainage facility construction, shall not be permitted within fifty feet of any property line except along any portion of the perimeter adjacent to M or F zoned property. If native vegetation is restored, temporary disturbance resulting from construction of noise attenuation features located closer than fifty feet shall be permitted; and g. Sand and gravel extraction shall be limited to forty thousand yards per year. 24. The following accessory uses to a motor race track operation are allowed if approved as part of the special use permit: a. motocross; b. autocross; c. skidpad; d. garage; e. driving school; and f. fire station. 25. Regional transit authority facilities shall be exempt from setback and height requirements. 26. Transit comfort facility shall: a. only be located outside of the urban growth area boundary; b. be exempt from street setback requirements; and c. be no more than 200 square feet in size. 27.a. Required for all new, modified, or expanded fossil fuel facilities. Modification or expansion includes, but is not limited to: (1) new uses or fuel types within existing facilities; (2) changes to the type of refining, manufacturing, or processing; (3) changes in the methods or volumes of storage or transport of raw materials or processed products; (4) changes in the location of the facilities on-site; (5) replacement of existing facilities; (6) increases in power or water demands; or (7) increases in production capacity. b. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. c. As part of permit application submittal for new, modified, or expanded fossil fuel facilities, the applicant shall submit the following documentation: (1) an inventory of similar existing facilities in King County and neighboring counties, including their locations and capacities; (2) a forecast of the future needs for the facility; (3) an analysis of the potential social and economic impacts and benefits to jurisdictions and local communities receiving or surrounding the facility; (4) an analysis of alternatives to the facility, including location, conservation, demand management and other strategies; (5) an analysis of economic and environmental impacts, including mitigation, of any similar existing facilities and of any new site(s) under consideration as an alternative to expansion of an existing facility; (6) an extensive public involvement strategy that strives to effectively engage a wide range of racial, ethnic, cultural, and socioeconomic groups, including communities that are the most impacted; (7) considered evaluation of any applicable prior review conducted by a public agency, local government, or stakeholder group; and (8) a greenhouse gas impact analysisprepared by the applicant , the results of which shall be used to identify and mitigate the impacts of such facilities. d. As part of permit application submittal, the applicant shall demonstrate financial responsibility meeting the requirements of K.C.C. chapter 21A.49 The financial responsibility shall be reviewed as part of the facility's periodic review under K.C.C. 21A.22.050. e. New, modified or expanded fossil fuel facilities shall: (1) not be located within one thousand feet from any schools, medical care facilities, or places of assembly that have occupancies of greater than one thousand persons; (2) not be located within two hundred fifty feet from a regulated wetland or aquatic area, except when a larger buffer is required under K.C.C. chapter 21A.24, the buffer in K.C.C. chapter 21A.24 shall apply; (3) maintain an interior setback of at least two hundred feet; (4) store fossil fuels completely within enclosed structures, tanks, or similar facilities; (5) be accessed directly to and from an arterial roadway; and (6) comply with all applicable regulations in K.C.C. chapter 21A.22. 28. Limited to uses that will not convert more than two acres of farmland or forestland, or two and one-half percent of the farmland or forestland, whichever is less. 29.a. Before filing an application with the department, the applicant shall hold a community meeting in accordance with K.C.C. 20.20.035. b. As part of permit application submittal for nonhydroelectric generation facilities, the applicant shall submit the following documentation: (1) an inventory of similar existing facilities in King County and neighboring counties, including their locations and capacities; (2) a report demonstrating that the facility would serve a significant portion of the county or metropolitan region or is part of a statewide or national system; (3) a forecast of the future needs for the facility; (4) an analysis of the potential social and economic impacts and benefits to jurisdictions and local communities receiving or surrounding the facility; (5) an analysis of alternatives to the facility, including location, conservation, demand management, and other strategies; (6) an analysis of economic and environmental impacts, including mitigation, of any similar existing facilities and of any new site or sites under consideration as an alternative to expansion of an existing facility; (7) an extensive public involvement strategy which strives to effectively engage a wide range of racial, ethnic, cultural and socioeconomic groups, including communities that are the most impacted; (8) considered evaluation of any applicable prior review conducted by a public agency, local government, or stakeholder group; and (9) a greenhouse gas impact analysis prepared by the applicant, the results of which shall be used to identify and mitigate the impacts of such facilities. c. As part of permit application submittal, an applicant shall demonstrate financial responsibility meeting the requirements of K.C.C. chapter 21A.49. d. Non-hydroelectric generation facilities shall be subject to a periodic review meeting the same standards given in K.C.C. 21A.22.050. The financial responsibility required by subsection B.29.c. of this section shall be reviewed as part of the periodic review. 30. Battery energy storage systems, except those defined as an accessory use under K.C.C. 21A.06.015, 21A.06.020, or 21A.06.025, are subject to the applicable permit requirements of subsection A. of this section and the following conditions: a. A minimum separation of ten feet shall be maintained between rooms or enclosures containing battery energy storage systems and landscaping or other vegetation; b. As part of building permit application submittal, battery energy storage systems shall demonstrate financial responsibility for public liability and environmental risks in accordance with K.C.C. chapter 21A.49 if the total system capacity is more than two megawatts and all three of the following apply: (1) the battery technology requires thermal runaway compliance under WAC 51-54A-1207.6; (2) any individual room, cabinet, container, or other enclosure containing the system has an energy rating greater than two megawatt-hours, or any two enclosures are less than ten feet apart; and (3) the system does not qualify as a remote installation under IFC 1207.8.1.; c. As part of building permit application submittal, battery energy storage systems with a total system capacity more than two megawatts shall demonstrate financial responsibility for decommissioning in accordance with K.C.C. chapter 21A.49; d. If financial responsibility is required by subsection B.30.b. or c. of this section, the applicant shall submit verification of financial responsibility to the department every five years, beginning five years from the date of permit issuance; e. The findings and recommendations of studies, analyses, and testing required by K.C.C. Title 17, WAC 51-54A-1207, and the International Fire Code, should be incorporated into the permit conditions for the facility; and f. As part of application submittal, the applicant shall submit verification that preliminary fire safety and evacuation plans have been shared with the local fire protection district. The final plans shall be shared with the local fire protection district before final inspection approval. 31.a. For all search and rescue facilities: (1) the minimum lot size is four and one half acres; (2) structures and parking areas for search and rescue facilities shall maintain a minimum distance of seventy-five feet from interior lot lines that adjoin rural area and residential zones, unless located in a building designated as historic resource under K.C.C. chapter 20.62; (3) use of the search and rescue facility is limited to activities directly relating to the search and rescue organization, except that the facility may be used by law enforcement and other public emergency responders for training and operations related to search and rescue activities; and (4) the applicant must demonstrate the absence of existing search and rescue facilities that are adequate to conduct search and rescue operations in the rural area. b. A special use permit is required when helicopter fueling, maintenance, or storage is proposed. (Ord. 19824 § 10, 2024: Ord. 19601 § 1, 2023: Ord. 19331 § 4, 2021: Ord. 19146 § 47, 2020: Ord. 18861 § 2, 2019: Ord. 18671 § 3, 2018: Ord. 18626 § 8, 2017: Ord. 18335 § 2, 2016: Ord. 17287 § 10, 2012: Ord. 17191 § 35, 2011: Ord. 16267 § 24, 2008: Ord. 15938 § 2, 2007: Ord. 14808 § 3, 2003: Ord. 14199 § 233, 2001: Ord. 14045 § 17, 2001: Ord. 13129 § 13, 1998: Ord. 13022 § 15, 1998: Ord. 12709 § 2, 1997: Ord. 12596 § 10, 1997: Ord. 11621 § 40, 1994: Ord. 10870 § 337, 1993).21A.08.110 Shoreline jurisdiction - permitted uses - exceptions. The permitted land uses allowed in this chapter are allowed within the shoreline jurisdiction except as amended by K.C.C. 21A.25.100. (Ord. 16985 § 109, 2010).21A.08.900 Applicability - Ordinance 13694. Complete applications for segregation submitted prior to January 1, 2000, shall continue to be governed by those ordinances in effect on the date the complete application was submitted. (Ord. 13694 § 93, 1999).21A.12DEVELOPMENT STANDARDS - DENSITY AND DIMENSIONSSections:21A.12.010Purpose.21A.12.020Interpretation of tables.21A.12.030Densities and dimensions - residential and rural zones (expires January 2, 2025).21A.12.030Densities and dimensions - residential and rural zones (in effect January 2, 2025, and thereafter).21A.12.040Densities and dimensions - resource and commercial/industrial zones.21A.12.042Historic buildings – exceptions for number of dwelling units allowed.21A.12.050Measurement methods.21A.12.060Minimum urban residential density.21A.12.070Calculations - allowable dwelling units lots or floor area.21A.12.080Calculations - site area used for base density and maximum density floor area calculations.21A.12.085Calculations - site area used for minimum density calculations.21A.12.087Minimum density adjustments for moderate slopes.21A.12.090Lot area - prohibited reduction.21A.12.100Lot area - minimum lot area for construction.21A.12.110Measurement of setbacks.21A.12.120Setbacks - specific building or use.21A.12.122Setbacks - livestock buildings and manure storage areas.21A.12.130Setbacks - modifications.21A.12.140Setbacks - from regional utility corridors.21A.12.150Setbacks - from alley.21A.12.160Setbacks - required modifications.21A.12.170Setbacks - projections and structures allowed.21A.12.180Height - exceptions to limits.21A.12.190Height - limits near major airports.21A.12.200Lot or site divided by zone boundary.21A.12.210Sight distance requirements.21A.12.220Nonresidential land uses in RA, UR, or R zones.21A.12.230Personal services and retail uses in R-4 through R-48 zones.21A.12.240Joint use driveway and easement width.21A.12.250General personal service use, office/outpatient use allowed restrictions.21A.12.260Shoreline jurisdiction - density and dimensions apply - exceptions.21A.12.010 Purpose. The purpose of this chapter is to establish basic dimensional standards for development relative to residential density and as well as specific rules for general application. The standards and rules are established to provide flexibility in project design, and maintain privacy between adjacent uses. (Ord. 10870 § 338, 1993).21A.12.020 Interpretation of tables.A. K.C.C. 21A.12.030 and 21A.12.040 contain general density and dimension standards for the various zones and limitations specific to a particular zone(s). Additional rules, exceptions, and methodologies are set forth in K.C.C. 21A.12.050 through 21A.12.210.B. The density and dimension tables are arranged in a matrix format on two separate tables and are delineated into two general land use categories: 1. Residential; and 2. Resource and Commercial/Industrial.C. Development standards are listed down the left side of both tables, and the zones are listed at the top. The matrix cells contain the minimum dimensional requirements of the zone. The parenthetical numbers in the matrix identify specific requirements applicable either to a specific use or zone. A blank box indicates that there are no specific requirements. If more than one standard appears in a cell, each standard will be subject to any applicable parenthetical footnote following the standard. (Ord. 10870 § 339, 1993).21A.12.030 Densities and dimensions - residential and rural zones (expires January 2, 2025*).A. Densities and dimensions - residential and rural zones.RURALRESIDENTIALSTANDARDSRA-2.5RA-5RA-10RA-20URR-1 (17)R-4R-6R-8R-12R-18R-24R-48Base Density:DwellingUnit/Acre (15) (28)0.2du/ac0.2du/ac0.1du/ac0.05du/ac0.2du/ac(21)1du/ac4du/ac(6)6du/ac8du/ac12du/ac18du/ac24du/ac48du/acMaximum Density:Dwelling Unit/Acre(1)0.4du/ac(20)6du/ac(22)8du/ac(27)9du/ac12du/ac(27)12du/ac16du/ac(27)18du/ac24du/ac(27)27du/ac36du/ac(27)36du/ac48du/ac(27)72du/ac96du/ac(27)Minimum Density:(2)85%(12)(18)(23)85%(12)(18)85%(12)(18)80%(18)75%(18)70%(18)65%(18)Minimum Lot Area (13)1.875 ac3.75 ac7.5 ac15 ac10,000 sf (30)Minimum LotWidth(3)135 ft135 ft135 ft135 ft35 ft (7)35 ft(7)30 ft30 ft30 ft30 ft30ft30 ft30 ftMinimum Street Setback (3)30 ft(9)30 ft(9)30ft(9)30 ft(9)30 ft(7)20 ft(7)(29)10 ft(8)20 ft(30)10 ft(8)10 ft(8)10 ft(8)(30)10 ft(8)(30)10ft(8)(30)10 ft(8)(30)Minimum InteriorSetback (3) (16)5 ft(9)10ft(9)10 ft(9)10 ft(9)5 ft(7)5 ft(7)(29)5 ft10 ft (30)5 ft5 ft5 ft(10)(30)5 ft(10)(30)5 ft(10)(30)5 ft(10)(30)Base Height40 ft40 ft40 ft40 ft35 ft35 ft (29)35 ft25 ft (25a)35 ft25 ft (25a)35 ft25 ft (25a)60 ft60 ft60 ft60 ftMaximum Height75 ft(4)75 ft(4)75 ft(4)75 ft(4)75 ft(4)75 ft(4)30 ft(25b)75 ft(4)45 ft(14)30 ft(25b)75 ft(4)45 ft(14)30 ft(25b)75 ft(4)75 ft(4)75 ft(4)80 ft(14)75 ft(4)80 ft(14)75 ft(4)80 ft(14)Maximum ImperviousSurface:Percentage (5)25%(11)(19)(26)20%(11)(19)(26)15%(11)(19)(24)(26)12.5%(11)(19)(26)30%(11)(26)30%(11)(26)55%(26)70%(26)75%(26)85%(26)(30)85%(26)(30)85%(26)(30)90%(26)(30)B. Development conditions. 1. This maximum density may be achieved only through the application of: a. residential density incentives in accordance with K.C.C. chapter 21A.34 or transfers of development rights in accordance with K.C.C. chapter 21A.37, or any combination of density incentive or density transfer; or b. for properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in the inclusionary housing regulations in K.C.C. chapter 21A.48. 2. Also see K.C.C. 21A.12.060. 3. These standards may be modified under the provisions for zero-lot-line and townhouse developments. 4.a. Portions of a structure may exceed the base height if one additional foot of street and interior setback is provided for each foot above the base height limit. The following restrictions apply: (1) for netting or fencing and support structures for the netting or fencing used to contain golf balls in the operation of golf courses or golf driving ranges, the maximum height shall not exceed seventy-five feet, except for recreation or multiuse parks, where the maximum height shall not exceed one hundred twenty-five feet, unless a golf ball trajectory study requires a higher fence. All such netting, fencing, and support structures are exempt from the additional interior setback requirement, regardless of whether located in a recreation or multiuse park; (2) properties within the Skyway-West Hill or North Highline community service area subarea geographies shall not increase height through this method; and (3) for all other structures, the maximum height achieved through this method shall not exceed seventy-five feet. b. Accessory dwelling units and accessory living quarters shall not exceed base heights, except that this requirement shall not apply to accessory dwelling units constructed wholly within an existing dwelling unit. 5. Applies to each individual lot. Impervious surface area standards for: a. Regional uses shall be established at the time of permit review; b. Nonresidential uses in rural area and residential zones shall comply with K.C.C. 21A.12.120 and 21A.12.220; c. Individual lots in the R-4 through R-6 zones that are less than nine thousand seventy-six square feet in area shall be subject to the applicable provisions of the nearest comparable R-6 or R-8 zone; and d. A lot may be increased beyond the total amount permitted in this chapter subject to approval of a conditional use permit. 6. Mobile home parks shall be allowed a base density of six dwelling units per acre. 7. The standards of the R-4 zone apply if a lot is less than fifteen thousand square feet in area. 8. At least twenty linear feet of driveway shall be provided between any garage, carport or other fenced parking area and the street property line. The linear distance shall be measured along the center line of the driveway from the access point to such garage, carport, or fenced area to the street property line. 9.a. Residences shall have a setback of at least one hundred feet from any property line adjoining A, M, or F zones or existing extractive operations. However, residences on lots less than one hundred fifty feet in width adjoining A, M, or F zones or existing extractive operations shall have a setback from the rear property line equal to fifty percent of the lot width and a setback from the side property equal to twenty-five percent of the lot width. b. Except for residences along a property line adjoining A, M, or F zones or existing extractive operations, lots between one acre and two and one-half acres in size shall conform to the requirements of the R-1 zone and lots under one acre shall conform to the requirements of the R-4 zone. 10.a. For developments consisting of three or more single-detached dwellings located on a single parcel, the setback shall be ten feet along any property line abutting R-1 through R-8, RA, and UR zones, except for structures in on-site play areas required in K.C.C. 21A.14.190, which shall have a setback of five feet. b. For townhouse and apartment development, the setback shall be twenty feet along any property line abutting R-1 through R-8, RA, and UR zones, except for structures in on-site play areas required in K.C.C. 21A.14.190, which shall have a setback of five feet, unless the townhouse or apartment development is adjacent to property upon which an existing townhouse or apartment development is located. 11. Lots smaller than one-half acre in area shall comply with standards of the nearest comparable R-4 through R-8 zone. For lots that are one-half acre in area or larger, the maximum impervious surface area allowed shall be at least ten thousand square feet. On any lot over one acre in area, an additional five percent of the lot area may be used for buildings related to agricultural or forestry practices. For lots smaller than two acres but larger than one-half acre, an additional ten percent of the lot area may be used for structures that are determined to be medically necessary, if the applicant submits with the permit application a notarized affidavit, conforming with K.C.C. 21A.32.170A.2. 12. For purposes of calculating minimum density, the applicant may request that the minimum density factor be modified based upon the weighted average slope of the net buildable area of the site in accordance with K.C.C. 21A.12.087. 13. The minimum lot area does not apply to lot clustering proposals as provided in K.C.C. chapter 21A.14, except in the Rural Town of Fall City between December 1, 2023, and January 2, 2025. 14. This maximum height is only allowed as follows: a. in R-6 and R-8 zones, for a building with a footprint built on slopes exceeding a fifteen percent finished grade; and b. in R-18, R-24 and R-48 zones: (1) for properties within the Skyway-West Hill or North Highline community service area subarea geographies, only if meeting the requirements of K.C.C. chapter 21A.48; or (2) for all other properties, using residential density incentives and transfer of density credits in accordance with this title. 15. Density applies only to dwelling units and not to sleeping units. 16. Vehicle access points from garages, carports or fenced parking areas shall be set back from the property line on which a joint use driveway is located to provide a straight line length of at least twenty-six feet as measured from the center line of the garage, carport or fenced parking area, from the access point to the opposite side of the joint use driveway. 17.a. All subdivisions and short subdivisions in the R-1 zone shall be required to be clustered if the property is located within or contains: (1) a floodplain; (2) a critical aquifer recharge area; (3) a regionally or locally significant resource area; (4) existing or planned public parks or trails, or connections to such facilities; (5) a category type S or F aquatic area or category I or II wetland; (6) a steep slope; or (7) an urban separator or wildlife habitat network designated by the Comprehensive Plan or a community plan. b. The development shall be clustered away from critical areas or the axis of designated corridors such as urban separators or the wildlife habitat network to the extent possible and the open space shall be placed in a separate tract that includes at least fifty percent of the site. Open space tracts shall be permanent and shall be dedicated to a homeowner's association or other suitable organization, as determined by the director, and meet the requirements in K.C.C. 21A.14.040. On-site critical area and buffers and designated urban separators shall be placed within the open space tract to the extent possible. Passive recreation, with no development of recreational facilities, and natural-surface pedestrian and equestrian trails are acceptable uses within the open space tract. 18. See K.C.C. 21A.12.085. 19. All subdivisions and short subdivisions in R-1 and RA zones within the North Fork and Upper Issaquah Creek subbasins of the Issaquah Creek Basin (the North Fork and Upper Issaquah Creek subbasins are identified in the Issaquah Creek Basin and Nonpoint Action Plan) and the portion of the Grand Ridge subarea of the East Sammamish Community Planning Area that drains to Patterson Creek shall have a maximum impervious surface area of eight percent of the gross acreage of the plat. Distribution of the allowable impervious area among the platted lots shall be recorded on the face of the plat. Impervious surface of roads need not be counted towards the allowable impervious area. Where both lot- and plat-specific impervious limits apply, the more restrictive shall be required. 20. This density may only be achieved on RA 2.5 zoned parcels receiving density from rural forest focus areas through a transfer of density credit pursuant to K.C.C. chapter 21A.37. 21. Base density may be exceeded, if the property is located in a designated rural city urban growth area and each proposed lot contains an occupied legal residence that predates 1959. 22.a. The maximum density is four dwelling units per acre for properties zoned R-4 when located in the Rural Town of Fall City. b. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in the inclusionary housing regulations in K.C.C. chapter 21A.48. 23. The subdivision or short subdivision of property within the Rural Town of Fall City is not required to meet with the minimum density requirements of this chapter. 24. The impervious surface standards for the county fairground facility are established in the King County Fairgrounds Site Development Plan, Attachment A to Ordinance 14808** on file at the department of natural resources and parks and the department of local services, permitting division. Modifications to that standard may be allowed provided the square footage does not exceed the approved impervious surface square footage established in the King County Fairgrounds Site Development Plan Environmental Checklist, dated September 21, 1999, Attachment B to Ordinance 14808**, by more than ten percent. 25. For cottage housing developments only: a. The base height is twenty-five feet. b. Buildings that have pitched roofs with a minimum slope of six over twelve may achieve a maximum height of thirty feet at the ridge of the roof. 26. Impervious surface does not include access easements serving neighboring property and driveways to the extent that they extend beyond the street setback due to location within an access panhandle or due to the application of King County Code requirements to locate features over which the applicant does not have control. 27. a. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only in accordance with the inclusionary housing regulations in K.C.C. chapter 21A. 48. b. For all other properties, only in accordance with K.C.C. 21A.34.040.F.1.g., F.6. or K.C.C. 21A.37.130.A.2. 28. On a site zoned RA with a building listed on the national register of historic places, additional dwelling units in excess of the maximum density may be allowed under K.C.C. 21A.12.042.29. Height and setback requirements shall not apply to regional transit authority facilities. 30. 30. Applies only in the Rural Town of Fall City between December 1, 2023, and January 2, 2025. (Ord. 19690 § 2, 2023 (expires January 2, 2025): Ord. 19687 § 3, 2023: Ord. 19555 § 11, 2022: Ord. 19146 § 48, 2020: Ord. 18791 § 168, 2018: Ord. 18671 § 4, 2018: Ord. 17841 § 31, 2014: Ord. 17539 § 33, 2013: Ord. 17420 § 99, 2012: Ord. 16267 § 25, 2008: Ord. 15245 § 6, 2005: Ord. 15051 § 126, 2004: Ord. 15032 § 17, 2004: Ord. 14808 § 4, 2003: Ord. 14807 § 7, 2003: Ord. 14429 § 2, 2002: Ord. 14190 § 33, 2001: Ord. 14045 § 18, 2001: Ord. 13881 § 1, 2000: Ord. 13571 § 1, 1999: Ord. 13527 § 1, 1999: Ord. 13274 § 10, 1998: Ord. 13086 § 1, 1998: Ord. 13022 § 16, 1998: Ord. 12822 § 6, 1997: Ord. 12549 § 1, 1996: Ord. 12523 § 3, 1996: Ord. 12320 § 2, 1996: Ord. 11978 § 4, 1995: Ord. 11886 § 5, 1995: Ord. 11821 § 2, 1995: Ord. 11802 § 3, 1995: Ord. 11798 § 1, 1995: Ord. 11621 § 41, 1994: Ord. 11555 § 5, 1994: Ord. 11157 § 15, 1993: Ord. 10870 § 340, 1993).Reviser's notes:*"This ordinance expires thirteen months after the effective date of this ordinance." (Ord. 19690 § 5.)**Available in the King County Archives.21A.12.030 Densities and dimensions - residential and rural zones (in effect January 2, 2025, and thereafter*).A. Densities and dimensions - residential and rural zones.RURALRESIDENTIALSTANDARDSRA-2.5RA-5RA-10RA-20URR-1 (17)R-4R-6R-8R-12R-18R-24R-48Base Density:DwellingUnit/Acre (15) (28)0.2du/ac0.2du/ac0.1du/ac0.05du/ac0.2du/ac(21)1du/ac4du/ac(6)6du/ac8du/ac12du/ac18du/ac24du/ac48du/acMaximum Density:Dwelling Unit/Acre(1)0.4du/ac(20)6du/ac(22)8du/ac(27)9du/ac12du/ac(27)12du/ac16du/ac(27)18du/ac24du/ac(27)27du/ac36du/ac(27)36du/ac48du/ac(27)72du/ac96du/ac(27)Minimum Density:(2)85%(12)(18)(23)85%(12)(18)85%(12)(18)80%(18)75%(18)70%(18)65%(18)Minimum Lot Area (13)1.875 ac3.75 ac7.5 ac15 acMinimum LotWidth(3)135 ft135 ft135 ft135 ft35 ft (7)35 ft(7)30 ft30 ft30 ft30 ft30ft30 ft30 ftMinimum Street Setback (3)30 ft(9)30 ft(9)30ft(9)30 ft(9)30 ft(7)20 ft(7)(29)10 ft(8)10 ft(8)10 ft(8)10 ft(8)(30)10 ft(8)(30)10ft(8)(30)10 ft(8)(30)Minimum InteriorSetback (3) (16)5 ft(9)10ft(9)10 ft(9)10 ft(9)5 ft(7)5 ft(7)(29)5 ft5 ft5 ft5 ft(10)(30)5 ft(10)(30)5 ft(10)(30)5 ft(10)(30)Base Height40 ft40 ft40 ft40 ft35 ft35 ft (29)35 ft25 ft (25a)35 ft25 ft (25a)35 ft25 ft (25a)60 ft60 ft60 ft60 ftMaximum Height75 ft(4)75 ft(4)75 ft(4)75 ft(4)75 ft(4)75 ft(4)30 ft(25b)75 ft(4)45 ft(14)30 ft(25b)75 ft(4)45 ft(14)30 ft(25b)75 ft(4)75 ft(4)75 ft(4)80 ft(14)75 ft(4)80 ft(14)75 ft(4)80 ft(14)Maximum ImperviousSurface:Percentage (5)25%(11)(19)(26)20%(11)(19)(26)15%(11)(19)(24)(26)12.5%(11)(19)(26)30%(11)(26)30%(11)(26)55%(26)70%(26)75%(26)85%(26)(30)85%(26)(30)85%(26)(30)90%(26)(30)B. Development conditions. 1. This maximum density may be achieved only through the application of: a. residential density incentives in accordance with K.C.C. chapter 21A.34 or transfers of development rights in accordance with K.C.C. chapter 21A.37, or any combination of density incentive or density transfer; or b. for properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in the inclusionary housing regulations in K.C.C. chapter 21A.48. 2. Also see K.C.C. 21A.12.060. 3. These standards may be modified under the provisions for zero-lot-line and townhouse developments. 4.a. Portions of a structure may exceed the base height if one additional foot of street and interior setback is provided for each foot above the base height limit. The following restrictions apply: (1) for netting or fencing and support structures for the netting or fencing used to contain golf balls in the operation of golf courses or golf driving ranges, the maximum height shall not exceed seventy-five feet, except for recreation or multiuse parks, where the maximum height shall not exceed one hundred twenty-five feet, unless a golf ball trajectory study requires a higher fence. All such netting, fencing, and support structures are exempt from the additional interior setback requirement, regardless of whether located in a recreation or multiuse park; (2) properties within the Skyway-West Hill or North Highline community service area subarea geographies shall not increase height through this method; and (3) for all other structures, the maximum height achieved through this method shall not exceed seventy-five feet. b. Accessory dwelling units and accessory living quarters shall not exceed base heights, except that this requirement shall not apply to accessory dwelling units constructed wholly within an existing dwelling unit. 5. Applies to each individual lot. Impervious surface area standards for: a. Regional uses shall be established at the time of permit review; b. Nonresidential uses in rural area and residential zones shall comply with K.C.C. 21A.12.120 and 21A.12.220; c. Individual lots in the R-4 through R-6 zones that are less than nine thousand seventy-six square feet in area shall be subject to the applicable provisions of the nearest comparable R-6 or R-8 zone; and d. A lot may be increased beyond the total amount permitted in this chapter subject to approval of a conditional use permit. 6. Mobile home parks shall be allowed a base density of six dwelling units per acre. 7. The standards of the R-4 zone apply if a lot is less than fifteen thousand square feet in area. 8. At least twenty linear feet of driveway shall be provided between any garage, carport or other fenced parking area and the street property line. The linear distance shall be measured along the center line of the driveway from the access point to such garage, carport, or fenced area to the street property line. 9.a. Residences shall have a setback of at least one hundred feet from any property line adjoining A, M, or F zones or existing extractive operations. However, residences on lots less than one hundred fifty feet in width adjoining A, M, or F zones or existing extractive operations shall have a setback from the rear property line equal to fifty percent of the lot width and a setback from the side property equal to twenty-five percent of the lot width. b. Except for residences along a property line adjoining A, M, or F zones or existing extractive operations, lots between one acre and two and one-half acres in size shall conform to the requirements of the R-1 zone and lots under one acre shall conform to the requirements of the R-4 zone. 10.a. For developments consisting of three or more single-detached dwellings located on a single parcel, the setback shall be ten feet along any property line abutting R-1 through R-8, RA, and UR zones, except for structures in on-site play areas required in K.C.C. 21A.14.190, which shall have a setback of five feet. b. For townhouse and apartment development, the setback shall be twenty feet along any property line abutting R-1 through R-8, RA, and UR zones, except for structures in on-site play areas required in K.C.C. 21A.14.190, which shall have a setback of five feet, unless the townhouse or apartment development is adjacent to property upon which an existing townhouse or apartment development is located. 11. Lots smaller than one-half acre in area shall comply with standards of the nearest comparable R-4 through R-8 zone. For lots that are one-half acre in area or larger, the maximum impervious surface area allowed shall be at least ten thousand square feet. On any lot over one acre in area, an additional five percent of the lot area may be used for buildings related to agricultural or forestry practices. For lots smaller than two acres but larger than one-half acre, an additional ten percent of the lot area may be used for structures that are determined to be medically necessary, if the applicant submits with the permit application a notarized affidavit, conforming with K.C.C. 21A.32.170A.2. 12. For purposes of calculating minimum density, the applicant may request that the minimum density factor be modified based upon the weighted average slope of the net buildable area of the site in accordance with K.C.C. 21A.12.087. 13. The minimum lot area does not apply to lot clustering proposals as provided in K.C.C. chapter 21A.14. 14. This maximum height is only allowed as follows: a. in R-6 and R-8 zones, for a building with a footprint built on slopes exceeding a fifteen percent finished grade; and b. in R-18, R-24 and R-48 zones: (1) for properties within the Skyway-West Hill or North Highline community service area subarea geographies, only if meeting the requirements of K.C.C. chapter 21A.48; or (2) for all other properties, using residential density incentives and transfer of density credits in accordance with this title. 15. Density applies only to dwelling units and not to sleeping units. 16. Vehicle access points from garages, carports or fenced parking areas shall be set back from the property line on which a joint use driveway is located to provide a straight line length of at least twenty-six feet as measured from the center line of the garage, carport or fenced parking area, from the access point to the opposite side of the joint use driveway. 17.a. All subdivisions and short subdivisions in the R-1 zone shall be required to be clustered if the property is located within or contains: (1) a floodplain; (2) a critical aquifer recharge area; (3) a regionally or locally significant resource area; (4) existing or planned public parks or trails, or connections to such facilities; (5) a category type S or F aquatic area or category I or II wetland; (6) a steep slope; or (7) an urban separator or wildlife habitat network designated by the Comprehensive Plan or a community plan. b. The development shall be clustered away from critical areas or the axis of designated corridors such as urban separators or the wildlife habitat network to the extent possible and the open space shall be placed in a separate tract that includes at least fifty percent of the site. Open space tracts shall be permanent and shall be dedicated to a homeowner's association or other suitable organization, as determined by the director, and meet the requirements in K.C.C. 21A.14.040. On-site critical area and buffers and designated urban separators shall be placed within the open space tract to the extent possible. Passive recreation, with no development of recreational facilities, and natural-surface pedestrian and equestrian trails are acceptable uses within the open space tract. 18. See K.C.C. 21A.12.085. 19. All subdivisions and short subdivisions in R-1 and RA zones within the North Fork and Upper Issaquah Creek subbasins of the Issaquah Creek Basin (the North Fork and Upper Issaquah Creek subbasins are identified in the Issaquah Creek Basin and Nonpoint Action Plan) and the portion of the Grand Ridge subarea of the East Sammamish Community Planning Area that drains to Patterson Creek shall have a maximum impervious surface area of eight percent of the gross acreage of the plat. Distribution of the allowable impervious area among the platted lots shall be recorded on the face of the plat. Impervious surface of roads need not be counted towards the allowable impervious area. Where both lot- and plat-specific impervious limits apply, the more restrictive shall be required. 20. This density may only be achieved on RA 2.5 zoned parcels receiving density from rural forest focus areas through a transfer of density credit pursuant to K.C.C. chapter 21A.37. 21. Base density may be exceeded, if the property is located in a designated rural city urban growth area and each proposed lot contains an occupied legal residence that predates 1959. 22.a. The maximum density is four dwelling units per acre for properties zoned R-4 when located in the Rural Town of Fall City. b. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in the inclusionary housing regulations in K.C.C. chapter 21A.48. 23. The minimum density requirement does not apply to properties located within the Rural Town of Fall City. 24. The impervious surface standards for the county fairground facility are established in the King County Fairgrounds Site Development Plan, Attachment A to Ordinance 14808* on file at the department of natural resources and parks and the department of local services, permitting division. Modifications to that standard may be allowed provided the square footage does not exceed the approved impervious surface square footage established in the King County Fairgrounds Site Development Plan Environmental Checklist, dated September 21, 1999, Attachment B to Ordinance 14808*, by more than ten percent. 25. For cottage housing developments only: a. The base height is twenty-five feet. b. Buildings that have pitched roofs with a minimum slope of six over twelve may achieve a maximum height of thirty feet at the ridge of the roof. 26. Impervious surface does not include access easements serving neighboring property and driveways to the extent that they extend beyond the street setback due to location within an access panhandle or due to the application of King County Code requirements to locate features over which the applicant does not have control. 27. a. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only in accordance with the inclusionary housing regulations in K.C.C. chapter 21A. 48. b. For all other properties, only in accordance with K.C.C. 21A.34.040.F.1.g., F.6. or K.C.C. 21A.37.130.A.2. 28. On a site zoned RA with a building listed on the national register of historic places, additional dwelling units in excess of the maximum density may be allowed under K.C.C. 21A.12.042.29. Height and setback requirements shall not apply to regional transit authority facilities. 30. Properties within the North Highline community service area subarea geography shall meet the setback and GreenCenter requirements in K.C.C. chapter 21A.60. (Ord. 19690 § 2, 2023 (expired January 2, 2025): Ord. 19687 § 3, 2023: Ord. 19555 § 11, 2022: Ord. 19146 § 48, 2020: Ord. 18791 § 168, 2018: Ord. 18671 § 4, 2018: Ord. 17841 § 31, 2014: Ord. 17539 § 33, 2013: Ord. 17420 § 99, 2012: Ord. 16267 § 25, 2008: Ord. 15245 § 6, 2005: Ord. 15051 § 126, 2004: Ord. 15032 § 17, 2004: Ord. 14808 § 4, 2003: Ord. 14807 § 7, 2003: Ord. 14429 § 2, 2002: Ord. 14190 § 33, 2001: Ord. 14045 § 18, 2001: Ord. 13881 § 1, 2000: Ord. 13571 § 1, 1999: Ord. 13527 § 1, 1999: Ord. 13274 § 10, 1998: Ord. 13086 § 1, 1998: Ord. 13022 § 16, 1998: Ord. 12822 § 6, 1997: Ord. 12549 § 1, 1996: Ord. 12523 § 3, 1996: Ord. 12320 § 2, 1996: Ord. 11978 § 4, 1995: Ord. 11886 § 5, 1995: Ord. 11821 § 2, 1995: Ord. 11802 § 3, 1995: Ord. 11798 § 1, 1995: Ord. 11621 § 41, 1994: Ord. 11555 § 5, 1994: Ord. 11157 § 15, 1993: Ord. 10870 § 340, 1993).*Available in the King County Archives.21A.12.040 Densities and dimensions - resource and commercial/industrial zones.A. Densities and dimensions - resource and commercial/industrial zones.RESOURCECOMMERCIAL/INDUSTRIALSTANDARDSA-10A-35FMNBCBRBOIBase Density:DwellingUnit/Acre (19)0.1du/ac.0286du/ac.0125du/ac8 du/ac(2)48 du/ac(2)36 du/ac (2)48 du/ac (1)48 du/ac(2)MaximumDensity:DwellingUnit/Acre12 du/ac(3)16 du/ac (15)72 du/ac(16)96 du/ac (17)48 du/ac(3)72 du/ac (16) 96 du/ac (17)72 du/ac(16) 96 du/ac (17)Minimum LotArea10 acres35 acres80 acres10 acresMaximum LotDepth/WidthRatio4 to 14 to 1Minimum StreetSetback30 ft (4)30 ft (4)50 ft (4)(12)10 ft (5)(21)10 ft (5)(21)10 ft (5)(21)10 ft(21)25 ftMinimum InteriorSetback10 ft (4)10 ft (4)100 ft (4)(12)10 ft (18)20 ft (14)(21)20 ft (7)(21)20 ft (7)(21)20 ft (7)(21)20 ft (7)50 ft (8)Base Height35 ft35 ft35 ft35 ft35 ft35 ft35 ft45 ft45 ftMaximum Height75 ft(10)75 ft(10)75 ft(10)75 ft(10)45 ft (6)65 ft (20)75 ft(10)60 ft (6)65 ft (17)75 ft(10)80 ft (20)65 ft (6)75 ft(10)85 ft (20)65 ft (6)75 ft(10)85 ft (20)75 ft(10)MaximumFloor/LotRatio:Square Feet1/1 (9)1.5/1 (9)2.5/1 (9)2.5/1 (9)2.5/1MaximumImperviousSurface:Percentage(13)15%35%(11)10%35%(11)10%35%(11)85%(21)85%(21)90%(21)75%(21)90%B. Development conditions. 1. In the RB zone on property located within the Potential Annexation Area of a rural city, this density is not allowed. 2. These densities are allowed only through the application of mixed-use development standards and, in the NB zone on property in the urban area designated commercial outside of center, for stand-alone townhouse development. 3. These densities may only be achieved: a. for properties within the Skyway-West Hill or North Highline community service area subarea geographies, as provided in the inclusionary housing regulations in K.C.C. chapter 21A. 48; or b. for all other properties, through the application of residential density incentives or transfer of development rights in mixed-use developments and, in the NB zone on property in the urban area designated commercial outside of center, for stand-alone townhouse development. See K.C.C. chapters 21A.34 and 21A.37. 4.a. in the F zone, scaling stations may be located thirty-five feet from property lines. Residences shall have a setback of at least thirty feet from all property lines. b. for lots between one acre and two and one-half acres in size, the setback requirements of the R-1 zone shall apply. For lots under one acre, the setback requirements of the R-4 zone shall apply. c. for developments consisting of three or more single-detached dwellings located on a single parcel, the setback shall be ten feet along any property line abutting R-1 through R-8, RA, and UR zones. 5. Gas station pump islands shall be placed no closer than twenty-five feet to street front lines. 6. This maximum height allowed only for mixed-use developments and for stand-alone townhouse development in the NB zone on property designated commercial outside of center in the urban area. 7. Required on property lines adjoining rural area and residential zones. 8. Required on property lines adjoining rural area and residential zones for industrial uses established by conditional use permits. 9. The floor-to-lot ratio for mixed use developments shall conform to K.C.C. chapter 21A.14 or if meeting the requirements of K.C.C. chapter 21A.48. 10. Portions of a structure may exceed the base height if one additional foot of street and interior setback is provided for each foot above the base height. The following restrictions apply: a. for netting or fencing and support structures for the netting or fencing used to contain golf balls in the operation of golf courses or golf driving ranges, the maximum height shall not exceed seventy-five feet. All such netting, fencing, and support structures are exempt from the additional interior setback requirement; b. properties within the Skyway-West Hill or North Highline community service area subarea planning geographies shall not increase height through this method[;] c. mixed use developments outside the Skyway-West Hill or North Highline community service subarea geographies are not subject to a height restriction when using this method; and d. for all other structures, the maximum height achieved through this method shall not exceed seventy-five feet. 11. Applicable only to lots containing less than one acre of lot area. Development on lots containing less than fifteen thousand square feet of lot area shall be governed by impervious surface standards of the nearest comparable R-4 through R-8 zone. 12. See K.C.C. 21A.22.060 for setback requirements in the mineral zone. 13. The impervious surface area for any lot may be increased beyond the total amount permitted in this chapter subject to approval of a conditional use permit. 14. Required on property lines adjoining rural area and residential zones unless a stand-alone townhouse development on property designated commercial outside of center in the urban area is proposed to be located adjacent to property upon which an existing townhouse development is located. 15.a. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in the inclusionary housing regulations in K.C.C. chapter 21A.48. b. For all other properties, only as provided for walkable communities under K.C.C. 21A.34.040.F.8. well-served by transit or for mixed-use development through the application of rural area and residential density incentives under K.C.C. 21A.34.040.F.1.g. 16.a. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in the inclusionary housing regulations in K.C.C. chapter 21A.48. b. For all other properties, only for mixed-use development through the application of residential density incentives under K.C.C. chapter 21A.34 or the transfer of development rights under K.C.C. chapter 21A.37. In the RB zone on property located within the Potential Annexation Area of a rural city, this density is not allowed. 17.a. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in the inclusionary housing regulations in K.C.C. chapter 21A.48. b. For all other properties, only for mixed-use development through the application of residential density incentives under K.C.C. chapter 21A.34 or the transfer of development rights under K.C.C. chapter 21A.37. Upper-level setbacks are required for any facade facing a pedestrian street for any portion of the structure greater than forty-five feet in height. The upper-level setback shall be at least one foot for every two feet of height above forty-five feet, up to a maximum required setback of fifteen feet. The first four feet of horizontal projection of decks, balconies with open railings, eaves, cornices and gutters shall be permitted in required setbacks. In the RB zone on property located within the Potential Annexation Area of a rural city, this density is not allowed. 18. Required on property lines adjoining rural area and residential zones only for a social service agency office reusing a residential structure in existence on January 1, 2010. 19. On a site zoned A with a building designated as a county landmark in accordance with the procedures in K.C.C. 20.62.070, additional dwelling units in excess of the maximum density may be allowed under K.C.C. 21A.12.042. 20. This maximum height allowed only for properties within the Skyway-West Hill or North Highline community service area subarea geographies, if meeting the requirements of K.C.C. chapter 21A.48. 21. Properties within the North Highline community service area subarea geography shall meet the setback and GreenCenter requirements in K.C.C. chapter 21A.60. (Ord. 19687 § 4, 2023: Ord. 19555 § 12, 2022: Ord. 17539 § 34, 2013: Ord. 16950 § 20, 2010: Ord. 16267 § 26, 2008: Ord. 14190 § 34, 2001: Ord. 14045 § 19, 2001: Ord. 13086 § 2, 1998: Ord. 13022 § 17, 1998: Ord. 12929 § 2, 1997: Ord. 12522 § 4, 1996: Ord. 11821 § 3, 1995: Ord. 11802 § 4, 1995: Ord. 11621 § 42, 1994: Ord. 10870 § 341, 1993).21A.12.042 Historic buildings – exceptions for number of dwelling units allowed. On a site zoned A or RA with a building designated as a county landmark in accordance with the procedures in K.C.C. 20.62.070, the number of dwelling units allowed may exceed what would otherwise be allowed under K.C.C. 21A.12.030 as follows:A. All dwelling units shall be located within the historic building; andB. No more than five dwelling units shall be allowed, subject to approval by the historic preservation officer and, where required, review and approval by the landmarks commission in accordance with the procedures in K.C.C. 20.62.080. (Ord. 17539 § 35, 2013).21A.12.050 Measurement methods. The following provisions shall be used to determine compliance with this title:A. Street setbacks shall be measured from the existing edge of a street right-of-way or temporary turnaround, except as provided by K.C.C. 21A.12.150;B. Lot widths shall be measured by scaling a circle of the applicable diameter within the boundaries of the lot, provided that an access easement shall not be included within the circle;C. Building height shall be measured from the average finished grade to the highest point of the roof. The average finished grade shall be determined by first delineating the smallest square or rectangle which can enclose the building and then averaging the elevations taken at the midpoint of each side of the square or rectangle, provided that the measured elevations do not include berms;D. Lot area shall be the total horizontal land area contained within the boundaries of a lot; andE. Impervious surface calculations shall not include areas of turf, landscaping, natural vegetation or flow control or water quality treatment facilities. (Ord. 15051 § 127, 2004: Ord. 13190 § 16, 1998: Ord. 10870 § 342, 1993).21A.12.060 Minimum urban residential density. Minimum density for residential development in the urban areas designated by the Comprehensive Plan shall be based on the tables in K.C.C. 21A.12.030, adjusted as provided in 21A.12.070 through 21A.12.080.A. A proposal may be phased, if compliance with the minimum density requirement results in noncompliance with of K.C.C. chapter 21A.28, if the overall density of the proposal is consistent with this section.B. Minimum density requirements may be waived by King County if the applicant demonstrates one or more of the following: 1. The proposed layout of the lots in a subdivision or the buildings in a multiple dwelling development will not preclude future residential development consistent with the minimum density of the zone; 2. The non-sensitive area of the parcel is of a size or configuration that results in lots that cannot meet the minimum dimensional requirements of the zone; 3. In the R-12 through R-48 zones, the area of the parcel required to accommodate storm water facilities exceeds ten percent of the area of the site; 4. The site contains a national, state or county historic landmark.C. A proposal to locate a single residential unit on a lot shall be exempt from the minimum density requirement provided the applicant either preplans the site by demonstrating that the proposed single residence would be located in a manner compatible with future division of the site in a manner that would meet the minimum density requirements, or locates the dwelling within fifteen feet of one or more of the site's interior lot lines. D. Alternative minimum density requirements may be imposed through county-approved property-specific development standards (P-suffix), a special district overlays in accordance with K.C.C. chapter 21A.38 or a subarea plan. (Ord. 14045 § 20, 2001: Ord. 11555 § 6, 1994: 10870 § 343, 1993).21A.12.070 Calculations - allowable dwelling units, lots or floor area. Permitted number of units, or lots or floor area shall be determined as follows:A. The allowed number of dwelling units or lots (base density) shall be computed by multiplying the site area specified in K.C.C. 21A.12.080 by the applicable residential base density number;B. The maximum density (unit or lot) limits shall be computed by adding the bonus or transfer units authorized by K.C.C. chapters 21A.34, 21A.37 and 21A.48 to the base units computed under subsection A. of this section;C. The allowed floor area, which excludes structured or underground parking areas and areas housing mechanical equipment, shall be computed by applying the floor-to-lot area ratio to the project site area specified in K.C.C. 21A.12.080;D. If calculations result in a fraction, the fraction shall be rounded to the nearest whole number as follows, except as provided in subsection E. of this section and K.C.C. 21A.48.050: 1. Fractions of 0.50 or above shall be rounded up; and 2. Fractions below 0.50 shall be rounded down; and E. For subdivisions and short subdivisions in the RA and A zones, rounding up of the number of development units or lots is not allowed. (Ord. 19555 § 13, 2022: Ord. 14190 § 35, 2001: Ord. 14045 § 21, 2001: Ord. 11927 § 1, 1995: Ord. 10870 § 344, 1993).d21A.12.080 Calculations - site area used for base density and maximum density floor area calculations.A. All site areas may be used in the calculation of base and maximum allowed residential density or project floor area.B. For subdivisions and short subdivisions in the RA zone, if calculations of site area for base density result in a fraction, the fraction shall be rounded to the nearest whole number as follows: 1. Fractions of 0.50 or above shall be rounded up; and 2. Fractions below 0.50 shall be rounded down. (Ord. 15051 § 128, 2004: Ord. 14045 § 22, 2001: Ord. 11621 § 43, 1994: Ord. 11555 § 3, 1994: Ord. 10870 § 345, 1993).21A.12.085 Calculations - site area used for minimum density calculations. Minimum density shall be determined by:A. Multiplying the Base Density (Dwelling Units/Acre) as set forth in K.C.C. 21A.12.030.A by the net buildable area of the project site; and thenB. Multiplying the resulting product by the Minimum Density percentage set forth in K.C.C. 21A.12.030.A or as adjusted pursuant to the provisions of K.C.C. 21A.12.087. (Ord. 12549 § 2, 1996: Ord. 11798 § 2, 1995: Ord. 11555 § 4, 1994).21A.12.087 Minimum density adjustments for moderate slopes.A. For purposes of calculating minimum density of sloped sites in zones R-4, R-6 and R-8, the following adjustment is permitted:Weighted Average Slope of Net Buildable Area(s) of Site:Minimum Density Factor:0% - less than 5%85%5% - less than 15%83%, less 1.5% for each 1% of average slope in excess of 5%15% - less than 40%66%, less 2.0% for each 1% of average slope in excess of 15%B. Weighted average slope shall be calculated as follows: 1. The applicant shall submit a topographic survey of the net buildable area(s) of the site which identifies distinct areas within the following slope increments: 0-5%, 5-10%, 10-15%, etc. up to 35-40%. 2. Each slope increment will have a corresponding median slope value. This value is the midpoint of each slope increment. For instance, slope increments of 0-5% and 5-10% shall have median values of 2.5% and 7.5%, respectively. 3. The weighted average slope shall be determined by multiplying the number of square feet in each area by the median slope value in that area. For example, if the net buildable area portion of a site is 30,000 sq. ft. of which there are 10,000 square feet of 5-10% slope and 20,000 square feet of 10-15% slope, the weighted average slope would be 10.8%. See the following calculation [(10,000 sq. ft. times 7.5% plus 20,000 sq. ft. times 12.5%) divided by 30,000 sq. ft. = 10.8%]. (Ord. 12549 § 3, 1996).21A.12.090 Lot area - prohibited reduction. Any portion of a lot that was used to calculate compliance with the standards and regulations of this title shall not be subsequently subdivided or segregated from such lot. (Ord. 10870 § 346, 1993).21A.12.100 Lot area - minimum lot area for construction. Except as provided for nonconformances in K.C.C. 21A.32:A. In the UR and R zones no construction shall be permitted on a lot that contains an area of less than 2,500 square feet or that does not comply with the applicable minimum lot width, except for townhouse developments, zero-lot-line subdivisions, or lots created prior to February 2, 1995 in a recorded subdivision or short subdivision which complied with applicable subdivision or short subdivision laws;B. In the A, F or RA zones: 1. Construction shall not be permitted on a lot containing less than 5,000 square feet; and 2. Construction shall be limited to one dwelling unit and residential accessory uses for lots containing greater than 5,000 square feet, but less than 12,500 square feet. (Ord. 12268 § 1, 1996: Ord. 10870 § 347, 1993).21A.12.110 Measurement of setbacks.A. Interior setback: the interior setback is measured from the interior lot line to a line parallel to and measured perpendicularly from the interior lot lines at the depth prescribed for each zone.B. Street setback: the street setback is measured from the street right-of-way or the edge of a surface improvement which extends beyond a right-of-way, whichever is closer to the proposed structure, to a line parallel to and measured perpendicularly from the street right-of-way or the edge of the surface improvement at the depth prescribed for each zone. (Ord. 10870 § 348, 1993).21A.12.120 Setbacks - specific building or use. When a building or use is required to maintain a specific setback from a property line or other building, such setback shall apply only to the specified building or use. (Ord. 10870 § 349, 1993).21A.12.122 Setbacks - livestock buildings and manure storage areas.A. The minimum interior setback for any building used to house, confine or feed swine shall be 90 feet.B. The minimum interior setback for any building used to house, confine or feed any other livestock shall be 25 feet.C. The minimum interior setback for any manure storage area shall be 35 feet. (Ord. 12786 § 3, 1977).21A.12.130 Setbacks - modifications. When a lot is located between lots having nonconforming street setbacks, the required street setback for such lot may be the average of the two nonconforming setbacks or sixty percent of the required street setback, whichever results in the greater street setback. (Ord. 16950 § 21, 2010: Ord. 10870 § 350, 1993).21A.12.140 Setbacks - from regional utility corridors.A. Except as otherwise provided in subsection B. of this section, in subdivisions and short subdivisions, areas used as regional utility corridors shall be contained in separate tracts.B. For a subdivision or short subdivision: 1. Upon mutual agreement of the utility and applicant for the subdivision or short subdivision submitted at the time of application for the preliminary plat, the area of the regional utility corridor placed in a separate tract may be less than the entire utility right-of-way or easement. The agreement may be evidenced by correspondence between the utility and the applicant; 2. If the utility and applicant enter into an agreement under subsection B.1. of this section: a. The location of the easement or right-of-way shall be shown on the face of the plat; b. The applicant shall record on the title of all lots that extend into the right-of-way or easement a notice approved by the department that there is an easement or right-of-way for a regional utility corridor that may subject use of that area of the property to conditions established by the utility; and c. The department shall include as conditions of plat approval the conditions on use of the area within the regional utility corridor included in the agreement between the utility and the applicant.C. In land development permits other than subdivisions or short subdivisions, easements shall be used to delineate regional utility corridors.D. All structures shall maintain a minimum distance of five feet from property or easement lines delineating the boundary of regional utility corridors, except for utility structures necessary to the operation of the utility corridor or when structures are allowed by mutual agreement in the regional utility corridor.E. Any structure designed for human occupancy, except for utility structures not normally occupied that are necessary for the operation of the pipeline or a minor communication facility, and any required parking or recreation space shall maintain a minimum distance of one hundred feet from a hazardous liquid or gas transmission pipeline located within a regional utility corridor. The setback distance may be modified if the applicant demonstrates the following: 1. A one-hundred-foot setback would deny all reasonable use of the property; or 2. That the structure, parking or recreation space would be protected from radiant heat of an explosion by berming or other physical barriers; or 3. That a one-hundred-foot setback would be impractical or unnecessary due to existing geographical features, streets, lot lines, or easements; or 4. That no other practical alternative exists to meet the demand for service; and 5. That the applicant will construct a hazardous liquid or gas transmission containment system or other mitigating actions if the county finds that leakage could accumulate within one hundred feet of the pipeline. Any containment system or other mitigating actions required by this section shall meet all applicable federal, state and local regulations. (Ord. 17191 § 36, 2011: Ord. 15245 § 7, 2005: Ord. 14045 § 23, 2001: Ord. 13190 § 17, 1998: Ord. 10870 § 351, 1993).21A.12.150 Setbacks - from alley.A. Structures may be built to a property line abutting an alley, except as provided in subsection B.B. Vehicle access points from garages, carports or fenced parking areas shall be set back from the alley property line to provide a straight line length of at least 26 feet, as measured from the centerline of the garage, carport or fenced parking area, from the access point to the opposite edge of the alley. No portion of the garage or the door in motion may cross the property line. (Ord. 11978 § 5, 1995: Ord. 10870 § 352, 1993).21A.12.160 Setbacks - required modifications. The following setback modifications are required:A. In addition to providing the standard street setback, a lot adjoining a half-street or designated arterial shall provide an additional width of street setback sufficient to accommodate construction of the planned half-street or arterial; andB. Where the standard setback for a property is modified within an adopted subarea or neighborhood plan area zoning, the applicable setback shall be that specified therein. (Ord. 12822 § 7, 1997: Ord. 10870 § 353, 1993).21A.12.170 Setbacks - projections and structures allowed. If the required setbacks from regional utility corridors of K.C.C. 21A.12.140, the adjoining half-street or designated arterial setbacks of K.C.C. 21A.12.160, and the sight distance requirements of K.C.C. 21A.12.210 are maintained, structures may extend into or be located in required setbacks, including setbacks as required by K.C.C. 21A.12.220.C, as follows:A. Fireplace structures, bay or garden windows, enclosed stair landings, closets, or similar structures may project into any setback, provided such projections are: 1. Limited to two per facade; 2. Not wider than ten feet; and 3. Not more than twenty-four inches into an interior setback or thirty inches into a street setback;B. Uncovered porches and decks that exceed eighteen inches above the finished grade may project: 1. Eighteen inches into interior setbacks; and 2. Five feet into the street setback;C. Uncovered porches and decks not exceeding eighteen inches above the finished grade may project to the property line;D. Eaves may not project more than: 1. Eighteen inches into an interior setback; 2. Twenty-four inches into a street setback; or 3. Eighteen inches across a lot line in a zero-lot-line development; E. Fences with a height of six feet or less may project into or be located in any setback;F. Rockeries, retaining walls, and curbs may project into or be located in any setback. Except for structures that cross the setback perpendicularly to property lines or that abut a critical area, these structures: 1. Shall not exceed a height of six feet in the R-1 through R-18, UR, RA, and resource zones; 2. Shall not exceed a height of eight feet in the R-24 and R-48 zones; and 3. Shall not exceed the building height for the zone in commercial/industrial zones, measured in accordance with the standards established in the King County Building Code, Title 16;G. Fences located on top of rockeries, retaining walls or berms are subject to the requirements of K.C.C. 21A.14.220;H. Telephone, power, light, and flag poles;I. The following may project into or be located within a setback, but may only project into or be located within a five foot interior setback area if an agreement documenting consent between the owners of record of the abutting properties is recorded with the records and licensing services division prior to the installment or construction of the structure: 1. Sprinkler systems, electrical and cellular equipment cabinets, and other similar utility boxes and vaults, not to include equipment associated with a battery energy storage system; 2. security system access controls; 3. structures, except for buildings, associated with trails and on-site recreation spaces and play areas required in K.C.C.21A.14.180 and K.C.C. 21A.14.190 such as benches, picnic tables, and drinking fountains; and 4. Surface water management facilities as required by K.C.C. 9.04;J. Freestanding air conditioners and heat pumps may project into or be located within a setback abutting a residential property, but may only be located closer than five feet of an abutting residential property if an agreement documenting consent between the owners of record of the abutting properties is recorded with the records and licensing services division prior to permit issuance.K. Mailboxes and newspaper boxes may project into or be located within street setbacks;L. Fire hydrants and associated appendages; M. Metro bus shelters may be located within street setbacks;N. Unless otherwise allowed in K.C.C. 21A.20.080, free standing and monument signs four feet or less in height, with a maximum sign area of twenty square feet may project into or be located within street setbacks;O. On a parcel in the RA zone, in the interior setback that adjoins a property zoned NB or CB, structures housing refrigeration equipment that extends no more than ten feet into the setback and is no more than sixty feet in length;P. Stormwater conveyance and control facilities, both above and below ground, provided such projections are: 1. Consistent with setback, easement and access requirements specified in the Surface Water Design Manual; or 2. In the absence of said specifications, not within five feet of the property line; andQ. Equipment associated with a battery energy storage system defined as an accessory use under K.C.C. 21A.06.015, 21A.06.020, or 21A.06.025 may be located within a street setback, but only when used solely to supply electricity for electric-vehicle-charging infrastructure also within the setback or within the adjacent right-of-way.(Ord. 19824 § 11, 2024: Ord. 17191 § 37, 2011: Ord. 16267 § 27, 2008: Ord. 15971 § 94, 2007: Ord. 15606 § 16, 2006: Ord. 13190 § 18, 1998: Ord. 13022 § 18, 1998: Ord. 12987 § 4, 1998: Ord. 10870 § 354, 1993).21A.12.180 Height - exceptions to limits. The following structures may be erected above the height limits of K.C.C. 21A.12.030-.050.A. Roof structures housing or screening elevators, stairways, tanks, ventilating fans or similar equipment required for building operation and maintenance; andB. Fire or parapet walls, skylights, flagpoles, chimneys, smokestacks, church steeples, crosses, spires, communication transmission and receiving structures, utility line towers and poles, and similar structures. (Ord. 10870 § 355, 1993).21A.12.190 Height - limits near major airports. No building or structure shall be erected nor shall any tree be allowed to grow to a height in excess of the height limit established by the Airport Height Maps for the Seattle-Tacoma International Airport and the King County Airport (Boeing Field). (Ord. 10870 § 356, 1993).21A.12.200 Lot or site divided by zone boundary. When a lot or site is divided by a zone boundary, the following applies:A. If a lot or site contains both rural area or residential and nonresidential zoning, the zone boundary between the rural area or residential zone and the nonresidential zone shall be considered a lot line for determining permitted building height and required setbacks on the site.B. If a lot or site contains residential zones of varying density: 1. Any residential density transfer within the lot or site shall be allowed if: a. the density, as a result of moving dwelling units from one lot to another lot within a site or across zone lines within a single lot, does not exceed one hundred fifty percent of the base density on any of the lots or portions of a lot to which the density is transferred; b. the transfer does not reduce the minimum density achievable on the lot or site; c. the transfer enhances the efficient use of needed infrastructure; d. the transfer does not result in significant adverse impacts to the low density portion of the lot or site; e. the transfer contributes to preservation of environmentally sensitive areas, wildlife corridors, or other natural features; and f. the transfer does not result in significant adverse impacts to adjoining lower density properties; 2. Residential density transfers from one lot to another lot within a site or from one portion of a lot to another portion of a lot across a zone line shall not be allowed in the RA zone; 3. Residential density transfers shall not be allowed to a lot or portion of a lot zoned R-1; 4. Compliance with the criteria in this subsection B shall be evaluated during review of any development proposals in which such a transfer is proposed; and 5. Residential density transfers from one lot to another lot within a site or from one portion of a lot to another portion of a lot across a zone line shall not, in of itself, be considered development above the base density for purposes of requiring a conditional use permit for apartments or townhouses in the R-1 through R-8 zones.C. Uses on each portion of the lot shall only be those permitted in each zone in accordance with K.C.C. chapter 21A.08. (Ord. 17539 § 36, 2013: Ord. 14429 § 3, 2002: Ord. 14045 § 24, 2001: Ord. 11157 § 16, 1993: Ord. 10870 § 357, 1993).21A.12.210 Sight distance requirements. Except for utility poles and traffic control signs, the following sight distance provisions shall apply to all intersections and new or reconstructed driveway access points on local access streets. Sight distance requirements for arterial and neighborhood collector intersections are specified in the King County road standards:A. A sight distance triangle area as determined by Section 21A.12.210B shall contain no fence, berm, vegetation other than narrow tree trunks, on-site vehicle parking area, signs or other physical obstruction between 42 inches and eight feet above the existing street grade;NOTE: The area of a sight distance triangle between 42 inches and eight feet above the existing street grade shall remain open.B. The sight distance triangle requirements for new or reconstructed intersections and driveway connections to local access streets are defined as follows: 1. Except where a twenty-five foot property line radius exists at an intersection, a sight distance triangle at a street intersection shall be determined by measuring fifteen feet along both street property lines beginning at their point of intersection. The third side of the triangle shall be a line connecting the endpoints of the first two sides of the triangle. Where a twenty-five foot property line radius or larger radius is present at an intersection, the King County road standards shall govern the placement of objects that may obscure sight distance; or 2. A driveway access point shall be determined by measuring fifteen feet along the street lines and fifteen feet along the edges of the driveway beginning at the respective points of intersection. The third side of each triangle shall be a line connecting the endpoints of the first two sides of each triangle; andC. The development engineer may require modification or removal of structures or landscaping located in required street setbacks or relocate the driveway connection, if: 1. Such improvements prevent adequate sight distance to drivers entering or leaving a driveway, and, 2. No reasonable driveway relocation alternative for an adjoining lot is feasible. (Ord. 16267 § 28, 2008: Ord. 10870 § 358, 1993).21A.12.220 Nonresidential land uses in RA, UR, or R zones.A. The requirements of this section apply to all nonresidential uses located in the RA, UR, or R zones, except: 1. Utility facilities; 2. Uses listed in K.C.C. 21A.08.100, except that the standards in this section shall apply to battery energy storage systems not defined as accessory uses under K.C.C. 21A.06.015, 21A.06.020, or 21A.06.025; and 3. Nonresidential uses regulated by 21A.12.230.B. Impervious surface coverage shall not exceed: 1. Forty percent of the site in the RA zone. 2. Seventy percent of the site in the UR and the R-1 through R-8 zones. 3. Eighty percent of the site in the R-12 through R-48 zones.C. Buildings and structures, except fences and wire or mesh backstops, shall not be closer than 30 feet to any property line, except as provided in subsection D.D. Single detached dwelling allowed as accessory to a church or school shall conform to the setback requirements of the zone.E. Parking areas are permitted within the required setback area from property lines, but only if such parking areas are located outside of the required landscape area.F. Sites shall abut or be accessible from at least one public street functioning at a level consistent with King County Road Design Standards. New high school sites shall abut or be accessible from a public street functioning as an arterial per the King County Design Standards.G. The base height shall conform to the zone in which the use is located.H. Building illumination and lighted signs shall be designed so that no direct rays of light are projected into neighboring residences or onto any street right-of-way. (Ord. 19824 § 12, 2024: Ord. 11802 § 5, 1995: Ord. 11621 § 44, 1994: Ord. 10870 § 359, 1993).21A.12.230 Personal services and retail uses in R-4 through R-48 zones. The general personal service use (SIC # 72 except 7216, 7218 and 7261) listed in K.C.C. 21A.08.050 and the retail uses, except agricultural crop sales, listed in K.C.C. 21A.08.070 which are located in the R-4 through R-48 zones shall be subject to the following requirements:A. Each individual establishment shall not exceed 5,000 square feet of gross floor area and the combined total of all contiguous commercial establishments shall not exceed 15,000 square feet of gross floor area;B. Establishments shall not be located less than one mile from another commercial establishment, unless located with other establishments meeting the criteria in paragraph A;C. Establishment sites shall abut an intersection of two public streets, each of which is designated as a neighborhood collector or arterial and which has improved pedestrian facilities for at least 1/4th mile from the site;D. The maximum on-site parking ratios for establishments and sites shall be 2 per 1000 square feet and required parking shall not be located between the building(s) and the street; andE. Buildings shall comply with the building facade modulation and roofline variation requirements in K.C.C. 21A.14.080 and .090 and at least one facade of the building shall be located within five feet of the sidewalk.F. If the personal service or retail use is located in a building with multifamily uses, then the commercial use shall be on the ground floor and shall not exceed 25 percent of the total floor area of the building.G. Sign and landscaping standards for the use apply. (Ord. 12596 § 11, 1997: Ord. 10870 § 360, 1993).21A.12.240 Joint use driveway and easement width. The minimum width for a joint use driveway and easement on private property shall be sixteen feet, except as otherwise provided in the King County road standards. (Ord. 16267 § 29, 2008).21A.12.250 General personal service use, office/outpatient use allowed - restrictions.The general personal service use (SIC # 72 except 7216, 7218 and 7261) and the office/outpatient clinic use (SIC # 801 - 04) listed in K.C.C. 21A.08.050 are allowed as a conditional use, subject to the following requirements:A. The site shall be zoned R-4 through R-48;B. The establishment shall be located within one-quarter mile of a rural town, unincorporated activity center, community business center or neighborhood business center and less than one mile from another commercial establishment;C. The establishment shall be located in either: 1. A legally established single family dwelling in existence on or before January 1, 2008. The structure may not be expanded by more than ten percent as provided in K.C.C. 21A.32.065 for the expansion of legally established nonconforming uses; or 2. A mixed use development with one hundred percent of the dwelling units affordable to households with incomes at or below sixty percent of area median income and on-site supportive services consistent with the King County Consortium Consolidated Housing and Community Development Plan or successor plan;D. The maximum on-site parking ratio for establishments and sites shall be two per one thousand square feet and required parking shall not be located between the building and the street; andE. Sign and landscaping standards for the use apply. (Ord. 19146 § 49, 2020: Ord. 16267 § 30, 2008).21A.12.260 Shoreline jurisdiction - density and dimensions apply - exceptions. The density and dimensions established in this chapter apply within the shoreline jurisdiction except as inconsistent with K.C.C. 21A.25.220. (Ord. 16985 § 110, 2010).21A.14DEVELOPMENT STANDARDS - DESIGN REQUIREMENTSSections:21A.14.010Purpose.21A.14.020General layout standards.21A.14.025Cottage housing development.21A.14.030Lot segregations - Zero lot line development.21A.14.040Lot segregations - clustered development.21A.14.050Lot segregations - UR zone reserve tract.21A.14.060Townhouse development.21A.14.070Attached dwellings and group residences - Applicability.21A.14.080Attached dwellings and group residences - Vehicular access and parking location.21A.14.090Attached dwellings and group residences - Building fa?ade modulation.21A.14.110Mixed use development - Percentages of residential uses.21A.14.120Mixed use development - Residential density.21A.14.130Mixed use development - Building floor area.21A.14.135Mixed use development - design features.21A.14.145Mixed use development phasing - required plans, requirements, covenants,recordings -- review and approval.21A.14.150Mobile home parks - Standards for existing parks.21A.14.160Mobile home parks - Standards for new parks.21A.14.170Mobile home parks - Alternative design.21A.14.180On site recreation - space required.21A.14.185Recreation space - fees in lieu of.21A.14.190On-site recreation - play areas required.21A.14.195On-site recreation – financial guarantees for construction.21A.14.200On-site recreation - maintenance of recreation space or dedication.21A.14.210Storage space and collection points for recyclables.21A.14.220Fences.21A.14.225Hazardous liquid and gas transmission pipelines.21A.14.230Trail corridors - Applicability.21A.14.240Trail corridors - Design standards.21A.14.250Trail corridors - Maintenance of trail corridors/improvements.21A.14.280Rural industry development standards.21A.14.300Short subdivision or short subdivision alterations – adequacy of access – right of way use permits.21A.14.310Proposed formal subdivisions, short subdivisions or binding site plans – railroad buffer strips.21A.14.320Preliminary subdivision and short subdivision approval -- maintenance of private streets, easements and utilities required.21A.14.330Preliminary subdivision and short subdivision approval – covenants relating to keeping livestock in the RA zone.21A.14.350Rural equestrian community trail preservation – purpose.21A.14.360Rural equestrian community trails – general applicability.21A.14.365Rural equestrian community trails - notification.21A.14.370Rural equestrian community trails – authority.21A.14.380Rural equestrian community trails – location and design standards.21A.14.390Rural equestrian community trails – maintenance and operation.21A.14.010 Purpose. The purpose of this chapter is to improve the quality of development by providing building and site design standards that:A. Reduce the visual impact of large residential buildings from adjacent streets and properties;B. Enhance the aesthetic character of large residential buildings;C. Contain sufficient flexibility of standards to encourage creative and innovative site and building design;D. Meet the on-site recreation needs of project residents;E. Enhance aesthetics and environmental protection through site design; andF. Allow for continued or adaptive reuse of historic resources while preserving their historic and architectural integrity. (Ord. 11621 § 45, 1994: 10870 § 361, 1993).21A.14.020 General layout standards. For residential developments in the UR and R zones:A. The maximum length of blocks shall be 1,320 feet; andB. Except for corner lots, lots for single detached dwellings shall not have street frontage along two sides unless one of said streets is a neighborhood collector street or an arterial street. (Ord. 10870 § 362, 1993).21A.14.025 Cottage housing development. For cottage housing developments in the R4-R8 zones:A. The total area of the common open space must be at least two hundred and fifty square feet per unit and at least fifty percent of the units must be clustered around the common space.B. The total floor area of each unit, except for two hundred and fifty square feet of any enclosed parking, is limited to one thousand two hundred square feet. The footprint of each unit, including any enclosed parking, is limited to nine hundred square feet. A front or wraparound porch of up to one hundred square feet is permitted and is not to be included in the floor area or footprint calculation.C. Fences within the cottage housing unit development are limited to three feet in height. Fences along the perimeter of the cottage housing development are limited to six feet.D. Individual cottage housing units must be at least ten feet apart.E. Each dwelling unit that abuts common open space shall have either a primary entry or a covered porch, or both, oriented to the common open space.F. Each dwelling unit within forty feet of a public right-of-way, not including alleys, shall have a facade oriented to the public right-of-way that includes a porch, an entrance or a bay window that projects a minimum of six inches and is a minimum of four feet in width. If a dwelling unit is within forty feet of more than one public right-of-way, the department shall determine which right-of-way towards which the facade elements shall be oriented. Materials used on this facade shall wrap the corners of the unit. (Ord. 19146 § 50, 2020: Ord. 15245 § 8, 2005: Ord. 15032 § 18, 2004).21A.14.030 Lot segregations - Zero lot line development. In any UR or R zone or in the NB zone on property designated commercial outside of center in the urban area, interior setbacks may be modified during subdivision or short subdivision review as follows:A. If a building is proposed to be located within a normally required interior setback: 1. An easement shall be provided on the abutting lot of the subdivision that is wide enough to ensure a 10-foot separation between the walls of structures on adjoining lots, except as provided for common wall construction; 2. The easement area shall be free of permanent structures and other obstructions that would prevent normal repair and maintenance of the structure's exterior; 3. Buildings utilizing reduced setbacks shall not have doors that open directly onto the private yard areas of abutting property. Windows in such buildings shall not be oriented toward such private yard areas unless they consist of materials such as glass block, textured glass, or other opaque materials, and shall not be capable of being opened, except for clerestory-style windows or skylights; and 4. The final plat or short plat shall show the approximate location of buildings proposed to be placed in a standard setback area.B. In the UR or R zones, setbacks on existing individual lots may be modified provided that the standards set forth in subsection A.1 of this section are met. (Ord. 12522 § 5, 1996: Ord. 11978 § 6, 1995: Ord. 10870 § 363, 1993).21A.14.040 Lot segregations - clustered development. Residential lot clustering is allowed in the R, UR and RA zones. If residential lot clustering is proposed, the following requirements shall be met:A. In the R zones, any designated open space tract resulting from lot clustering shall not be altered or disturbed except as specified on recorded documents creating the open space. Open spaces may be retained under ownership by the subdivider, conveyed to residents of the development or conveyed to a third party. If access to the open space is provided, the access shall be located in a separate tract;B. In the RA zone: 1. No more than eight lots of less than two and one-half acres shall be allowed in a cluster; 2. No more than eight lots of less than two and one-half acres shall be served by a single cul-de-sac street; 3. Clusters containing two or more lots of less than two and one-half acres, whether in the same or adjacent developments, shall be separated from similar clusters by at least one hundred twenty feet; 4. The overall amount, and the individual degree of clustering shall be limited to a level that can be adequately served by rural facilities and services, including, but not limited to, on-site sewage disposal systems and rural roadways; 5. A fifty-foot Type II landscaping screen, as defined in K.C.C. 21A.16.040, shall be provided along the frontage of all public roads when adjoining differing types of development such as commercial and industrial uses, between differing types of residential development and to screen industrial uses from the street. The planting materials shall consist of species that are native to the Puget Sound region. Preservation of existing healthy vegetation is encouraged and may be used to augment new plantings to meet the requirements of this section; 6. Except as provided in subsection B.7. of this section, open space tracts created by clustering in the RA zone shall be designated as permanent open space. Acceptable uses within open space tracts are passive recreation, with no development of active recreational facilities, natural-surface pedestrian and equestrian foot trails and passive recreational facilities. A resource tract created under K.C.C. 16.82.152.E. may be considered an open space tract for purposes of this subsection B.6; 7.a. In the RA zone a resource tract may be created through a cluster development in lieu of an open space tract. A resource tract created under K.C.C. 16.82.152.E. may be considered a resource tract for purposes of this subsection B.7. The resource tract may be used as a working forest or farm if: (1) the department determines the resource tract is suitable for forestry or agriculture; and (2) the applicant submits a forest management plan prepared by a professional forester that has been approved by the King County department of natural resources and parks, or a farm management plan developed by the King Conservation District. The management plan must: (a) ensure that forestry or farming will remain as a sustainable use of the resource tract ; (b) set impervious surface and clearing limitations and identify the type of buildings or structures that will be allowed within the resource tract; and (c) if critical areas are included in the resource tract, clearly distinguish between the primary purpose of the resource portion of the tract and the primary purpose of the critical area portion of the tract as required under K.C.C. 21A.24.180. b. The recorded plat or short plat shall designate the resource tract as a working forest or farm. c. If the applicant conveys the resource tract to residents of the development, the resource tract shall be retained in undivided interest by the residents of the subdivision or short subdivision. d. A homeowners association shall be established to ensure implementation of the forest management plan or farm management plan if the resource tract is retained in undivided interest by the residents of the subdivision or short subdivision. e. The applicant shall file a notice with the King County department of executive services, records and licensing services division. The required contents and form of the notice shall be set forth in a public rule. The notice shall inform the property owner or owners that the resource tract is designated as a working forest or farm, that must be managed in accordance with the provisions established in the approved forest management plan or farm management plan. f. The applicant shall provide to the department proof of the approval of the forest management plan or farm management plan and the filing of the notice required in subsection B.7.g. of this section before recording of the final plat or short plat. g. The notice shall run with the land. h. Natural-surface pedestrian and equestrian foot trails, passive recreation, and passive recreational facilities, with no development of active recreational facilities, are allowed uses in resource tracts; and 8. The requirements of subsection B.1., 2., or 3. of this subsection may be modified or waived by the director if the property is encumbered by critical areas containing habitat for, or there is the presence of, species listed as threatened or endangered under the Endangered Species Act when it is necessary to protect the habitat; andC. In the R-1 zone, open space tracts created by clustering required by K.C.C. 21A.12.030 shall be located and configured to create urban separators and greenbelts as required by the comprehensive plan, or subarea plans or open space functional plans, to connect and increase protective buffers for critical areas, to connect and protect wildlife habitat corridors designated by the comprehensive plan and to connect existing or planned public parks or trails. The department may require open space tracts created under this subsection to be dedicated to an appropriate managing public agency or qualifying private entity such as a nature conservancy. In the absence of such a requirement, open space tracts shall be retained in undivided interest by the residents of the subdivision or short subdivision. A homeowners association shall be established for maintenance of the open space tract. (Ord. 17539 § 37, 2013: Ord. 16267 § 31, 2008: Ord. 15971 § 95, 2007: Ord. 15606 § 17, 2006: Ord. 15051 § 129, 2004: Ord. 15032 § 19, 2004: Ord. 14199 § 234, 2001: Ord. 14259 § 8, 2001: Ord. 14045 § 25, 2001: Ord. 13022 § 19, 1998: Ord. 12822 § 8, 1997: Ord. 11621 § 47, 1994: Ord. 10870 § 364, 1993).21A.14.050 Lot segregations - UR zone reserve tract. Subdivision of UR zoned property of ten or more acres shall be required to be clustered and a reserve tract shall be created for future development in accordance with the following:A. The reserve tract shall be no less than seventy-five percent of the net developable area of the property to be subdivided.B. The reserve tract shall be configured to contain lands with topography and natural features that allow future conversion of the reserve tract to residential development at urban densities.C. The reserve tract may contain a single dwelling unit, only if: 1. The unit was included in the overall density calculations for the original subdivision creating the reserve tract; and 2. The unit was noted on the face of the original subdivision (plat or short plat).D. The reserve tract shall not be altered or disturbed except as specified on the face of the original subdivision (plat or short plat).E. The reserve tract may be retained under the ownership of the subdivider, conveyed to residents of the subdivisions, or conveyed to a third party. Regardless of ownership of the reserve tract, all restrictions relative to the reserve tract shall apply.F. The reserve tract shall not be used to satisfy the recreation space requirement of the original subdivision.G. The layout of the lots and roadways created in the original subdivision shall facilitate future development of the reserve tract.H. The reserve tract shall not be eligible for further subdivision until such time that reclassification of the reserve tract occurs in accordance with the community plan area zoning process outlined in K.C.C. 20.08.030.I. Any proposed subsequent development on the reserve tract shall be governed by the development standards in effect at the time of such development. (Ord. 15032 § 20, 2004: Ord. 15032 § 20, 2004: Ord. 10870 § 365, 1993).21A.14.060 Townhouse development. In the R-1 through R-8 zones and in the NB zone on property designated commercial outside of center in the urban area, a building that contains a grouping of attached townhouse units shall not exceed a 200-foot maximum length without a separation of at least 10 feet from other groupings or rows of townhouses. (Ord. 12522 § 6, 1996: Ord. 11978 § 7, 1995: Ord. 10870 § 366, 1993).21A.14.070 Attached dwellings and group residences - Applicability. The standards of K.C.C. 21A.14.080 through 21A.14.090 shall apply to all new apartment developments exceeding four dwelling units, new townhouse development and new group residences except Class I Community Residential Facilities ("CRF-I"). Expansions of existing development that involve four or more dwelling units shall be subject to compliance with K.C.C. 21A.14.080 to 21A.14.090. (Ord. 13086 § 3, 1998: Ord. 10870 § 367, 1993).21A.14.080 Attached dwellings and group residences - Vehicular access and parking location.A. On sites abutting an alley constructed to a width of at least 20 feet, apartment and townhouse development and all group residences except Class I Community Residential Facilities ("CRF-I") shall have parking areas placed to the rear of buildings with primary vehicular access via the alley, except when waived by the director due to physical site limitations.B. When alley access is provided, no additional driveway access from the public street shall be allowed except as necessary to access parking under the structure or for fire protection.C. When the number of uncovered common parking spaces for attached dwellings and group residences exceed 30 spaces and when there is alley access, no more than 50 percent of these uncovered parking spaces shall be permitted between the street property line and any building, except when authorized by the director due to physical site limitations. (Ord. 11978 § 8, 1995: Ord. 10870 § 368, 1993).21A.14.090 Attached dwellings and group residences - Building facade modulation. Apartment and townhouse developments and all group residences shall provide building facade modulation on facades exceeding 60 feet and facing abutting streets or properties zoned R-1 through R-4. The following standards shall apply:A. The maximum wall length without modulation shall be 30 feet; andB. The sum of the modulation depth and the modulation width shall be no less than eight feet. Neither the modulation depth nor the modulation width shall be less than two feet.C. Any other technique approved by the director that achieves the intent of this section. (Ord. 11978 § 9, 1995: Ord. 10870 § 369, 1993).21A.14.110 Mixed use development - Percentages of residential uses. Residential uses in mixed use developments shall be subject to the following limits:A. A maximum of fifty percent of the total built floor area when located in NB zones; andB. A maximum of seventy-five percent of the total built floor area when located in CB, RB and O zones provided that the total percentage may be increased by an additional ten percent with the approval of the director. (Ord. 11978 § 11, 1995: Ord. 10870 § 371, 1993).21A.14.120 Mixed use development - Residential density. Base residential density for mixed use developments shall be determined using total site area according to K.C.C. 21A.12.040A. (Ord. 10870 § 372, 1993).21A.14.130 Mixed use development - Building floor area.A. For mixed use developments that utilize at least 25 percent of building square footage for residential uses in the NB zone and at least 50 percent of building square footage in the CB, RB or O zones, the building floor area ratio shall be as follows: 1. 1.5/1 in NB zones; 2. 3.5/1 in CB zones; and 3. 4.0/1 in RB and O zones;B. Building floor area ratios of subsection A may be increased when all required parking is contained within a common parking structure, as follows: 1. 2.0/1 in NB zones; 2. 4.5/1 in CB zones; and 3. 5.0/1 in RB and O zones. (Ord. 11978 § 12, 1995: Ord. 10870 § 373, 1993).21A.14.135 Mixed use development – design features. Mixed-use development permitted by K.C.C. chapter 21A.08 shall incorporate the following design features:A. Residential and nonresidential uses proposed for mixed-use development shall be only those uses permitted in the zone, as established by K.C.C. chapter 21A.08; B. If residential and nonresidential uses are proposed for the same structure, nonresidential uses shall occupy the lower levels. The director may waive this requirement under the following circumstances: 1. If the structure is located on a sloping lot that provides access from upper levels or from multiple levels. In such cases, the nonresidential use may be located on the levels that exit onto the primary pedestrian streets; or 2. If views from the upper levels are valuable amenities that would help assure success of the nonresidential uses, such as a restaurant;C. Mixed-use development shall provide off-street parking behind or to the side of buildings, or enclosed within buildings consistent with K.C.C. 21A.18.030. Relief from this requirement may be granted by the director only if the applicant can demonstrate that there is no practical site design to meet this requirement. The director may allow only the number of parking spaces that cannot be accommodated to the rear or sides of buildings, or enclosed within buildings, to be located to the front of buildings. A twenty percent reduction of required parking is allowed if a mixed-use development meets the criteria of K.C.C. 21A.18.040 for shared parking. (Ord. 14045 § 26, 2001).21A.14.145 Mixed use development - phasing - required plans, requirements, covenants, recordings -- review and approval. When residential and commercial uses are proposed to be contained in separate structures and the structures containing residential uses are proposed to be built prior to those containing commercial uses, then a commercial site development permit shall be required and as well as the following: A. The applicant shall submit a site plan showing the entire mixed use development. The plan shall show project features including the location of the residential and commercial structures, parking areas, landscaping planters, sidewalks, and pedestrian linkages. The plan shall be drawn to scale and provide sufficient detail to ensure all zoning and development standards are met for the entire development.B. Infrastructure plans, including storm drainage facilities, shall be sized to accommodate the needs of the entire mixed use development. The infrastructure shall be installed with the first phase of the development up to or near the commercial building(s) unless the applicant demonstrates to the department's satisfaction that there is potential for significant damage to the infrastructure during the construction of any later phase of construction.C. For the purpose of informing future property owners of limitations on future development because of the mixed use provisions of this title, the applicant shall record a covenant on the property that states the restrictions upon the remaining portions of the site that they shall only be used for commercial uses. The covenant shall be recorded prior to the issuance of the building permit for the residential structure(s). The covenant shall be subject to review and approval by the department. (Ord. 13851 § 1, 2000).21A.14.150 Mobile home parks - Standards for existing parks.A. Mobile home parks established prior to the effective date of this code shall continue to be governed by all standards relating to density, setbacks, landscaping and off-street parking in effect at the time they were approved.B. Placement of new accessory structures and replacement mobile homes, either standard or nonstandard, in these mobile home parks shall be governed by the dimensional standards in effect when the parks were approved, unless two or more replacement mobile homes are proposed to be installed adjacent to each other under the flexible setback option set forth in K.C.C. 21A.14.170. Where internal setbacks are not specified, the average of the prevailing setbacks on the pads to either side of the proposed new or replacement structure shall apply. C. No spaces or pads in an existing mobile home park shall be used to accommodate recreational vehicles (RVs), except when the spaces or pads were specifically for RVs at the time the park was established.D. An existing mobile home park may be enlarged, provided the proposed enlargement meets the standards set forth in K.C.C. 21A.14.160 and K.C.C. 21A.14.170.E. Both insignia and non-insignia mobile homes may be installed in established parks, provided that all mobile homes supported by piers shall be fully skirted, and that nonstandard mobile homes shall meet the minimum livability and safety requirements set forth in K.C.C. Title 16, Building Code and Construction Standards. (Ord. 10870 § 375, 1993).21A.14.160 Mobile home parks - Standards for new parks. New mobile home parks shall be developed subject to the following standards:A. A mobile home park shall be at least three acres in area;B. Residential densities in a mobile home park shall be as follows: 1. Six dwellings per acre in R-4 zone; 2. The base density of the zone in which the park is located in all R-6 through R-48 zones; and 3. Mobile home parks shall be eligible to achieve the maximum density permitted in the zone by providing the affordable housing benefit for mobile home parks set forth in K.C.C. 21A.34;C. Both insignia and non-insignia mobile homes may be installed in mobile home parks, provided that non-insignia mobile homes shall meet the minimum livability and safety requirements set forth in K.C.C. Title 16, Building Code;D. A mobile home park shall be exempt from impervious surface limits set forth in K.C.C. 21A.12;E. At least one of the off-street parking spaces required for each mobile home shall be located on or adjacent to each mobile home pad;F. Internal roads and sidewalks shall provide access to each mobile home space and shall be constructed in accordance with the adopted King County road standards for residential minor access streets;G. There shall be a minimum of ten feet of separation maintained between all mobile homes on the site, unless the flexible setback option set forth in K.C.C. 21A.14.170 is used. Accessory structures shall be located no closer than: 1. Ten feet to mobile homes on adjacent spaces, unless constructed of noncombustible materials, in which case the minimum setback shall be five feet; 2. Five feet to accessory structures of mobile homes on adjacent spaces; and 3. Five feet to the mobile home or other accessory structures on the same space, except a carport or garage may be attached to the mobile home, and the separation may be waived when such structures are constructed of noncombustible materials;H. All mobile homes and RVs supported by piers shall be fully skirted; andI. A mobile home park may include a storage area for RVs owned by residents of the park, provided the storage area contains no utility hook-ups and no RV within the storage area shall be used as living quarters. (Ord. 11802 § 6, 1995: Ord. 10870 § 376, 1993).21A.14.170 Mobile home parks - Alternative design standards. As an alternative to the building separation and internal street standards of K.C.C. 21A.14.160:A. Building separation requirements or setbacks between mobile homes and accessory structures on adjacent spaces may be modified, provided: 1. The common walls meet the fire protection standards set forth in the International Building Code and the standards set forth in the International Fire Code for duplexes, multifamily and condominium developments, as applicable; and 2. Rental agreement clauses, by-laws or other legal mechanisms stipulate maintenance responsibilities for structures, fences and yards;B. Private streets may be used with a minimum driving surface of 22 feet in width, provided: 1. The streets comply in all other respects with the road standards; 2. All required parking is located off-street and as specified in K.C.C. 21A.14.160.E; and 3. Such streets shall not: a. directly connect two or more points of vehicular access to the park; or b. serve over 100 dwelling units within the park. (Ord. 17837 § 89, 2014: Ord. 10870 § 377, 1993).21A.14.180 On-site recreation - space required.A. Residential developments, other than cottage housing developments, of more than four units in the UR and R-4 through R-48 zones, stand-alone townhouse developments in the NB zone on property designated commercial outside of center in the urban area of more than four units, and mixed-use developments of more than four units, shall provide recreation space for leisure, play and sport activities as follows: 1. Residential subdivision, townhouses and apartments developed at a density of eight units or less per acre: three hundred ninety square feet per unit; 2. Mobile home park: two hundred sixty square feet per unit; 3. Residential subdivisions developed at a density of greater than eight units per acre: one hundred seventy square feet per unit; and 4. Apartments and townhouses developed at a density of greater than eight units per acre and mixed use: a. Studio and one bedroom: ninety square feet per unit; b. Two bedrooms: one hundred seventy square feet per unit; and c. Three or more bedrooms: one hundred seventy square feet per unit.B. Recreation space shall be placed in a designated recreation space tract if part of a subdivision. The tract shall be dedicated to a homeowner's association or other workable organization acceptable to the director, to provide continued maintenance of the recreation space tract consistent with K.C.C. 21A.14.200.C. Any recreation space located outdoors that is not part of a storm water tract developed in accordance with subsection F. of this section shall: 1. Be of a grade and surface suitable for recreation improvements and have a maximum grade of five percent; 2. Be on the site of the proposed development; 3. Be located in an area where the topography, soils, hydrology and other physical characteristics are of such quality as to create a flat, dry, obstacle-free space in a configuration that allows for passive and active recreation; 4. Be centrally located with good visibility of the site from roads and sidewalks; 5. Have no dimensions less than thirty feet, except trail segments; 6. Be located in one designated area, unless the director determines that residents of large subdivisions, townhouses and apartment developments would be better served by multiple areas developed with recreation or play facilities; 7. Have a street roadway or parking area frontage along ten percent or more of the recreation space perimeter, except trail segments, if the required outdoor recreation space exceeds five thousand square feet and is located in a single detached or townhouse subdivision; 8. Be accessible and convenient to all residents within the development; and 9. Be located adjacent to, and be accessible by, trail or walkway to any existing or planned municipal, county or regional park, public open space or trail system, which may be located on adjoining property.D. Indoor recreation areas may be credited towards the total recreation space requirement, if the director determines that the areas are located, designed and improved in a manner that provides recreational opportunities functionally equivalent to those recreational opportunities available outdoors. For senior citizen assisted housing, indoor recreation areas need not be functionally equivalent but may include social areas, game and craft rooms, and other multipurpose entertainment and education areas.E. Play equipment or age appropriate facilities shall be provided within dedicated recreation space areas according to the following requirements: 1. For developments of five dwelling units or more, a tot lot or children’s play area, that includes age appropriate play equipment and benches, shall be provided consistent with K.C.C. 21A.14.190; 2. For developments of five to twenty-five dwelling units, one of the following recreation facilities shall be provided in addition to the tot lot or children’s play area: a. playground equipment; b. sport court; c. sport field; d. tennis court; or e. any other recreation facility proposed by the applicant and approved by the director; 3. For developments of twenty-six to fifty dwelling units, at least two or more of the recreation facilities listed in subsection E.2. of this section shall be provided in addition to the tot lot or children’s play area; and 4. For developments of more than fifty dwelling units, one or more of the recreation facilities listed in subsection E.2. of this section shall also be provided for every twenty-five dwelling units in addition to the tot lot or children’s play area. If calculations result in a fraction, the fraction shall be rounded to the nearest whole number as follows: a. Fractions of 0.50 or above shall be rounded up; and b. Fractions below 0.50 shall be rounded down.F. In subdivisions, recreation areas that are contained within the on-site stormwater tracts, but are located outside of the one hundred year design water surface, may be credited for up to fifty percent of the required square footage of the on-site recreation space requirement on a foot-per-foot basis, subject to the following criteria: 1. The stormwater tract and any on-site recreation tract shall be contiguously located. At final plat recording, contiguous stormwater and recreation tracts shall be recorded as one tract and dedicated to the homeowner's association or other organization as approved by the director; 2. The drainage facility shall be constructed to meet the following conditions: a. The side slope of the drainage facility shall not exceed thirty-three percent unless slopes are existing, natural and covered with vegetation; b. A bypass system or an emergency overflow pathway shall be designed to handle flow exceeding the facility design and located so that it does not pass through active recreation areas or present a safety hazard; c. The drainage facility shall be landscaped and developed for passive recreation opportunities such as trails, picnic areas and aesthetic viewing; and d. The drainage facility shall be designed so they do not require fencing under the King County Surface Water Design Manual.G. When the tract is a joint use tract for a drainage facility and recreation space, King County is responsible for maintenance of the drainage facility only and requires a drainage easement for that purpose.H. A recreation space plan shall be submitted to the department and reviewed and approved with engineering plans. 1. The recreation space plans shall address all portions of the site that will be used to meet recreation space requirements of this section, including drainage facility. The plans shall show dimensions, finished grade, equipment, landscaping and improvements, as required by the director, to demonstrate that the requirements of the on-site recreation space in K.C.C. 21A.14.180 and play areas in K.C.C. 21A.14.190 have been met. 2. If engineering plans indicate that the on-site drainage facility or stormwater tract must be increased in size from that shown in preliminary approvals, the recreation plans must show how the required minimum recreation space under K.C.C. 21A.14.180.A. will be met. (Ord. 17841 § 32, 2014: Ord. 15606 § 18, 2006: Ord. 15051 § 130, 2004: Ord. 14429 § 4, 2002: Ord. 14045 § 31, 2001: Ord. 12522 § 7, 1996: Ord. 11978 § 13, 1995: Ord. 11621 § 48, 1994: Ord. 10870 § 378, 1993).21A.14.185 Recreation space - fees in lieu of.A. The creation of on-site recreation space shall be the preferred method of providing new development with opportunities for leisure, play and sports activities. Applicants shall to the best of their ability endeavor to provide recreation space on the project site. However, if on-site recreation space is not provided in accordance with K.C.C. 21A.14.180, the applicant shall pay a fee-in-lieu of actual recreation space if approved by King County. King County acceptance of a fee-in-lieu payment is discretionary. A fee-in-lieu of on-site recreation space may be permitted if the recreation space provided within a county park in the vicinity will be of greater benefit to the prospective residents of the development.B. Fees shall be determined annually by the department of natural resources and parks on the basis of the projected market value of the required recreation space land area after development. Any recreational space provided by the applicant shall be credited toward the required fees.C. If recreation space credit is applied to stormwater facilities in accordance with K.C.C. 21A.14.180E, the development loses its option to request a fee-in-lieu and the remainder of the required recreation space and play area must be provided on site. (Ord. 17841 § 33, 2014: Ord. 14045 § 32, 2001: Ord. 11621 § 49, 1994).21A.14.190 On-site recreation – play areas required.A. All single detached subdivisions, apartment, townhouse and mixed-use developments, of more than four units in the UR and R-4 through R-48 zones and stand-alone townhouse developments in the NB zone of more than four units on property designated commercial outside of center in the urban area, excluding age-restricted senior citizen housing, shall provide children play areas within the recreation space on-site, except if facilities are available to the public that meet all of the following: 1. Developed as a county, municipal or regional park; 2. Located within one quarter mile walking distance; and 3. Accessible without crossing any arterial street.B. Play area designs shall: 1. Provide at least forty five square feet per dwelling unit, with a minimum size of four hundred square feet; 2. Be adjacent to main pedestrian paths or near building entrances; 3. Meet the requirements of K.C.C. 21A.14.180; and 4. Provide play equipment that meets, at a minimum, the Consumer Product Safety Standards for equipment, soft surfacing and spacing. (Ord. 14045 § 33, 2001: Ord. 13022 § 20, 1998: Ord. 10870 § 379, 1993).21A.14.195 On-site recreation – financial guarantees for construction. Financial guarantees for construction of recreation facilities required under K.C.C. 21A.14.180 and 21A.14.190 shall be provided consistent with K.C.C. Title 27A. (Ord. 14045 § 35, 2001).21A.14.200 On-site recreation - maintenance of recreation space or dedication.A. Recreation space that meets the criteria in K.C.C. 21A.14.180.C may, at the discretion of the department of natural resources and parks, be dedicated as a park open to the public in lieu of providing the on-site recreation required under K.C.C. 21A.14.180 if the following criteria are met: 1. The dedicated area is at least ten acres in size, unless when adjacent to an existing or planned county park; 2. The dedicated land provides one or more of the following: a. shoreline access; b. regional trail linkages; c. habitat linkages; d. recreation facilities; or e. heritage sites; and 3. The dedicated area is located within one mile of the project site.B. Unless the recreation space is dedicated to King County in accordance with subsection A of this section, maintenance of any recreation space retained in private ownership shall be the responsibility of the owner or other separate entity capable of long-term maintenance and operation in a manner acceptable to the parks department. (Ord. 17841 § 34, 2014: Ord. 14045 § 34, 2001: Ord. 13022 § 21, 1998: Ord. 10870 § 380, 1993).21A.14.210 Storage space and collection points for recyclables. Developments shall provide storage space for the collection of recyclables as follows:A. The storage space shall be provided at the following rates, calculated based on any new dwelling unit in multiple-dwelling developments and any new square feet of building gross floor area in any other developments: 1. One and one-half square feet per dwelling unit in multiple-dwelling developments except where the development is participating in a county-sponsored or approved direct collection program in which individual recycling bins are used for curbside collection; 2. Two square feet per every 1,000 square feet of building gross floor area in office, educational and institutional developments; 3. Three square feet per every 1,000 square feet of building gross floor area in manufacturing and other nonresidential developments; and 4. Five square feet per every 1,000 square feet of building gross floor area in retail developments.B. The storage space for residential developments shall be apportioned and located in collection points as follows: 1. The required storage area shall be dispersed in collection points throughout the site when a residential development comprises more than one building. 2. There shall be one collection point for every 30 dwelling units. 3. Collection points may be located within residential buildings, in separate buildings/structures without dwelling units, or outdoors. 4. Collection points located in separate buildings/structures or outdoors shall be no more than 200 feet from a common entrance of a residential building. 5. Collection points shall be located in a manner so that the swing of any collection point gate does not obstruct pedestrian or vehicle traffic or access to parking or that the gate swing or any hauling truck does not project into any public right-of-way.C. The storage space for nonresidential developments shall be apportioned and located in collection points as follows: 1. Storage space may be allocated to a centralized collection point. 2. Outdoor collection points shall not be located in any required setback areas. 3. Collection points shall be located in a manner so that the swing of any collection point gate does not obstruct pedestrian or vehicle traffic or access to parking or that the gate swing or any hauling truck does not project into any public right-of-way. 4. Access to collection points may be limited, except during regular business hours and/or specified collection hours.D. The collection points shall be designed as follows: 1. Dimensions of the collection points shall be of sufficient width and depth to enclose containers for recyclables. 2. Architectural design of any structure enclosing an outdoor collection point or any building primarily used to contain a collection point shall be consistent with the design of the primary structure(s) on the site. 3. Collection points shall be identified by signs not exceeding two square feet. 4. A six-foot wall or fence shall enclose any outdoor collection point, excluding collection points located in industrial developments that are greater than 100 feet from residentially zoned property. 5. Enclosures for outdoor collection points and buildings used primarily to contain a collection point shall have gate openings at least 12 feet wide for haulers. In addition, the gate opening for any building or other roofed structure used primarily as a collection point shall have a vertical clearance of at least 12 feet. 6. Weather protection of recyclables shall be ensured by using weather-proof containers or by providing a roof over the storage area.E. Only recyclable materials generated on-site shall be collected and stored at such collection points. Except for initial sorting of recyclables by users, all other processing of such materials shall be conducted off-site.F. The director may waive or modify specific storage space and collection point requirements set forth in this section if the director finds, in writing, that an alternate recycling program design proposed by the applicant meets the needs of the development and provides an equivalent or better level of storage and collection for recyclables. (Ord. 12461 § 1, 1996: Ord. 10870 § 381, 1993).21A.14.220 Fences. Fences are permitted as follows:A. Fences exceeding a height of six feet shall comply with the applicable street and interior setbacks of the zone in which the property is located, except: 1. Fences located on a rockery, retaining wall, or berm within a required setback area are permitted subject to the following requirements; a. In R-1 through R-18, UR, RA and the resource zones: (1) The total height of the fence and the rockery, retaining wall or berm upon which the fence is located shall not exceed a height of ten feet. This height shall be measured from the top of the fence to the ground on the low side of the rockery, retaining wall or berm; and (2) The total height of the fence itself, measured from the top of the fence to the top of the rockery, retaining wall or berm, shall not exceed six feet. b. In the R-24, R-48 and commercial/industrial zones, the height of the fence, measured from the top of the fence to the top of the rockery, retaining wall or berm, shall not exceed six feet. c. Any portion of the fence above a height of eight feet, measured to include both the fence and the rockery, retaining wall, or berm (as described in a1. above), shall be an open-work fence. d. The height limitation of this subsection may be exceeded where walls with fences cross a setback perpendicularly or abut a critical area tract established under K.C.C. chapter 21A.24.B. Fences located on a rockery, retaining wall or berm outside required setback areas shall not exceed the building height for the zone, measured in accordance with the standards established in the King County Building Code, Title 16.C. Electric fences shall: 1. Be permitted in all zones, provided that when placed within R-4 through R-48 zones, additional fencing or other barriers shall be constructed to prevent inadvertent contact with the electric fence from abutting property; 2. Comply with the following requirements: a. An electric fence using an interrupted flow of current at intervals of about one second on and two seconds off shall be limited to 2,000 volts at 17 milliamp; b. An electric fence using continuous current shall be limited to 1,500 volts at seven milliamp; c. All electric fences in the R-4 through R-48 zones shall be posted with permanent signs a minimum of 36 square inches in area at 50 foot intervals stating that the fence is electrified; and d. Electric fences sold as a complete and assembled unit can be installed by an owner if the controlling elements of the installation are certified by an A.N.S.I. approved testing agency; andD. Except as specifically required for the necessary security related to a nonresidential use, no barbed or razor-wire fence shall be located in any R-4 through R-48 zone. (Ord. 16267 § 32, 2008: Ord. 12987 § 5, 1998: Ord. 11621 § 50, 1994: 10870 § 382, 1993).21A.14.225 Hazardous liquid and gas transmission pipelines.A. Tracts and easements containing hazardous liquid and gas transmission pipelines and required setbacks from such pipelines may include the following uses, subject to other regulations applicable to each use and approval of the holder of the easement: utility structures not normally occupied necessary for the operation of the pipeline, landscaping, trails, open space, keeping of animals, agriculture, forestry, commercial signage, minor communication facilities and the utility structures not normally occupied necessary for the operation of the minor communication facility, and other compatible uses as specified on the face of the recorded plat or short plat; provided that structures designed for human occupancy shall never be allowed within pipeline tracts, easements or setbacks.B. Hazardous liquid and gas transmission pipelines shall not be located in aquifer recharge areas, landslide hazard areas or erosion hazard areas. When it is impractical to avoid such areas, special engineering precautions should be taken to protect public health, safety and welfare. (Ord. 14045 § 30, 2001).21A.14.230 Trail corridors - Applicability. Trail easements shall be provided by any development, except for single detached residential permits, when such developments are located within any community or regional trail corridor identified by an adopted King County Functional Plan or Community Plan identifying community and/or regional trail systems. The residents or tenants of the development shall be provided access to the trail easement. The area of the trail easement shall be counted as part of the site for purposes of density and floor area calculations. (Ord. 10870 § 383, 1993).21A.14.240 Trail corridors - Design standards. Trail design shall be reviewed by the department for consistency with adopted standards for:A. Width of the trail corridor;B. Location of the trail corridor on the site;C. Surfacing improvements; andD. Use(s) permitted within the corridor. (Ord. 17420 § 100, 2012: Ord. 11621 § 51, 1994: Ord. 10870 § 384, 1993).21A.14.250 Trail corridors - Maintenance of trail corridors/improvements. Maintenance of any trail corridor or improvements, retained in private ownership, shall be the responsibility of the owner or other separate entity capable of long-term maintenance and operation in a manner acceptable to the parks division. (Ord. 10870 § 385, 1993).21A.14.280 Rural industry development standards.A. The purpose of the rural industries section is to establish standards for industrial (I) zoned development in rural areas. Site and building designs, buffering, compatible commercial and industrial uses are required to maintain rural character.B. The following development standards shall apply to uses locating in the industrial (I) zone within the rural area; 1. All uses occurring outside an enclosed building shall be screened from adjoining rural residential uses; 2. All buildings shall be set back fifty-feet from perimeter streets and from rural area and residential zones; 3. The total permitted floor area\lot area ratio shall not exceed one hundred percent for a development consisting of multiple lots and one hundred twenty-five percent on any individual building lot; 4. The total permitted impervious lot coverage shall not exceed seventy percent for a development consisting of multiple lots and eighty percent on any individual building lot; 5. The landscaping standards in K.C.C. chapter 21A.16 are modified as follows: a. Twenty-foot-wide Type II landscaping shall be provided along exterior streets, b. Twenty-foot-wide Type I landscaping shall be provided along property lines adjacent to rural residential zoned areas; and c. Fifteen-foot-wide Type II landscaping shall be provided along lines adjacent to nonresidential zoned areas. 6. Outdoor lighting shall be focused downward and configured to minimize intrusion of light into surrounding rural residential areas; 7. Refuse collection/recycling areas and loading or delivery areas shall be located at least one hundred feet from rural area and residential zones and screened with a solid view obscuring barrier; 8. Off street parking standards shall be no less than one space for every one thousand square feet of floor area and no greater than one space for every five hundred square feet of floor area; 9. Sign are allowed as follows: a. Signs shall not exceed an area of sixty-four square feet per sign; b. Pole signs shall not be permitted; and c. Signs shall not be internally illuminated; 10. The director shall approve building design, materials and color. Buildings shall be designed and use accent materials (e.g. wood and brick), nonreflective glass, and muted colors to be compatible with rural character; and 11. Building height shall be limited to forty feet. (Ord. 17539 § 38, 2013: Ord. 11621 § 99, 1994).21A.14.300 Short subdivisions or short subdivision alterations -- adequacy of access – right of way use permits.A. Each lot within the short subdivision or short subdivision alteration shall have acceptable access to a street conforming to county road standards or to a lower level of improvement acceptable to the road engineer. Individual lots may be served by access panhandles established either by fee ownership or easement, subject to approval of the division. In order to assure safe and adequate access, the manager: 1. May approve private streets, provided the private street requirements contained in Section 2.05, Private Streets, of the county road standards as adopted in K.C.C. chapter 14.42 are met; 2. May limit direct access to certain streets and require on-site public or private streets in lieu of individual driveways or access panhandles, in accordance with the county road standards; 3. Shall require off-site improvements to public or private streets needed to provide access from the short subdivision to a road acceptable to the road engineer; and 4. Shall assure that the number of lots to be served by the road system complies with the road standards.B. Short subdivisions involving construction within county right-of-way shall obtain a right-of-way use permit pursuant to K.C.C. chapter 14.28. (Ord. 13694 § 87, 1999).Reviser's note: Definitions, Ordinance 13694: See K.C.C. chapter 19A.04.21A.14.310 Proposed formal subdivisions, short subdivisions or binding site plans – railroad buffer strips. Where railroads abut proposed formal subdivisions, short subdivisions or binding site plans, measures to provide a physical separation between the two uses shall be required. These measures may include the use: grade separations, setbacks or barriers such as walls and fences. (Ord. 13694 § 88, 1999).Reviser's note: Definitions, Ordinance 13694: See K.C.C. chapter 19A.04.21A.14.320 Preliminary subdivision and short subdivision approval – maintenance of private streets, easements and utilities required. As a condition of preliminary subdivision and short subdivision approval, all private streets, easements, community utilities and properties shall be maintained by the owners of the property served by them and kept in good repair at all times. In order to insure continued good repair, it must be demonstrated to the department prior to plat recording that:A. There is a workable organization to guarantee maintenance with a committee or group to administer the organizational functions; andB. There is a means for assessing maintenance costs equitably to property owners served by the private streets, easements, community utilities and properties. (Ord. 13694 § 89, 1999).Reviser's note: Definitions, Ordinance 13694: See K.C.C. chapter 19A.04.21A.14.330 Preliminary subdivision and short subdivision approval – covenants relating to keeping livestock in the RA zone. In the RA zone, all subdivisions and short subdivisions shall be recorded with a condition prohibiting any covenant that would preclude the keeping of horses or other large livestock. (Ord. 14045 § 43, 2001).21A.14.350 Rural equestrian community trail preservation – purpose. The purposes of the rural equestrian community trail protection and improvement requirements set forth in this chapter are to promote the preservation of equestrian communities in King County as a valuable element of rural character and lifestyle. King County intends to accomplish these purposes in a flexible manner that provides incentives to and minimizes costs to private property owners, provides protection from liability for property owners with trails on their property, and does not reduce permitted residential densities in subdivisions and short subdivisions. (Ord. 14045 § 36, 2001).21A.14.360 Rural equestrian community trails – general applicability. The county may accept the voluntary grant of an easement for a rural equestrian community trail consistent with K.C.C. 21A.14.350 through 21A.14.390 from any development when the development contains a rural equestrian community trail. The residents or tenants of the development shall be provided access to any such trail for use consistent with the function of the trail. The area of a trail provided under this section shall be counted as part of the site for purposes of density and floor area calculations. The application of this section shall not reduce the allowed density within a residential subdivision or short subdivision. The county may also accept the voluntary grant of an easement for a rural equestrian community trail consistent with K.C.C. 21A.14.350 through 21A.14.390 when there is no development proposed for the property. (Ord. 17841 § 35, 2014: Ord. 16267 § 75, 2008: Ord. 14259 § 9, 2001: Ord. 14045 § 37, 2001).21A.14.365 Rural equestrian community trails - notification.A. The department shall notify every applicant for a plat, short plat, boundary line adjustment, clearing and grading permit, conditional use permit, building permit for new construction or additions to existing structures, or zone reclassification in the RA, A or F zones on the opportunity to voluntarily grant an easement for a rural equestrian community trail in accordance with Ordinance 14259.B. The department shall notify the department of natural resources and parks of every application for a plat, short plat, boundary line adjustment, clearing and grading permit, conditional use permit, building permit for new construction or additions to existing structures, or zone reclassification in the RA, A or F zones. (Ord. 16267 § 76, 2008: Ord. 14259 § 10, 2001).21A.14.370 Rural equestrian community trails – authority. The department of natural resources and parks may accept a grant of easement for the preservation or relocation of a rural equestrian community trail as follows:A. The department of natural resources and parks makes a determination in writing that: 1. The rural equestrian community trail is listed or mapped on an inventory of equestrian community trails maintained by the department of natural resources and parks. The department of natural resources and parks shall field verify the presence of a trail where an inventory indicates the general location of a trail that has not yet been field verified; 2. The rural equestrian community trail connects to a state, county or other trail open to the public; 3. The rural equestrian community trail, following a site inspection by the department of natural resources and parks, is reasonably fit for use as a rural equestrian community trail; 4. A rural equestrian community trail that traverses or impacts an environmentally sensitive area can be modified to meet code requirements for trails in critical areas; and 5. Permanent protection or relocation of a rural equestrian community trail can be accomplished without interference with allowed uses and development of the subject property, and the site can be developed without interference with the trail and allows for future owners of the property to access historically existing or public trails in the vicinity of the site; orB. If the rural equestrian community trail is proposed to be granted as part of a mitigation package for a development proposal, the department of local services, permitting division: 1. Determines that permanent protection or relocation of the rural equestrian community trail can be accomplished without interference with the proposed use and development of the subject property; 2. Determines that the site can be developed without interference with the trail and in a manner that allows future owners of the property to access historically existing or public trails in the vicinity that are linked to the subject site; and 3. Reports its findings in writing to the department of natural resources and parks. (Ord. 18791 § 169, 2018: Ord. 17841 § 36, 2014: Ord. 17420 § 101, 2012: Ord. 16267 § 77, 2008: Ord. 14259 § 11, 2001: Ord. 14045 § 38, 2001).21A.14.380 Rural equestrian community trails – location and design standards. The following design standards apply to rural equestrian community trails:A. An on-site rural equestrian community trail should be retained at its existing location unless that location impairs the use of the property as intended by the applicant. A rural equestrian community trail retained in the existing location shall not require any upgrades or improvements, except for maintenance required by this section. The trail may be relocated to a location within the street right-of-way or to another corridor separate from a street right-of-way, provided that whatever alternative is used preserves the same connections as the original trail to an existing public park or trail in the vicinity of the subject property. The preferred place for a relocated trail is out of the right-of-way or separated from the paved surface and road shoulder by a berm, ditch or other separation. Trails may only be relocated to a street right-of-way when meeting the standards in subsection E. of this section. A tax credit under the Public Benefit Rating System may only be given for trails relocated off the road right-of-way. The trail location shall be preserved by appropriate easements or dedications.B. Corridors for trails located outside a street right-of-way shall be ten feet wide, or six feet wide if the trail will be located along a property line and additional corridor space can reasonably be expected to be preserved on the abutting property and the corridor is not encumbered by any structures adjacent to the corridor.C. If permitted by K.C.C. chapter 21A.24, an existing or relocated rural equestrian community trail may be located in a designated critical area buffer.D. Rural equestrian community trails that are not located within street rights-of-way, should be natural, visually and functionally unobtrusive, and as low-impact as possible.E. Relocated or new rural equestrian community trails within public or private road rights-of-way shall be designed consistent with adopted King County Road Standards, KCRS Section 3.11, as supplemented by the following standards: 1. The trail shall be located to provide access to a local equestrian travel corridor through the project site and adjacent properties, as determined by the King County department of local services in cooperation with the local equestrian community; 2. The preferred design is a trail separated from the paved roadway by a berm, ditch, tree cover or other natural obstacle; the center of the trail tread shall be at least eight feet of horizontal distance from the paved roadway edge; 3. When a separated trail cannot be provided, a soft-surfaced ninety-six inch-wide roadway shoulder path shall be installed on all roads other than local access streets, where a forty-eight inches shoulder path shall be sufficient; 4. All trails shall have an all-weather tread of thirty-six to forty-eight inches; 5. The roadway shall include appropriate surface treatment to reduce slippage at roadway and trail crossings; and 6. Appropriate signs shall be provided to indicate the location of street crossings for trails, with emphasis on arterials and subcollector street.F. Relocated or new rural equestrian community trails not located in a right-of-way shall be designed to the King County Road Standards, KCRS Section 3.11.A.2. (Ord. 18791 § 170, 2018: Ord. 17841 § 37, 2014: Ord. 16267 § 78, 2008: Ord. 14259 § 12, 2001: Ord. 14045 § 39, 2001).21A.14.390 Rural equestrian community trails - maintenance and operation.A. Once a trail easement has been granted to the county as provided by this chapter, it shall remain free from structural obstructions or other permanent or temporary obstacles. A rural equestrian community trail shall be open to the public for recreational use by equestrians and pedestrians. Equestrian and pedestrian use does not include use by motor vehicles, bicycles, roller skates, skateboards or other mechanized modes of transportation. However, the department of natural resources and parks may authorize use by motor vehicles in limited circumstances, such as for maintenance, emergencies or trail crossings.B. The trail easement shall set forth the responsibility for trail maintenance. Trails within dedicated street rights-of-way shall be maintained by the department of local services or its successor. Trails within easements granted to King County shall be maintained by the department of natural resources and parks. The county may contract with a local user group or parks district for maintenance of the trail.C. Trails established under this section are subject to the rules and enforcement measures for use of facilities for King County parks in K.C.C. chapter 7.12.D. An easement governing the use and operation of a rural equestrian community trail being granted under Ordinance 14259 shall be granted by the property owner to the county. In preparing the easement, the department of natural resources and parks is authorized to negotiate the terms of the easement on matters such as the allowed use of the easement, whether the easement includes indemnification requirements, the maintenance of the easement, the relocation of the easement, and whether the easement is permanent or for a term of years, depending on the value of the property as a rural equestrian community trail. The easement shall be consistent with Ordinance 14259. (Ord. 18791 § 171, 2018: Ord. 14259 § 13, 2001: Ord. 14045 § 40, 2001).21A.16DEVELOPMENT STANDARDS - LANDSCAPING AND WATER USESections:21A.16.010Purpose.21A.16.020Application.21A.16.030Land use grouping.21A.16.040Landscaping - screen types and description.21A.16.050Landscaping - street frontages.21A.16.060Landscaping - interior lot lines.21A.16.070Landscaping - surface parking areas.21A.16.080Landscaping - adjacent to freeway rights-of-way.21A.16.085Landscaping - general standards for all landscape areas.21A.16.090Landscaping - additional standards for required landscape areas.21A.16.100Landscaping - alternative options.21A.16.115Landscaping - plan design, design review, and installation.21A.16.125Lighting – limitation of direction in residential areas.21A.16.180Maintenance.21A.16.190Financial guarantees.21A.16.330Water use - Irrigation efficiency goals and system design standards.21A.16.340Water use - Irrigation system design, design review and audit at installation.21A.16.350Water use - Irrigation design plan contents.21A.16.370Water use - Irrigation system maintenance.21A.16.010 Purpose. The purpose of this chapter is to preserve the aesthetic character of communities; to improve the aesthetic quality of the built environment; to promote retention and protection of existing vegetation; to promote water efficiency; to promote native wildlife; to reduce the impacts of development on drainage systems and natural habitats; and to increase privacy for rural area and residential zones by:A. Providing visual relief from large expanses of parking areas and reduction of perceived building scale;B. Providing physical separation between rural area or residential zones and nonresidential zones;C. Providing visual screens and barriers as a transition between differing land uses;D. Retaining existing vegetation and significant trees by incorporating them into the site design;E. Providing increased areas of permeable surfaces to allow for: 1. Infiltration of surface water into groundwater resources; 2. Reduction in the quantity of storm water discharge; and 3. Improvement in the quality of storm water discharge;F. Encouraging the use of native plant species by their retention or use in the landscape design;G. Requiring water use efficiency through water budgeting and efficient irrigation design standards;H. Encouraging the use of a diversity of plant species that promote native wildlife habitat. (Ord. 17539 § 39, 2013: Ord. 11210 § 1, 1994: Ord. 10870 § 386, 1993).21A.16.020 Application. Except for communication facilities regulated pursuant to K.C.C. 21A.26, all new development listed in K.C.C. 21A.16.030 shall be subject to the landscaping provisions of this chapter, provided that specific landscaping and tree retention provisions for uses established through a conditional use permit, a special use permit, or an urban planned development application shall be determined during the applicable review process. (Ord. 11210 § 2, 1994: Ord. 10870 § 387, 1993).21A.16.030 Land use grouping. To facilitate the application of this chapter, the land uses of K.C.C. chapter 21A.08 have been grouped in the following manner:A. Residential development refers to those uses listed in K.C.C. 21A.08.030, except those uses listed under Accessory uses, and: 1. Attached/group residences refers to: a. townhouses, except as provided in subsection A.2.a. of this section; b. apartments and detached dwelling units developed on common property at a density of twelve or more units per acre; c. senior citizen assisted housing; d. temporary lodging; e. group residences other than Type I community residential facilities; f. mobile home parks; and 2. Single-family development refers to: a. residential subdivisions and short subdivisions, including attached and detached dwelling units on individually platted or short platted lots; b. any detached dwelling units located on a lot including cottage housing units; and c. Type I community residential facilities;B. Commercial development refers to those uses in: 1. K.C.C. 21A.08.040 as amusement/entertainment uses, except golf facilities; 2. K.C.C. 21A.08.050 except recycling centers, health and educational services, daycare I, churches, synagogues and temples, and miscellaneous repair as allowed in the A and RA zones; and 3. K.C.C. 21A.08.070, except forest product sales and agricultural product sales as allowed in the A, F, and RA zones and building, hardware, and garden materials as allowed in the A zones;C. Industrial development refers to those uses listed in: 1. K.C.C. 21A.08.050 as recycling center; 2. K.C.C. 21A.08.060, except government services and farm product warehousing, refrigeration, and storage as allowed in the A zones; 3. K.C.C. 21A.08.080, except food and kindred products as allowed in the A and F zones; and 4. K.C.C. 21A.08.090 as mineral extraction and processing;D. Institutional development refers to those uses listed in: 1. K.C.C. 21A.08.040 as cultural uses, except arboretums; 2. K.C.C. 21A.08.050 as churches, synagogues, and temples, health services, and education services except specialized instruction schools permitted as an accessory use; 3. K.C.C. 21A.08.060 as government services; and 4. Search and rescue facilities;E. Utility development refers to those uses listed in: 1. K.C.C. 21A.08.060 as utility facilities; and 2. K.C.C. 21A.08.100 as battery energy storage systems, except those defined as accessory uses under K.C.C. 21A.06.015, 21A.06.020, or 21A.06.025; andF. Uses in K.C.C. chapter 21A.08 that are not listed in subsections A. through E. of this section shall not be subject to landscaping and tree retention requirements except as specified in any applicable review of a conditional use or special use permits, or reviews conducted in accordance with K.C.C. 21A.42.300. (Ord. 19824 § 13, 2024: Ord. 19331 § 5, 2021: 18626 § 17, 2017: Ord. 15032 § 21, 2004: Ord. 14045 § 44, 2001: Ord. 11621 § 54, 1994: Ord. 11354 § 1, 1994: Ord. 11210 § 3, 1994: Ord. 10870 § 388, 1993).21A.16.040 Landscaping - screen types and description. The three types of landscaping screens are described and applied as follows:A. Type I landscaping screen: 1. Type I landscaping is a "full screen" that functions as a visual barrier. This landscaping is typically found adjacent to freeways and between residential and non-residential areas. 2. Type I landscaping shall minimally consist of: a. A mix of primarily evergreen trees and shrubs generally interspersed throughout the landscape strip and spaced to form a continuous screen; b. Between 70 and 90 percent evergreen trees; c. Trees provided at the rate of one per 10 linear feet of landscape strip and spaced no more than 30 feet apart on center; d. Evergreen shrubs provided at the rate of one per linear four feet of landscape strip and spaced no more than 8 feet apart on center; and e. Ground cover pursuant to K.C.C. 21A.16.090; B. Type II landscaping screen: 1. Type II landscaping is a "filtered screen" that functions as a visual separator. This landscaping is typically found between commercial and industrial uses; between differing types of residential development; and to screen industrial uses from the street; 2. Type II landscaping shall minimally consist of: a. A mix of evergreen and deciduous trees and shrubs generally interspersed throughout the landscape strip spaced to create a filtered screen; b. At least 50 percent deciduous trees and at least 30 percent evergreen trees; c. Trees provided at the rate of one per 20 linear feet of landscape strip and spaced no more than 30 feet apart on center; d. Shrubs provided at the rate of one per four linear feet of landscape strip and spaced no more than eight feet apart on center; and e. Ground cover pursuant to K.C.C. 21A.16.090;C. Type III landscaping screen: 1. Type III landscaping is a "see-through screen" that functions as a partial visual separator to soften the appearance of parking areas and building elevations. This landscaping is typically found along street frontage or between apartment developments; 2. Type III landscaping shall minimally consist of: a. A mix of evergreen and deciduous trees generally interspersed throughout the landscape strip and spaced to create a continuous canopy; b. At least 70 percent deciduous trees; c. Trees provided at the rate of one per linear 25 feet of landscape strip and spaced no more than 30 feet apart on center; d. Shrubs provided at the rate of one per four linear feet of landscape strip and spaced no more than 8 feet apart on center; and e. Ground cover pursuant to K.C.C. 21A.16.090. (Ord. 11621 § 55, 1994: Ord. 11210 § 4, 1994: Ord. 10870 § 389, 1993).21A.16.050 Landscaping - street frontages. The average width of perimeter landscaping along street frontages shall be provided as follows: A. Twenty feet of Type II landscaping shall be provided for an institutional use, excluding playgrounds and playfields; B. Ten feet of Type II landscaping shall be provided for an industrial development;C. Ten feet of Type II landscaping shall be provided for an above-ground utility development, excluding distribution and transmission corridors, located outside a public right-of-way;D. Ten feet of Type III landscaping shall be provided for a commercial or attached/group residence development; and E. For single family subdivisions and short subdivisions in the urban growth area: 1. Trees shall be planted at the rate of one tree for every forty feet of frontage along all public streets; 2. The trees shall be: a. Located within the street right-of-way if permitted by the custodial state or local agency; b. No more than twenty feet from the street right-of-way line if located within a lot; c. Maintained by the adjacent landowner unless part of a county maintenance program; and d. A species approved by the county if located within the street right-of way and compatible with overhead utility lines. 3. The trees may be spaced at irregular intervals to accommodate sight distance requirements for driveways and intersections. (Ord. 19824 § 14, 2024: Ord. 16267 § 33, 2008: Ord. 14045 § 45, 2001: Ord. 11621 § 56, 1994: Ord. 11210 § 5, 1994: Ord. 10870 § 390, 1993).21A.16.060 Landscaping - interior lot lines. The average width of perimeter landscaping along interior lot lines shall be provided as follows:A. Twenty feet of Type I landscaping shall be included in a commercial or industrial development along any portion adjacent to a residential development;B. Five feet of Type II landscaping shall be included in an attached/group residence development, except that along portions of the development adjacent to property developed with single detached residences or vacant property that is zoned RA, UR or R(1-8), the requirement shall be ten feet of Type II landscaping;C. Ten feet of Type II landscaping shall be included in an industrial development along any portion adjacent to a commercial or institutional development; andD. Ten feet of Type II landscaping shall be included in: 1. An institutional use, excluding playgrounds and playfields; or 2. An above-ground utility development, excluding distribution or transmission corridors, when located outside a public right-of-way. (Ord. 19824 § 15, 2024: Ord. 11939 § 1, 1995: Ord. 11210 § 6, 1994: Ord. 10870 § 391, 1993).21A.16.070 Landscaping - surface parking areas. Parking area landscaping shall be provided within surface parking areas with ten or more parking stalls for the purpose of improving air quality, reducing surface water runoff, providing shade and diminishing the visual impacts of large paved areas as follows:A. Residential developments with common parking areas shall provide planting areas at the rate of twenty square feet per parking stall;B. Commercial, industrial or institutional developments shall provide landscaping at a rate of: 1. Twenty square feet per parking stall if ten to thirty parking stalls are provided; and 2. Twenty-five square feet per parking stall if thirty-one or more parking stalls are provided;C. Trees shall be provided and distributed throughout the parking area at a rate of: 1. One tree for every three parking stalls for a commercial or industrial development; and 2. One tree for every five parking stalls for residential or institutional development;D. The maximum distance between any parking stall and landscaping shall be no more than one hundred feet;E. Permanent curbs or structural barriers shall be provided to protect the plantings from vehicle overhang; F. Landscaping around the perimeter of a site that is in addition to the perimeter landscaping required by K.C.C. 21A.16.050 may count toward ten percent of the required surface parking area landscaping if it is adjacent to the parking area; andG. Parking area landscaping shall consist of: 1. Canopy-type deciduous trees, evergreen trees, evergreen shrubs and ground covers planted in islands or strips; 2. Shrubs that do not exceed a maintained height of forty-two inches; 3. Plantings contained in planting islands or strips having an area of at least one hundred square feet and with a narrow dimension of no less than five feet; 4. Ground cover in accordance with K.C.C. 21A.16.090; and 5. At least seventy percent of trees are deciduous. (Ord. 14045 § 46, 2001: Ord. 11210 § 7, 1994: Ord. 10870 § 392, 1993).21A.16.080 Landscaping - adjacent to freeway rights-of-way.A. All residential developments shall provide a minimum average width of 20 feet of Type I landscaping adjacent to freeway rights-of-way. B. All other developments shall provide a minimum average width of 20 feet of Type III landscaping adjacent to freeway rights-of-way. (Ord. 11210 § 8, 1994: Ord. 10870 § 393, 1993).21A.16.085 Landscaping - general standards for all landscape areas. All new landscape areas proposed for a development shall be subject to the following provisions:A. Berms shall not exceed a slope of two horizontal feet to one vertical foot (2:1).B. All new turf areas, except all-weather, sand-based athletic fields shall: 1. Be augmented with a two-inch layer of organic material cultivated a minimum of six inches deep; or 2. Have an organic content of five percent or more to a depth of six inches as shown in a soil sample analysis. The soil analysis shall include: a. determination of soil texture, indicating percentage of organic matter, b. an approximated soil infiltration rate either measured or derived from soil/texture/infiltration rate tables. A range of infiltration rates shall be noted where appropriate; and c. measure pH value.C. Except as specifically outlined for turf areas in subsection B. of this section, the organic content of soils in any landscape area shall be as necessary to provide adequate nutrient and moisture-retention levels for the establishment of plantings.D. Landscape areas, except turf or areas of established groundcover, shall be covered with at least two inches of mulch to minimize evaporation. E. Plants having similar water use characteristics shall be grouped together in distinct hydrozones.F. Plants selected shall be natives, or other plants adapted to the climatic, geologic and topographical conditions of the site. Preservation of existing noninvasive vegetation is encouraged.G. Landscape areas are authorized to be used for bioretention, as long as the landscape areas meet the bioretention design standards of the Surface Water Design Manual, including soil mix and plant selection, and also meet the standards of this chapter for types of plants used and their spacing and density. (Ord. 18257 § 22, 2016: Ord. 11210 § 9, 1994).21A.16.090 Landscaping - additional standards for required landscape areas. In addition to the general standards of K.C.C. 21A.16.085, landscape areas required pursuant to K.C.C. 21A.16.050 through .080 shall conform to the following standards:A. All plants shall conform to American Association of Nurserymen (AAN) grades and standards as published in the "American Standard for Nursery Stock" manual, provided that existing healthy vegetation used to augment new plantings shall not be required to meet the standards of this manual;B. Single-stemmed trees required pursuant to this chapter shall at the time of planting conform to the following standards: 1. In parking area landscaping and in street rights-of-way: a. Deciduous trees shall have a minimum caliper of 1.75 inches and a height of 10 feet, and b. Coniferous and broadleaf evergreens shall be at least five feet in height; 2. In all other required landscape areas: a. Deciduous trees shall have a minimum caliper of 1.5 inches and a height of ten feet, and b. Coniferous and broadleaf evergreen trees shall be at least five feet in height.C. Multiple-stemmed trees shall be permitted as an option to single-stemmed trees provided that such multiple-stemmed trees are: 1. At least six feet in height, and 2. Not allowed within street rights-of-way;D. When the width of any landscape strip is 20 feet or greater, the required trees shall be staggered in two or more rows;E. Shrubs shall be: 1. At least an AAN container class #2 size at time of planting in Type II, III and parking area landscaping, 2. At least 24 inches in height at the time of planting for Type I landscaping, and 3. Maintained at a height not exceeding 42 inches when located in Type III or parking area landscaping; F. Ground covers shall be planted and spaced to result in total coverage of the majority of the required landscape area within three years.G. All fences shall be placed on the inward side of any required perimeter landscaping along the street frontage.H. Required street landscaping may be placed within King County street rights-of-way subject to the County Road Design Standards, provided adequate space is maintained along the street line to replant the required landscaping should subsequent street improvements require the removal of landscaping within the rights-of-way;I. Required street landscaping may be placed within Washington State rights-of-way subject to permission of the Washington State Department of Transportation.J. New landscape material provided within areas of undisturbed vegetation or within the protected area of significant trees shall give preference to utilizing indigenous plant species. (Ord. 11621 § 57, 1994: 11210 § 10, 1994: Ord. 10870 § 394, 1993).21A.16.100 Landscaping - alternative options. The following alternative landscape options may be allowed, subject to county approval, only if they accomplish equal or better levels of screening, or when existing conditions on or adjacent to the site, such as significant topographic differences, vegetation, structures or utilities would render application of this chapter ineffective or result in scenic view obstruction:A. The amount of required landscape area may be reduced to ensure that the total area for required landscaping, and/or the area remaining undisturbed for the purpose of wildlife habitat or corridors does not exceed 15 percent of the net developable area of the site. For the purpose of this subsection, the net developable area of the site shall not include areas deemed unbuildable due to their location within sensitive areas and any associated buffers.B. The average width of the perimeter landscape strip may be reduced up to 25 percent along any portion where: 1. Berms at least three feet in height or architectural barriers at least six feet in height are incorporated into the landscape design; or 2. The landscape materials are incorporated elsewhere on-site;C. In pedestrian district overlays, street perimeter landscaping may be waived provided a site plan, consistent with the applicable adopted area zoning document, is approved that provides street trees and other pedestrian-related amenities;D. Landscaping standards for uses located in a rural town or rural business centers designated by the comprehensive plan may be waived or modified by the director if deemed necessary to maintain the historic character of the area. Where a local or subarea plan with design guidelines has been adopted, the director shall base the landscaping modifications on the policies and guidelines of such plan.E. When an existing structure precludes installation of the total amount of required site perimeter landscaping, such landscaping material shall be incorporated on another portion of the site.F. Single-stemmed deciduous tree species that cannot generally be planted and established in larger sizes may have a caliper of less than 1.5 inches; andG. The number of trees and shrubs to be provided in required perimeter and parking area landscaping may be reduced up to 25 percent when a development uses landscaping materials consisting of species typically associated with the Puget Sound Basin in the following proportions: 1. Seventy-five percent of groundcover and shrubs, and 2. Fifty percent of trees.H. The department shall, pursuant to K.C.C. 2.98, develop and maintain an advisory listing of trees recommended for new plantings. Such list shall describe their general characteristics and suitability, and provide guidelines for their inclusion within required landscape areas. (Ord. 11621 § 58, 1994: Ord. 11255 § 3, 1994: Ord. 11210 § 11, 1994: Ord. 10870 § 395, 1993).21A.16.115 Landscaping - plan design, design review, and installation.A. The landscape plan submitted to the department shall be drawn on the same base map as the development plans and shall identify the following: 1. total landscape area and separate hydrozones; 2. Landscape materials botanical/common name and applicable size; 3. Property lines; 4. Impervious surfaces; 5. natural or human-made water features or bodies; 6. Existing or proposed structures, fences, and retaining walls; 7. Natural features or vegetation left in natural state; and 8. Designated recreational open space areas.B. The proposed landscape plan shall be certified by a Washington state licensed landscape architect.C. An affidavit signed by an individual specified in subsection B. [of this section], certifying that the landscaping has been installed in compliance with the approved landscaping plan, shall be submitted to the department within thirty days of installation completion, unless the installed landscaping has been inspected and accepted by the department. D. The required landscaping shall be installed no later than three months after issuance of a certificate of occupancy for the project or project phase. However, the time limit for compliance may be extended to allow installation of such required landscaping during the next appropriate planting season. A financial guarantee shall be required before issuance of the certificate of occupancy, if landscaping is not installed and inspected before occupancy. (Ord. 18683 § 53, 2018: Ord. 17539 § 40, 2013: Ord. 11939 § 2, 1995: Ord. 11210 § 12, 1994).21A.16.125 Lighting – limitation of direction in residential areas. All exterior lighting fixtures within the R1-8 zones shall be installed and maintained so as not to cause light from the fixture to be directed toward windows or buildings on adjacent or nearby residential properties (Ord. 19282 § 2, 2021).21A.16.180 Maintenance.A. All landscaping shall be maintained for the life of the project.B. All landscape materials shall be pruned and trimmed as necessary to maintain a healthy growing condition or to prevent primary limb failure;C. With the exception of dead, diseased or damaged trees specifically retained to provide wildlife habitat; other dead, diseased, damaged or stolen plantings shall be replaced within three months or during the next planting season if the loss does not occur in a planting season; andD. Landscape areas shall be kept free of trash. (Ord. 11255 § 2, 1994: Ord. 10870 § 403, 1993).21A.16.190 Financial guarantees. Financial guarantees shall be required consistent with the provisions of Title 27A. This time period may be extended to one year by the director, if necessary to cover a planting and growing season. (Ord. 12020 § 52, 1995: Ord. 11210 § 13, 1994: Ord. 10870 § 404, 1993).21A.16.330 Water use - Irrigation efficiency goals and system design standards. For purposes of this section, irrigation shall include any means of applying water to landscaped areas. All irrigation is at the applicant’s option. Manually applied irrigation methods shall comply with subsections A. through C. of this section. Irrigation applied through installed irrigation systems shall comply with subsections A. through D. of this section.A. The applicant shall provide the following information: 1. Right-of-way use permit if required; 2. Identity of person or entity responsible for maintenance of the irrigation; and 3. Location of shut-off valves.B. Irrigation water shall be applied with goals of avoiding runoff, low head drainage, overspray or other similar conditions where water flows onto adjacent property, nonirrigated areas and impervious surfaces by: 1. Considering soil type and infiltration rates; 2. Using proper irrigation equipment and schedules, including features such as repeat cycles, to closely match application rates with infiltration rates; and 3. Considering special problems posed by irrigation on slopes and in median strips.C. All irrigation water outlets, except those using alternative water sources, shall be downstream of the meter used to measure irrigation water use.D. Irrigation systems shall be subject to the following additional provisions: 1. Systems shall not be located on any: a. turfgrass slopes exceeding a slope of three horizontal feet to one vertical foot (3:1); and b. turfgrass portions of median strips. 2. Systems in landscape strips less than five feet in width shall be designed to ensure that overspray and/or runoff does not occur by use of system design options such as low volume emitters. 3. Systems shall be designed to be consistent with the requirements of the hydrozone in which they are located. 4. Systems shall be designed with the minimum average irrigation efficiency of 0.625. 5. The use of automatic shutoff or override capabilities using rain shutoffs or moisture sensors is encouraged. 6. Systems shall utilize a central control valve connected to an automatic controller. 7. Systems shall make provisions for winterization either by providing: a. manual drains (automatic drain valves are not permitted at all low points), or b. means to blow out lines with pressurized air. 8. Separate valves shall be used to irrigate plants with differing water needs. 9. Sprinkler heads with consistent application rates shall be selected for proper area coverage, operating pressure, and adjustment capability. (Ord. 18683 § 54, 2018: Ord. 17191 § 38, 2011: Ord. 11210 § 17, 1994).21A.16.340 Water use - Irrigation system design, design review and audit at installation.A. Irrigation plan design shall be certified by an Irrigation Association (IA)-certified designer or a registered landscape architect or professional engineer with irrigation design experience.B. The irrigation system must be audited and accepted at installation by an IA-certified irrigation auditor. (Ord. 11210 § 18, 1994).21A.16.350 Water use - Irrigation design plan contents. Proposed irrigation system design plans shall be drawn on the same base project map as the landscape plan and shall identify:A. Location and size of any proposed separate water meters for the landscape;B. Location, type, and size of all components of the irrigation system;C. Static water pressure at the point of connection to the water supply; andD. Flow rate (gallons per minute), application rates (inches per hour), and design operating pressure (PSI) for each station. (Ord. 11210 § 19, 1994).21A.16.370 Water use - Irrigation system maintenance. Irrigation systems shall be maintained and inspected periodically to assure proper functioning. Replacement of components shall be of originally specified parts or materials, or their equivalents. (Ord. 11210 § 21, 1994).21A.18DEVELOPMENT STANDARDS - PARKING AND CIRCULATIONSections:21A.18.010Purpose.21A.18.020Authority and application.21A.18.030Computation of required off-street parking spaces.21A.18.040Shared parking requirements.21A.18.050Exceptions for community residential facilities (CRF) and senior citizen assisted housing.21A.18.060Parking for the disabled.21A.18.070Loading space requirements.21A.18.080Stacking spaces for drive-through facilities.21A.18.090Transit and rideshare provisions.21A.18.100Pedestrian and bicycle circulation and access.21A.18.110Off-street parking plan design standards.21A.18.120Off-street parking construction standards.21A.18.130Compact car allowance requirements.21A.18.140Internal circulation road standards.21A.18.150Electric-vehicle-charging infrastructure.21A.18.010 Purpose. The purpose of this chapter is to provide adequate parking for all uses allowed in this title; to reduce demand for parking by encouraging alternative means of transportation including public transit, rideshare and bicycles; and to increase pedestrian mobility in urban areas by:A. Setting minimum off street parking standards for different land uses that assure safe, convenient and adequately sized parking facilities within activity centers;B. Providing incentives to rideshare through preferred parking arrangements;C. Providing for parking and storage of bicycles;D. Providing safe direct pedestrian access from public rights-of-way to structures and between developments; andE. Requiring uses which attract large numbers of employees or customers to provide transit stops. (Ord. 10870 § 405, 1993).21A.18.020 Authority and application.A. Before an occupancy permit may be granted for any new or enlarged building or for a change of use in any existing building, the use shall be required to meet the requirements of this chapter. In addition, K.C.C. 21A.18.110 I. and J. establish residential parking limitations applicable to existing, as well as new, residential uses. B. If this chapter does not specify a parking requirement for a land use, the director shall establish the minimum requirement based on a study of anticipated parking demand. Transportation demand management actions taken at the site shall be considered in determining anticipated demand. If the site is located in an activity center or community business center, the minimum requirement shall be set at a level less than the anticipated demand, but at no less than seventy-five percent of the anticipated demand. In the study, the applicant shall provide sufficient information to demonstrate that the parking demand for a specific land use will be satisfied. Parking studies shall be prepared by a professional engineer with expertise in traffic and parking analyses, or an equally qualified individual as authorized by the director.C. If the required amount of off-street parking has been proposed to be provided off-site, the applicant shall provide written contracts with affected landowners showing that required off-street parking shall be provided in a manner consistent with this chapter. The contracts shall be reviewed by the director for compliance with this chapter, and if approved, the contracts shall be recorded with the records and licensing services division as a deed restriction on the title to all applicable properties. These deed restrictions may not be revoked or modified without authorization by the director.D. Upon request from the proponent of any use subject to the this chapter located in a rural town, rural neighborhood center, any commercial zone located in a rural area or natural resource production district designated by the Comprehensive Plan, or any agricultural product production, processing or sales use allowed in the A or F zones the director may waive or modify this chapter in order to protect or enhance the historic character of the area, to reduce the need for pavement or other impervious surfaces, to recognize the seasonal nature of any such activity or to minimize the conversion of agriculturally productive soils. Where a neighborhood or subarea plan with design guidelines that includes the subject property has been adopted, the director shall base allowable waivers or modifications on the policies and guidelines in such a plan. (Ord. 15971 § 96, 2007: Ord. 15032 § 22, 2004: Ord. 14309 § 9, 2002: Ord. 11621 § 59, 1994: Ord. 10870 § 406, 1993).21A.18.030 Computation of required off-street parking spaces.A. Except as modified in K.C.C. 21A.18.070.B. through D., off-street parking areas shall contain at a minimum the number of parking spaces as stipulated in the following table. Off-street parking ratios expressed as number of spaces per square feet means the usable or net square footage of floor area, exclusive of non-public areas. Non-public areas include but are not limited to building maintenance areas, storage areas, closets or restrooms. If the formula for determining the number of off-street parking spaces results in a fraction, the number of off-street parking spaces shall be rounded to the nearest whole number with fractions of 0.50 or greater rounding up and fractions below 0.50 rounding down.LAND USEMINIMUM PARKING SPACES REQUIREDRESIDENTIAL (K.C.C. 21A.08.030.A):Single detached/Townhouse2.0 per dwelling unitApartment:Studio units1.2 per dwelling unitOne bedroom units1.5 per dwelling unitTwo bedroom units1.7 per dwelling unitThree bedroom units or larger2.0 per dwelling unitMobile home park2.0 per dwelling unitSenior citizen assisted1 per 2 dwelling or sleeping unitsCommunity residential facilities1 per two bedroomsDormitory, including religious1 per two bedroomsHotel/Motel including organizational hotel/lodging1 per bedroomBed and breakfast guesthouse1 per guest room, plus 2 per facilityCottage housing1 per dwelling unitRECREATION/CULTURAL (K.C.C. 21A.08.040.A):Recreation/culture uses:1 per 300 square feetExceptions:Bowling center5 per laneGolf course3 per hole, plus 1 per 300 square feet of club house facilitiesTennis Club4 per tennis court plus 1 per 300 square feet of clubhouse facilityGolf driving range1 per teePark/playfield/paintball(director)Theater1 per 3 fixed seatsConference center1 per 3 fixed seats, plus 1 per 50 square feet used for assembly purposes without fixed seats, or 1 per bedroom, whichever results in the greater number of spaces.LAND USEMINIMUM PARKING SPACES REQUIREDGENERAL SERVICES (K.C.C. 21A.08.050.A): General services uses:1 per 300 square feetExceptions:Funeral home/Crematory1 per 50 square feet of chapel areaDaycare I2 per facilityDaycare II2 per facility, plus 1 space for each 20 childrenChurches, synagogue, temple1 per 5 fixed seats, plus 1 per 50 square feet of gross floor area without fixed seats used for assembly purposesOutpatient and Veterinaryclinic offices1 per 300 square feet of office, labs and examination roomsNursing and personal careFacilities1 per 4 bedsHospital1 per bedElementary schools1 per classroom, plus 1 per 50 studentsSecondary schoolsMiddle/junior high schools1 per classroom, plus 1 per 50 studentsHigh schools1 per classroom, plus 1 per 10 studentsHigh schools with stadiumsgreater of 1 per classroom plus 1 per 10 students, or 1 per 3 fixed seats in stadiumVocational schools1 per classroom, plus 1 per five studentsSpecialized instructionSchools1 per classroom, plus 1 per two studentsArtist Studios.9 per 1,000 square feet of area used for studiosGOVERNMENT/BUSINESS SERVICES (K.C.C. 21A.08.060.A):Government/business services uses:1 per 300 square feetExceptions:Public agency yard1 per 300 square feet of offices, plus 0.9 per 1,000 square feet of indoor storage or repair areasPublic agency archives0.9 per 1000 square feet of storage area, plus 1 per 50 square feet of waiting/reviewing areasCourts3 per courtroom, plus 1 per 50 square feet of fixed seat or assembly areasPolice facility(director)Fire facility(director)Construction and trade1 per 300 square feet of office, plus 1 per 3,000 square feet of storage areaWarehousing and storage1 per 300 square feet of office, plus 0.9 per 1,000 square feet of storage areaSelf-service storage1 per 3,500 square feet of storage area, plus 2 for any resident director's unitOutdoor advertising services1 per 300 square feet of office, plus 0.9 per 1,000 square feet of storage areaHeavy equipment repair1 per 300 square feet of office, plus 0.9 per 1,000 square feet of indoor repair areasOffice1 per 300 square feetLAND USEMINIMUM PARKING SPACES REQUIREDRETAIL/WHOLESALE (K.C.C. 21A.08.070.A):Retail trade uses:1 per 300 square feetExceptions:Food stores, less than15,000 square feet3 plus 1 per 350 square feetGasoline service stationsw/o grocery3 per facility, plus 1 per service bayGasoline service stationsw/grocery, no service bays1 per facility, plus 1 per 300 square feet of storeRestaurants1 per 75 square feet in dining or lounge areasRemote tasting rooms1 per 300 square feet of tasting and retail areasWholesale trade uses0.9 per 1000 square feetRetail and wholesale trade mixed use1 per 300 square feetMANUFACTURING (K.C.C. 21A.08.080.A): Manufacturing uses0.9 per 1,000 square feetWinery/Brewery/Distillery Facility II and III0.9 per 1,000 square feet, plus 1 per 300 square feet of tasting and retail areasRESOURCES (K.C.C. 21A.08.090.A):Resource uses(director)REGIONAL (K.C.C. 21A.08.100.A): Regional uses(director)B. An applicant may request a modification of the minimum required number of parking spaces by providing that parking demand can be met with a reduced parking requirement. In such cases, the director may approve a reduction of up to fifty percent of the minimum required number of spaces.C. When the county has received a shell building permit application, off-street parking requirements shall be based on the possible tenant improvements or uses authorized by the zoning classification and compatible with the limitations of the shell permit. When the range of possible uses result in different parking requirements, the director will establish the amount of parking based on a likely range of uses.D. Where other provisions of this code stipulate maximum parking allowed or reduced minimum parking requirements, those provisions shall apply.E. In any development required to provide six or more parking spaces, bicycle parking shall be provided. Bicycle parking shall be bike rack or locker-type parking facilities unless otherwise specified. 1. Off-street parking areas shall contain at least one bicycle parking space for every twelve spaces required for motor vehicles except as follows: a. The director may reduce bike rack parking facilities for patrons when it is demonstrated that bicycle activity will not occur at that location. b. The director may require additional spaces when it is determined that the use or its location will generate a high volume of bicycle activity. Such a determination will include but not be limited to the following uses: (1) Park/playfield, (2) Marina, (3) Library/museum/arboretum, (4) Elementary/secondary school, (5) Sports club, or (6) Retail business (when located along a developed bicycle trail or designated bicycle route). 2. Bicycle facilities for patrons shall be located within 100 feet of the building entrance and shall be designed to allow either a bicycle frame or wheels to be locked to a structure attached to the pavement. 3. All bicycle parking and storage shall be located in safe, visible areas that do not impede pedestrian or vehicle traffic flow, and shall be well lit for nighttime use. 4. When more than ten people are employed on site, enclosed locker-type parking facilities for employees shall be provided. The director shall allocate the required number of parking spaces between bike rack parking and enclosed locker-type parking facilities. 5. One indoor bicycle storage space shall be provided for every two dwelling units in townhouse and apartment residential uses, unless individual garages are provided for every unit. The director may reduce the number of bike rack parking spaces if indoor storage facilities are available to all residents. (Ord. 19146 § 51, 2020: Ord. 19030 § 20, 2019: Ord. 16267 § 34, 2008: Ord. 13022 § 22, 1998: Ord. 11978 § 14, 1995: Ord. 11157 § 18, 1993: Ord. 10870 § 407, 1993).21A.18.040 Shared parking requirements. The amount of off-street parking required by K.C.C. 21A.18.030 may be reduced by an amount determined by the director when shared parking facilities for two or more uses are proposed, provided:A. The total parking area exceeds 5,000 square feet;B. The parking facilities are designed and developed as a single on-site common parking facility, or as a system of on-site and off-site facilities, if all facilities are connected with improved pedestrian facilities and no building or use involved is more than eight hundred feet from the most remote shared facility;C. The amount of the reduction shall not exceed ten percent for each use, unless: 1. The normal hours of operation for each use are separated by at least one hour; or 2. A parking demand study is prepared by a professional traffic engineer and submitted by the applicant documenting that the hours of actual parking demand for the proposed uses will not conflict and those uses will be served by adequate parking if shared parking reductions are authorized; 3. The director will determine the amount of reduction subject to paragraph D of this section.D. The total number of parking spaces in the common parking facility is not less than the minimum required spaces for any single use;E. A covenant or other contract for shared parking between the cooperating property owners is approved by the director. This covenant or contract must be recorded with the records and licensing services division as a deed restriction on both properties and cannot be modified or revoked without the consent of the director; and F. If any requirements for shared parking are violated, the affected property owners must provide a remedy satisfactory to the director or provide the full amount of required off-street parking for each use, in accordance with the requirements of this chapter, unless a satisfactory alternative remedy is approved by the director. (Ord. 15971 § 97, 2007: Ord. 11621 § 60, 1994: Ord. 10870 § 408, 1993).21A.18.050 Exceptions for community residential facilities (CRF) and senior citizen assisted housing.A. The minimum requirement of one off-street parking space per two bedrooms for CRF's and one off-street parking space per two senior citizen assisted housing units may be reduced by up to 50 percent, as determined by the director based on the following considerations: 1. Availability of private, convenient transportation services to meet the needs of the CRF residents; 2. Accessibility to and frequency of public transportation; and 3. Pedestrian access to health, medical, and shopping facilities;B. If a CRF facility or senior citizen assisted housing is no longer used for such purposes, additional off-street parking spaces shall be required in compliance with this chapter prior to the issuance of a new certificate of occupancy. (Ord. 10870 § 409, 1993).21A.18.060 Parking for the disabled. Off-street parking and access for physically disabled persons shall be provided in accordance with of the regulations adopted pursuant to Chapter 19.27 RCW, State Building Code, and Chapter 70.92 RCW, Public Buildings-Provisions for Aged and Disabled. (Ord. 13022 § 23, 1998: Ord.11621 § 61, 1994: Ord. 10870 § 410, 1993).21A.18.070 Loading space requirements.A. Every non-residential building engaged in retail, wholesale, manufacturing or storage activities, excluding self-service storage facilities, shall provide loading spaces in accordance with the standards listed below.REQUIRED NUMBER OFGROSS FLOOR AREALOADING SPACES 10,000 to 16,000 square feet1 16,001 to 40,000 square feet2 40,001 to 64,000 square feet3 64,001 to 96,000 square feet4 96,001 to 128,000 square feet5128,001 to 160,000 square feet6160,001 to 196,000 square feet7For each additional 36,000 square feet1 additionalB. Every building engaged in hotel, office building, restaurant, hospital, auditorium, convention hall, exhibition hall, sports arena/stadium or other similar use shall provide loading spaces in accordance with the standards listed below.REQUIRED NUMBERGROSS FLOOR AREAOF LOADING SPACES 40,000 TO 60,000 square feet1 60,001 to 160,000 square feet2160,001 to 264,000 square feet3264,001 to 388,000 square feet4388,001 to 520,000 square feet5520,001 to 652,000 square feet6652,001 to 784,000 square feet7784,001 to 920,000 square feet8For each additional 140,000 square feet1 additionalC. Each loading space required by this section shall be a minimum of ten feet wide, thirty feet long, and have an unobstructed vertical clearance of fourteen feet six inches, and shall be surfaced, improved and maintained as required by this chapter. Loading spaces shall be located so that trucks shall not obstruct pedestrian or vehicle traffic movement or project into any public right-of-way. All loading space areas shall be separated from parking areas and shall be designated as truck loading spaces.D. Any loading space located within 100 feet of areas zoned for residential use shall be screened and operated as necessary to reduce noise and visual impacts. Noise mitigation measures may include architectural or structural barriers, beams, walls, or restrictions on the hours of operation.E. Multi-story self-service storage facilities shall provide two loading spaces, and single story facilities one loading space, adjacent to each building entrance that provides common access to interior storage units. Each loading berth shall measure not less than twenty-five feet by twelve feet with an unobstructed vertical clearance of fourteen feet six inches, and shall be surfaced, improved and maintained as required by this chapter. Any floor area additions or structural alterations to a building shall be required to provide loading space or spaces as set forth in this chapter. (Ord. 13022 § 24, 1998: Ord. 10870 § 411, 1993).21A.18.080 Stacking spaces for drive-through facilities.A. A stacking space shall be an area measuring eight feet by twenty feet with direct forward access to a service window of a drive-through facility. A stacking space shall be located to prevent any vehicles from extending onto the public right-of-way, or interfering with any pedestrian circulation, traffic maneuvering, or other parking space areas. Stacking spaces for drive-through or drive-in uses may not be counted as required parking spaces.B. Uses providing drive-up or drive-through services shall provide vehicle stacking spaces as follows: 1. For each drive-through lane of a bank or financial institution, business service or other drive-through use not listed, a minimum of five stacking spaces shall be provided; 2. For each drive-through lane of a restaurant that makes provision for on-premises consumption of food or drink or whose building floor area is more than one hundred sixty square feet, a minimum of seven stacking spaces shall be provided; and 3. For each drive-through lane of a restaurant that makes no provision for on-premises consumption of food or drink and whose building floor area is one hundred sixty square feet or less: a. A minimum of three stacking spaces shall be provided if: (1) there are three or more other restaurants within one-quarter mile of the restaurant that also make no provision for on-premises consumption of food or drink and whose building floor area is one hundred sixty square feet or less; or (2) if vehicles on the drive-through lane of the restaurant does not exceed six vehicles per any half-hour period; b. A minimum of four stacking spaces shall be provided if: (1) there are two or fewer other restaurants within one-quarter mile of the restaurant that also make no provision for on-premises consumption of food or drink and whose building floor area is one hundred sixty square feet or less; or (2) vehicles on the drive-through lane of the restaurant are seven or more but less than eleven vehicles per any half-hour period; c. A minimum of five stacking spaces shall be provided if: (1) there are no restaurants within one-quarter mile of the restaurant that also make no provision for on-premises consumption of food or drink and whose building floor area is one hundred sixty square feet or less; or (2) vehicles on the drive-through lane of the restaurant are eleven or more vehicles per any half-hour period; or d. The director may modify the number of required stacking spaces, after consultation with other public agencies or after consideration of traffic studies provided by the applicant, but to no fewer than three stacking spaces. (14943 § 1, 2004: Ord. 11621 § 62, 1994: Ord. 10870 § 412, 1993).21A.18.090 Transit and rideshare provisions.A. All land uses listed in K.C.C. 21A.08.060.A. (Government/Business Services), and in K.C.C. 21A.08.080.A. (Manufacturing), hospitals, high schools, vocational schools, universities and specialized instruction schools shall be required to reserve one parking space of every twenty required spaces for rideshare parking as follows: 1. The parking spaces shall be located closer to the primary employee entrance than any other employee parking except disabled; 2. Reserved areas shall have markings and signs indicating that the space is reserved; and 3. Parking in reserved areas shall be limited to vanpools and carpools established through ride share programs by public agencies and to vehicles meeting minimum rideshare qualifications set by the employer.B. The director may reduce the number of required off-street parking spaces when one or more scheduled transit routes provide service within six hundred sixty feet of the site. The amount of reduction shall be based on the number of scheduled transit runs between 7:00 - 9:00 a.m. and 4:00 - 6:00 p.m. each business day up to a maximum reduction as follows: 1. Four percent for each run serving land uses in K.C.C. 21A.08.060.A. (Government/Business Services) and K.C.C. 21A.08.080.A. (Manufacturing) up to a maximum of forty percent; 2. Two percent for each run serving land uses in K.C.C. 21A.08.040.A. (Recreation/Culture), 21A.08.050.A. (General Services) and 21A.08.060.A. (Retail/Wholesale) up to a maximum of twenty percent; and 3. When served by transit runs scheduled every fifteen minutes or less, cottage housing sites shall have no required parking minimum.C. All uses which are located on an existing transit route and are required under the computation for required off-street parking spaces in K.C.C. 21A.18.030.A. to provide more than two hundred parking spaces may be required to provide transit shelters, bus turnout lanes or other transit improvements as a condition of permit approval. Uses that reduce required parking under subsection B. of this section shall provide transit shelters if transit routes adjoin the site. (Ord. 19146 § 52, 2020: Ord. 11621 § 63, 1994: Ord. 10870 § 413, 1993).21A.18.100 Pedestrian and bicycle circulation and access.A. Non residential uses. All permitted nonresidential uses shall provide pedestrian and bicycle access within and onto the site. Access points onto the site shall be provided (a) approximately every 800 to 1,000 feet along existing and proposed perimeter sidewalks and walkways, and (b) at all arrival points to the site, including abutting street intersections, crosswalks, and transit stops. In addition, access points to and from adjacent lots shall be coordinated to provide circulation patterns between developments.B. Residential uses. 1. All permitted residential uses of five or more dwelling units shall provide pedestrian and bicycle access within and onto the site. Access points onto the site shall be provided (a) approximately every 800 to 1,000 feet along existing and proposed perimeter sidewalks and walkways, and (b) at all arrival points to the site, including abutting street intersections, crosswalks, and transit and school bus stops. In addition, access points to and from adjacent lots shall be coordinated to provide circulation patterns between sites.2. Residential uses of five or more dwelling units shall provide for non-motorized circulation between cul-de-sacs or groups of buildings to allow pedestrian and bicycle access within and through the development to adjacent activity centers, parks, common tracts, dedicated open space intended for active recreation, schools or other public facilities, transit and school bus stops, and public streets.3. Access shall only be required to school bus stops that are within or adjacent to a proposed residential use of five or more dwelling units and that are identified by the affected school district in response to a Notice of Application. In order to allow school districts to identify school bus stops, the department shall send a Notice of Application to affected school districts on all applications for residential uses of five or more dwelling units.C. Walkways shall form an on-site circulation system that minimizes the conflict between pedestrians and traffic at all points of pedestrian access to on-site parking and building entrances. Walkways shall be provided when the pedestrian access point onto the site, or any parking space, is more than 75 feet from the building entrance or principal on-site destination and as follows: 1. All developments which contain more than one building shall provide walkways between the principal entrances of the buildings; 2. All non-residential buildings set back more than 100 feet from the public right-of-way shall provide for direct pedestrian access from the building to buildings on adjacent lots; and 3. Walkways across parking areas shall be located as follows: a. Walkways running parallel to the parking rows shall be provided for every six rows. Rows without walkways shall be landscaped or contain barriers or other means to encourage pedestrians to use the walkways; and b. Walkways running perpendicular to the parking rows shall be no further than twenty parking spaces. Landscaping, barriers or other means shall be provided between the parking rows to encourage pedestrians to use the walkways;WALKWAYS RUNNING PERPENDICULAR TO PARKINGD. Pedestrian and bicycle access and walkways shall meet the following minimum design standards: 1. Access and walkways shall be well lit and physically separated from driveways and parking spaces by landscaping, berms, barriers, grade separation or other means to protect pedestrians from vehicular traffic; 2. Access and walkways shall be a minimum of 48 inches of unobstructed width and meet the surfacing standards of the King County Road Standards for walkways or sidewalks; 3. The minimum standard for walkways required to be accessible for persons with disabilities shall be designed and constructed to comply with the current State Building Code regulations for barrier-free accessibility; 4. A crosswalk shall be required when a walkway crosses a driveway or a paved area accessible to vehicles; andE. Blocks in excess of 660 feet shall be provided with a crosswalk at the approximate midpoint of the block. F. The director may waive or modify the requirements of this section when: 1. Existing or proposed improvements would create an unsafe condition or security concern; 2. There are topographical constraints, or existing or required structures effectively block access; 3. The site is in a rural area outside of or not contiguous to an activity center, park, common tract, dedicated open space, school, transit stop or other public facility; 4. The land use would not generate the need for pedestrian or bicycle access; or 5. the public is not allowed access to the subject land use. The director's waiver may not be used to modify or waive the requirements of K.C.C. 21A.18.100 relating to sidewalks and safe walking conditions for students.G. The provisions of this section shall not apply on school district property. (Ord. 12793 § 1, 1997: Ord. 11978 § 15, 1995: Ord. 11621 § 64 1994: Ord. 10870 § 414, 1993).21A.18.110 Off-street parking plan design standards.A. Off-street parking areas shall not be located more than six hundred feet from the building they are required to serve for all uses except those specified as follows; where an off-street parking area does not abut the building it serves, the requiredmaximum distance shall be measured from the nearest building entrance that the parking area serves: 1. For all single detached dwellings the parking spaces shall be located on the same lot they are required to serve; 2. For all other residential dwellings at least a portion of parking areas shall be located within one hundred fifty feet from the building or buildings they are required to serve; 3. For all nonresidential uses permitted in rural area and residential zones, the parking spaces shall be located on the site they are required to serve and at least a portion of parking areas shall be located within one hundred fifty feet from the nearest building entrance they are required to serve; 4. In designated activity, community business and neighborhood business centers, parking lots shall be located to the rear or sides of buildings. Relief from this subsection A.4 may be granted by the director only if the applicant can demonstrate that there is no practical site design to meet this requirement. The director may allow only the number of parking spaces that cannot be accommodated to the rear or sides of buildings to be located to the front of buildings; 5. Parking lots shall be so arranged as to permit the internal circulation of vehicles between parking aisles without re-entering adjoining public streets; and 6. Parking for the disabled shall be provided in accordance with K.C.C. 21A.18.060.B. The minimum parking space and aisle dimensions for the most common parking angles are shown on the table in this subsection. For parking angles other than those shown on the chart, the minimum parking space and aisle dimensions shall be determined by the director. Regardless of the parking angle, one-way aisles shall be at least ten feet wide, and two-way aisles shall be at least twenty feet wide. If dead-end aisles are used in the parking layout, they shall be constructed as two-way aisles. Parking plans for angle parking shall use space widths no less than eight feet six inches for a standard parking space design and eight feet for a compact car parking space design.MINIMUM PARKING STALL AND AISLE DIMENSIONSABCDEFPARKINGANGLESTALLWIDTHCURBLENGTHSTALL DEPTHAISLE WIDTH1-WAY 2-WAYUNIT DEPTH1-WAY 2-WAY00 8.0*Min 8.5Desired 9.020.0*22.522.5 8.0 8.5 9.012.0 20.012.0 20.012.0 20.0 ** **29.0 37.030.0 38.03030 8.0*Min 8.5Desired 9.016.0*17.018.015.016.517.010.0 20.010.0 20.010.0 20.0 ** **42.0 53.044.0 54.04545 8.0*Min 8.5Desired 9.011.5*12.012.517.0*12.0 20.012.0 20.012.0 20.0 ** **50.0 58.051.0 59.06060 8.0*Min 8.5Desired 9.0 9.6*10.010.518.020.021.018.0 20.018.0 20.018.0 20.0 ** **58.0 60.060.0 62.090 8.0*Min 8.5Desired 9.0 8.0* 8.5 9.016.0*18.018.024.0 24.024.0 24.023.0 24.0 ** **60.0 60.060.0 60.0 * for compact stalls only ** variable with compact and standard combinationsC. Any parking spaces abutting a required landscaped area on the driver or passenger side of the vehicle shall provide an additional eighteen inches above the minimum space width requirement to provide a place to step other than in the landscaped area. The additional width shall be separated from the adjacent parking space by a parking space division stripe.D. The parking stall depth may be reduced if vehicles overhang a walkway or landscaping under the following conditions: 1. Wheelstops or curbs are installed; 2. The remaining walkway provides a minimum of forty-eight inches of unimpeded passageway for pedestrians; 3. The amount of space depth reduction is limited to a maximum of eighteen inches; and 4. Landscaping is designed in accordance with K.C.C. 21A.16.070.E.E. Driveways providing ingress and egress between off-street parking areas and abutting streets shall be designed, located and constructed in accordance with K.C.C. chapter 14.42, Road Standards. Driveways for single detached dwellings, no more than twenty feet in width, may cross required setbacks or landscaped areas to provide access between the off-street parking areas and the street, provided no more than fifteen percent of the required landscaping or setback area is eliminated by the driveway. Joint use driveways may be located within required landscaping or setback areas. Driveways for all other developments may cross or be located within required setbacks or landscaped areas to provide access between the off-street parking areas and the street, if no more than ten percent of the required landscaping is displaced by the driveway and the driveway is located no closer than five feet from any property line except where intersecting the street.F. Parking spaces required under this title shall be located as follows: 1. For single detached dwelling units the required parking spaces shall be outside of any required setbacks or landscaping, but driveways crossing setbacks and required landscaping may be used for parking. However, if the driveway is a joint use driveway, no vehicle parked on the driveway shall obstruct any joint user's access to the driveway or parking spaces; 2. For all other developments parking spaces may be permitted by the director in setback areas in accordance with an approved landscape plan; and 3. For nonresidential uses in rural area and residential zones, parking is permitted in setback areas in accordance with K.C.C. 21A.12.220.G. Lighting shall be provided for safety of traffic and pedestrian circulation on the site. It shall be designed to minimize direct illumination of abutting properties and adjacent streets. The director shall have the authority to waive the requirement to provide lighting.H. Tandem or end-to-end parking is allowed in residential developments. Apartment or townhouse developments may have tandem parking areas for each dwelling unit but shall not combine parking for separate dwelling units in tandem parking areas. I. All vehicle parking and storage for single detached dwellings must be in a garage, carport or on an approved impervious surface. Any impervious surface used for vehicle parking or storage must have direct and unobstructed driveway access.J. The total number of vehicles parked or stored outside of a building on a single family lot in the R-1 through R-8 zones, excluding recreational vehicles and trailers, shall not exceed six vehicles on lots that are twelve thousand five hundred square feet or less and eight vehicles on lots that are greater than twelve thousand five hundred square feet.K. Vanpool and carpool parking areas shall meet the following minimum design standards: 1. A minimum vertical clearance of seven feet three inches shall be provided to accommodate van vehicles if designated vanpool and carpool parking spaces are located in a parking structure; and 2. A minimum turning radius of twenty-six feet four inches with a minimum turning diameter, curb to curb, of fifty-two feet five inches shall be provided from parking aisles to adjacent vanpool and carpool parking spaces.L. Direct access from the street right-of-way to off-street parking areas shall be subject to K.C.C. 21A.28.120.M. No dead-end alley may provide access to more than eight off-street parking spaces.N. Any parking stalls located in enclosed buildings must be totally within the enclosed building. (Ord. 17539 § 41, 2013: Ord. 17191 § 39, 2011: Ord. 14309 § 10, 2002: Ord. 14045 § 47, 2001: Ord. 13022 § 25, 1998: Ord. 11978 § 16, 1995: Ord. 11621 § 65, 1994: Ord. 10870 § 415, 1993).21A.18.120 Off-street parking construction standards.A. Off-street parking areas shall have dust-free, all-weather surfacing. Typical approved sections are illustrated below. Frequently used (at least five days a week) off-street parking areas shall conform to the standards shown in A below or an approved equivalent. If the parking area is to be used more than 30 days per year but less than five days a week, then the standards to be used shall conform to the standards shown in B below or an approved equivalent. An exception to these surfacing requirements may be made for certain uses that require intermittent use of their parking facilities less than 30 days per year. Any surface treatment other than those graphically illustrated below must be approved by the director.MINIMUM SURFACING REQUIREMENTSB. Grading work for parking areas shall meet the requirements of K.C.C. 16.82. Drainage and erosion/sedimentation control facilities shall be provided in accordance with K.C.C. 9.04.C. Asphalt or concrete surfaced parking areas shall have parking spaces marked by surface paint lines or suitable substitute traffic marking material in accordance with the Washington State Department of Transportation Standards. Wheel stops are required where a parked vehicle would encroach on adjacent property, pedestrian access or circulation areas, right-of-way or landscaped areas. Typically approved markings and wheel stop locations are illustrated below.(Ord. 10870 § 416, 1993).21A.18.130 Compact car allowance requirements. In any development containing more than 20 parking spaces, up to 50 percent of the total number of spaces may be sized to accommodate compact cars, subject to the following:A. Each space shall be clearly identified as a compact car space by painting the word "COMPACT" in capital letters, a minimum of 8 inches high, on the pavement at the base of the parking space and centered between the striping; B. Aisle widths shall conform to the standards set for standard size cars; andC. Apartment developments with less than twenty parking spaces may designate up to 40 percent of the required parking spaces as compact spaces. (Ord. 10870 § 417, 1993).21A.18.140 Internal circulation road standards. Internal access roads to off-street parking areas shall conform with the surfacing and design requirements for private commercial roads set forth in K.C.C. 14.42 King County Roads Standards. (Ord. 10870 § 418, 1993).21A.18.150 Electric-vehicle-charging infrastructure. If this title requires a use to provide off-street parking, the parking area, whether provided on-site or off-site, shall include electric-vehicle-charging infrastructure as follows:A.1. New townhouses shall provide one electric-vehicle-ready parking space per dwelling unit. 2. For new or substantially improved buildings for apartment dwelling units, or if paved surface parking area for such buildings is expanded by fifty percent or more, ten percent of total parking spaces shall be electric-vehicle-supply-equipment parking spaces and twenty-five percent of total parking spaces shall be electric-vehicle-ready parking spaces. 3. For the following development activities, five percent of total parking spaces shall be electric-vehicle-supply-equipment parking spaces and ten percent of total parking spaces shall be electric-vehicle-ready parking spaces: a. new or substantially improved buildings for group residential or temporary lodging uses in K.C.C. 21A.08.030, or expansion of paved surface parking area for one of these uses by fifty percent or more; b. new or substantially improved buildings for nonresidential uses, or expansion of paved surface parking area for one of these uses by fifty percent or more; and c. new commuter parking lot or automotive parking, or expansion of paved surface parking area for one of these uses by fifty percent or more. 4. The electric-vehicle-charging infrastructure requirements in this section do not apply to common-wall residential buildings that serve townhouse, apartment, group residential or temporary lodging uses and that consist of four or fewer units, do not exceed two stories in height, are less than five thousand square feet in area and have a one-hour fire-resistive occupancy separation between units. New construction of such buildings that serve Group B, Group R-1 hotel and motel only and Group R-2 occupancies as defined in the Washington State Building Code are required to meet the provisions of Section 429 of the Washington State Building Code. 5. For developments subject to subsections A.2., A.3.a. or A.3.b. of this section , if the total number of parking spaces required by this title is six or fewer, the required electric-vehicle-supply-equipment parking spaces may be replaced by electric-vehicle-ready parking spaces. However, if such a parking area voluntarily exceeds the minimum required number of parking spaces, the parking area shall include the number of electric-vehicle-supply-equipment parking spaces required by this subsection A. 6. When electric-vehicle-charging infrastructure is required for new buildings or substantial improvements to existing buildings, the parking area shall meet the requirements of this section even if construction of additional off-street parking is not required elsewhere in this title. 7. For developments that have both residential and nonresidential uses, parking associated with residential uses shall meet the applicable requirements of subsection A.1., A.2. or A.3.a. of this section, and parking associated with nonresidential uses shall meet the requirements of subsection A.3.b. of this section. 8. If a parking reduction is granted as allowed by this title, the required number of electric-vehicle-supply-equipment parking spaces and electric-vehicle-ready parking spaces shall be calculated based on the final total number of parking spaces to be provided. 9. An electric-vehicle-supply-equipment parking space required by this section shall not count as an electric-vehicle-ready parking space for the purposes of meeting the electric-vehicle-ready requirements of this section. Each additional electric-vehicle-supply-equipment parking space installed beyond the minimum requirements of this section may count as one electric-vehicle-ready parking space for the purposes of meeting the electric-vehicle-ready requirements of this section. 10. When calculating the number of required electric-vehicle-supply-equipment parking spaces and electric-vehicle-ready parking spaces, any fraction or portion of a required electric-vehicle-supply-equipment parking space or a required electric-vehicle-ready parking space shall be rounded up to the nearest whole number. 11. When electric-vehicle-supply-equipment parking spaces are required, at least five percent of the electric-vehicle-supply-equipment parking spaces, but no less than one electric-vehicle-supply-equipment parking space, shall be accessible. The accessible electric-vehicle-supply-equipment parking spaces shall be in addition to any accessible parking spaces required by the Washington state building code. The electric-vehicle-supply-equipment charger serving accessible spaces may include multiple attachment plugs in order to serve adjacent parking spaces not designated as accessible parking. 12. For electric-vehicle-ready parking spaces, the branch circuit shall be identified as "Electric-Vehicle Ready" in the service panel or subpanel directory, and the termination location shall be marked as "Electric-Vehicle Ready";B. For townhouse developments containing nine or fewer dwelling units, the director may reduce the requirements of subsection A. of this section where the applicant can prove that the added electrical load to meet the requirements will require an on-site transformer that is pole-mounted, on a slab or in an underground vault. The reductions shall occur as follows: 1. The maximum quantity of electric-vehicle-charging infrastructure required to be installed shall be reduced to the maximum service size that would not require the changes to transformation or electrical service in subsection B. of this section; and 2. The director may first reduce the number of required electric-vehicle-ready parking spaces at electric-vehicle-ready parking spaces. If this is not sufficient, the director may also then reduce the required level of electric-vehicle-charging infrastructure at electric-vehicle-ready parking spaces from 208/240 volt to 120 volt circuits;C. Electric-vehicle load management system technology is permitted to be used to support electric-vehicle-supply-equipment parking spaces. Applicants may also use electric-vehicle load management system assumptions in calculating the number of minimum 208/240-volt dedicated branch circuits needed to support electric-vehicle-ready parking spaces required by this section;D. Where electric-vehicle-ready exterior on-grade surface parking spaces are located more than four feet from a building, enclosed conduit raceways shall be extended to a pull box or stub in the vicinity of the designated parking space and shall be protected from vehicles by a curb or other device;E. Nothing in this section shall be construed to modify the minimum number of off-street-motor-vehicle parking spaces required for specific uses or the maximum number of parking spaces allowed, as set forth in K.C.C. chapter 21A.18 or elsewhere in K.C.C. Title 21A; andF. All electric-vehicle-supply-equipment parking spaces shall have designated signage and pavement markings as required under RCW 46.08.185. (Ord. 19316 § 7, 2021).21A.20DEVELOPMENT STANDARDS - SIGNSSections:21A.20.010Purpose.21A.20.020Permit requirements.21A.20.030Exempt signs.21A.20.040Prohibited signs or displays.21A.20.050Sign area calculation.21A.20.060General sign requirements.21A.20.065Community bulletin board signs.21A.20.070Resource zone signs.21A.20.080Residential zone signs.21A.20.090Office zone signs.21A.20.095Neighborhood business zone signs.21A.20.100Community business and industrial zone signs.21A.20.110Regional business zone signs.21A.20.115Mixed-use development signs in R-12 through R-48 zones.21A.20.120Signs or displays of limited duration.21A.20.130Billboards: location and height standards.21A.20.140Billboards: general requirements.21A.20.150Billboards: special restrictions in the CB zone.21A.20.160Billboards: alteration or relocation limitations.21A.20.170Billboards: view and vegetative screening protections.21A.20.180Billboard-free areas.21A.20.190Community identification signs.21A.20.010 Purpose. The purpose of this chapter is to enhance the visual environment of the county by:A. Establishing standards that regulate the type, number, location, size, and lighting of signs;B. Recognizing the private purposes of signs for the identification of businesses and promotion of products and services; andC. Recognizing the public purposes of signs which includes considerations of traffic safety, economic and aesthetic welfare. (Ord. 10870 § 419, 1993).21A.20.020 Permit requirements.A. Except as otherwise permitted by this chapter, no sign shall be erected, altered or relocated without approval by the county.B. No building permit shall be required for repainting, cleaning, or other normal maintenance and repair of a sign, or for sign face and copy changes that do not alter the size or structure of the sign. (Ord. 10870 § 420, 1993).21A.20.030 Exempt signs. The following signs or displays are exempted from the regulations under this chapter:A. Historic site markers or plaques, gravestones, and address numbers;B. Signs required by law, including but not limited to: 1. Official or legal notices issued and posted by any public agency or court; or 2. Traffic directional or warning signs;C. Plaques, tablets or inscriptions indicating the name of a building, date of erection, or other commemorative information, which are an integral part of the building structure or are attached flat to the face of the building, which are nonilluminated, and which do not exceed four square feet in surface area;D. Incidental signs, which shall not exceed two square feet in surface area, though the size limitation shall not apply to signs providing directions, warnings or information when established and maintained by a public agency;E. State or federal flags;F. Religious symbols;G. The flag of a commercial institution, provided no more than one flag is permitted per business premises, and further provided the flag does not exceed twenty square feet in surface area; andH. Gateway signs, as adopted by ordinance. (Ord. 18659 § 2, 2018: Ord. 10870 § 421, 1993).21A.20.040 Prohibited signs or displays. Except as otherwise specifically allowed by this chapter, the following signs or displays are prohibited:A. Portable signs including, but not limited to, sandwich/A-frame signs and mobile readerboard signs, and excluding signs permitted under K.C.C. 21A.20.120;B. Private signs on utility poles;C. Signs which, by reason of their size, location, movement, content, coloring or manner of illumination may be confused with traffic control signs or signals;D. Signs located in the public right-of-way; andE. Posters, pennants, string of lights, blinking lights, balloons, searchlights and other displays of a carnival nature; except as architectural features, or on a limited basis as seasonal decorations or as provided for in K.C.C. 21A.20.120 as grand opening displays.F. Changing message center signs. (Ord. 16267 § 35, 2008: Ord. 10870 § 422, 1993).21A.20.050 Sign area calculation.A. Sign area for non-monument free-standing signs shall be calculated by determining the total surface area of the sign as viewed from any single vantage point, excluding support structures.B. Sign area for letters or symbols painted or mounted directly on walls or monument signs or on the sloping portion of a roof shall be calculated by measuring the smallest single rectangle which will enclose the combined letters and symbols.C. Sign area for signs contained entirely within a cabinet and mounted on a wall, roof or monument shall be calculated by measuring the entire area of the cabinet. (Ord. 13014 § 4, 1998: Ord. 10870 § 423, 1993).21A.20.060 General sign requirements.A. All signs, except billboards, community bulletin boards, community identification signs, political signs, real estate signs and special event signs, shall be on-premise signs, except that uses located on lots without public street frontage in business, office and industrial zones may have one off-premise directional sign of no more than sixteen square feet.B. Fuel price signs shall not be included in sign area or number limitations of K.C.C. 21A.20.090, 21A.20.095, 21A.20.100 and 21A.20.110, but only if the signs do not exceed twenty square feet per street frontage.C. Except as otherwise provided in K.C.C. 21A.20.115 and 21A.20.080.A.3, projecting and awning signs and signs mounted on the sloping portion of roofs shall not be permitted for uses in the resource, rural area and residential zones. In other zones, projecting and awning signs and signs mounted on the sloping portion of roofs may be used in lieu of wall signs, but only if: 1. They maintain a minimum clearance of eight feet above finished grade; 2. They do not project more than six feet perpendicular from the supporting building facade; 3. They meet the standards of subsection J. of this section if mounted on the roof of a building; and 4. They shall not exceed the number or size permitted for wall signs in a zone.D. Changing message center signs, and time and temperature signs, which can be a wall or freestanding sign, shall not exceed the size permitted for a wall or freestanding sign. Changing message center signs shall be permitted for all uses only in the NB, CB, RB, O and I zones and only for elementary, middle, junior, secondary and high schools and colleges and universities in the RA zone. Changing message center signs and time and temperature signs shall not exceed the maximum sign height permitted in the zone.E. Directional signs shall not be included in the sign area or number limitation of K.C.C. 21A.20.070, 21A.20.095, 21A.20.100 and 21A.20.110, but only if the signs do not exceed six square feet in surface area and are limited to one for each entrance or exit to surface parking areas or parking structure.F. Regarding sign illumination and glare: 1. Except as otherwise provided in this chapter, all signs may be illuminated; 2. The light source for indirectly illuminated signs shall be no farther away from the sign than the height of the sign; 3. Indirectly and directly illuminated signs shall be arranged so that no direct rays of light are projected from such artificial source into residences or any street right-of-way; 4. Electrical requirements for signs shall be governed by chapter 19.28 RCW and WAC 296-46-910; and 5. Signs with an on/off operation shall be permitted only in the CB, RB and I zones.G. Maximum height for wall signs shall not extend above the highest exterior wall or structure upon which the sign is located.H. Maximum height for projecting signs shall not extend above the highest exterior wall upon which the projecting sign is located.I. Maximum height for awning signs shall not extend above the height of the awning upon which the awning sign is located.J. Any sign attached to the sloping surface of a roof shall be installed or erected in such a manner that there are no visible support structures, shall appear to be part of the building itself, and shall not extend above the roof ridge line of the portion of the roof upon which the sign is attached.K. Except as otherwise permitted by this chapter, off-premise directional signs shall not exceed four square feet in sign area.L. Mixed use developments in the NB, CB, RB or O zones are permitted one permanent residential identification sign not exceeding thirty-two square feet in addition to the maximum sign area requirements in the zone where the mixed use development is located. (Ord. 17539 § 42, 2013: Ord. 16950 § 22, 2010: Ord. 16594 § 3, 2009: Ord. 16267 § 36, 2008: Ord. 15404 § 2, 2006: Ord. 13022 § 27, 1998: Ord. 13014 § 5, 1998: Ord. 10870 § 424, 1993).21A.20.065 Community bulletin board signs.A. One community bulletin board sign is permitted within each community plan designated activity center with the following limitations:B. In the R, UR and RA zones community bulletin board signs may not exceed 32 square feet and are only permitted at public schools, police stations, fire stations or other public facilities;C. In the O and NB zones community bulletin board signs may not exceed 40 square feet;D. In the CB and I zones community bulletin board signs may not exceed 60 square feet; andE. In the RB zone community bulletin board signs may not exceed 100 square feet. (Ord. 10870 § 425, 1993).21A.20.070 Resource zone signs. Signs in the A, F, and M zones are limited as follows:A. One residential identification sign, not exceeding two square feet, is permitted. One additional sign, not exceeding 24 square feet, is permitted to identify non-residential uses or to advertise goods or services availableon site; andB. Freestanding signs shall not exceed a height of six feet, and shall be setback at least 10 feet from street right-of-way. (Ord. 10870 § 426, 1993).21A.20.080 Residential zone signs. Except as otherwise provided in K.C.C. 21A.20.115, signs in the R, UR and RA zones are limited as follows:A. Nonresidential use: 1. One indirectly illuminated sign identifying nonresidential uses, not exceeding twenty-five square feet and not exceeding six feet in height is permitted, except as provided in subsection A.3. of this section; 2. Schools are permitted one sign per school or school facility entrance, which may be located in the setback. Two additional wall signs attached directly to the school or school facility are permitted. Changing message center signs, if allowed under K.C.C. 21A.20.060, shall be limited to hours of operation between 7a.m. and 10 p.m.; and 3. In lieu of the sign allowed under subsection A.1. of this section, one nonilluminated sign may be attached or painted on the sloping portion of a roof of a building located within one hundred feet of a state route as follows: a. each sign shall not exceed fifty square feet in area and six feet in height; b. each sign, and its mounting brackets, attached to the sloping surface of a roof shall not extend above the roof ridge line portion of the roof upon which the sign is attached; and c. no more than two signs may be attached or painted on the roof.B. Residential use: 1. One residential identification sign not exceeding two square feet is permitted; 2. One permanent residential development identification sign not exceeding thirty-two square feet is permitted for each entrance into a development. The maximum height for the sign shall be six feet. The sign may be freestanding or mounted on a wall, fence or other structure; and 3. Home occupation and home industry signs are limited to: a. one nonilluminated wall sign not exceeding ten percent of the building fa?ade on which they are located; and b. in the RA zone, one nonilluminated freestanding sign not exceeding twenty-four square feet and a maximum height of six feet. (Ord. 16950 § 21, 2010: Ord. 16594 § 4, 2009: Ord. 16267 § 37, 2008: Ord. 15404 § 3, 2006: Ord. 12595 § 1, 1997: Ord. 10870 § 427, 1993).21A.20.090 Office zone signs. Signs in the O zones shall be limited as follows:A. Wall signs are permitted, provided they do not total an area more than 10 percent of the building facade on which they are located and provided they are limited to building facades with street frontage.B. Freestanding signs: 1. One freestanding sign not exceeding 50 square feet is permitted for each street frontage of the lot, provided corner lots with a street frontage of less than 100 feet on each street shall be permitted only one freestanding sign; 2. On lots where more than one freestanding sign is permitted, the sign area permitted for individual freestanding signs may be combined; provided the combined sign does not exceed 80 square feet; and 3. The maximum height for freestanding signs shall be 15 feet. (Ord. 10870 § 428, 1993).21A.20.095 Neighborhood business zone signs. Signs in the NB zones shall be limited as follows:A. Wall signs are permitted, provided they do not total an area more than 10 percent of the building facade on which they are located;B. Freestanding signs: 1. One freestanding sign not exceeding 50 square feet is permitted for each street frontage of the lot, provided corner lots with a street frontage of less than 100 feet on each street shall be permitted only one freestanding sign; 2. Multiple tenant developments that have more than 300 feet of street frontage on one street may have one additional freestanding sign for each 300 feet of street frontage, or portion thereof. Such signs shall be separated from one another by a minimum of 150 feet, if located on the same street frontage; 3. On lots where more than one freestanding sign is permitted, the sign area permitted for individual freestanding signs may be combined; provided the combined sign does not exceed 150 square feet; and 4. The maximum height for freestanding signs shall be 15 feet. (Ord. 10870 § 429, 1993).21A.20.100 Community business and Industrial zone signs. Signs in the CB and I zones shall be limited as follows:A. Wall signs are permitted, provided they do not total an area more than 15 percent of the building facade on which they are located;B. Freestanding signs: 1. One freestanding sign not exceeding 85 square feet, plus an additional 20 square feet for each additional business in a multiple tenant structure but not to exceed 145 square feet total, is permitted for each street frontage of the lot, provided corner lots with a street frontage of less than 100 feet on each street shall be permitted only one freestanding sign; 2. Multiple tenant developments that have more than 300 feet of street frontage on one street may have one additional freestanding sign for each 300 feet of street frontage, or portion thereof. Such signs shall be separated from one another by a minimum of 150 feet, if located on the same street frontage; 3. On lots where more than one freestanding sign is permitted, the sign area permitted for individual freestanding signs may be combined provided the combined sign area does not exceed 250 square feet; and 4. The maximum height for freestanding signs shall be 20 feet. (Ord. 10870 § 430, 1993).21A.20.110 Regional business zone signs. Signs in the RB zone shall be limited as follows:A. Wall signs are permitted, provided they do not total an area more than 15 percent of the building facade on which they are located;B. Freestanding signs; 1. One freestanding sign not exceeding 170 square feet is permitted for each street frontage of the lot, provided corner lots with a street frontage of less than 100 feet on each street shall be permitted only one freestanding sign; 2. Multiple tenant developments that have more than 300 feet of street frontage on one street may have one additional freestanding sign for each 300 feet of street frontage, or portion thereof. Such signs shall be separated from one another by a minimum of 150 feet, if located on the same street frontage not exceeding 150 square feet; 3. On lots where more than one freestanding sign is permitted, the sign area permitted for individual freestanding signs may be combined; provided the combined sign area does not exceed 300 square feet; and4. The maximum height for a freestanding sign shall be 25 feet. (Ord. 10870 § 431, 1993).21A.20.115 Mixed-use development signs in R-12 through R-48 zones. In a mixed-use development in the R-12 through R-48 zones in which the combined total of all nonresidential establishments exceeds fifteen thousand square feet of gross floor area, signs are limited as follows:A. Signs for nonresidential uses are permitted as provided in K.C.C. 21A.20.095;B. Signs for residential uses are permitted as follows: 1. One permanent residential identification sign not exceeding thirty-two square feet is permitted per building for each street frontage of the lot. A corner lot with a street frontage of less than one hundred feet on each street shall be permitted only one sign; 2. The maximum height for freestanding signs shall be fifteen feet; 3. The sign may be freestanding or mounted on a fence or a wall or other structure; and 4. In lieu of wall signs, projecting and awning signs and signs mounted on the sloping portion of roofs are permitted if the signs: a. have a minimum clearance of eight feet above finished grade; b. do not project more than six feet perpendicular from the supporting building facade; c. meet the standards of K.C.C. 21A.20.060.J, if mounted on the roof of a building; and d. do not total an area more than ten percent of the building fa?ade on which they are located. (Ord. 15404 § 1, 2006).21A.20.120 Signs or displays of limited duration. The following temporary signs or displays are permitted and except as required by the K.C.C. Title 16, or as otherwise permitted in this chapter, do not require building permits:A. Grand opening displays: 1. Signs, posters, pennants, strings of lights, blinking lights, balloons and searchlights are permitted for a period of up to one month to announce the opening of a new enterprise or the opening of an enterprise under new management; and 2. All grand opening displays shall be removed upon the expiration of 30 consecutive days;B. Construction signs: 1. Construction signs identifying architects, engineers, planners, contractors or other individuals or firms involved with the construction of a building and announcing the character of the building or the purpose for which the building is intended may be displayed; 2. One nonilluminated, double-faced sign is permitted for each public street upon which the project fronts; 3. No sign shall exceed 32 square feet in surface area or ten feet in height, or be located closer than 30 feet from the property line of the adjoining property; and 4. Construction signs must be removed by the date of first occupancy of the premises or one year after placement of the sign, whichever occurs first; C. Political Signs: 1. Signs, posters or bills promoting or publicizing candidates for public office or issues that are to be voted upon in a general or special election may be displayed on private property with the consent of the property owner. Any such sign, poster or bill shall be removed within ten days following the election; and 2. No sign, poster, bill or other advertising device shall be located on public property or within public easements or street right-of-way;D. Real estate signs. All temporary real estate signs may be single or double-faced signs: 1. Signs advertising an individual residential unit for sale or rent shall be limited to one sign per street frontage. The sign may not exceed eight square feet in area, and shall not exceed six feet in height. The sign shall be removed within five days after closing of the sale, lease or rental of the property. 2. Portable off-premise residential directional signs announcing directions to an open house at a specified residence which is offered for sale or rent shall not exceed six square feet in area for each sign, and shall not exceed 42 inches in height. Such signs shall be permitted only when the agent or seller is in attendance at the property for sale or rent and may be located on the right-of-way outside of vehicular and bicycle lanes. 3. On-site commercial or industrial property for sale or rent signs shall be limited to one sign per street frontage, and shall not exceed 32 square feet in area. The sign shall not exceed 12 feet in height. The sign shall be removed within 30 days after closing of the sale, lease or rental of the property. A building permit is required and shall be issued for a one year period. The permit is renewable for one year increments up to a maximum of three years. 4. On-site residential development for sale or rent signs shall be limited to one sign per development. The sign shall not exceed 32 square feet in area, and shall not exceed 12 feet in height. A building permit is required and shall be issued for a one year period. The permit is renewable annually for up to a maximum of three years. 5. Off-site directional signs for residential developments shall be limited to six signs. Each sign shall not exceed 16 square feet in area, and shall include only the name of and directions to the residential development. The sign(s) shall be placed a maximum of two road miles from the nearest residential development entrance. No two signs for one residential development shall be located closer than 500 feet from one another on the same street. A single building permit is required for all signs and shall be issued for a one year period. The permit number and the permit expiration date must be clearly displayed on the face of each sign. The permit is renewable for one year increments up to a maximum of three years, provided that extensions will only be granted if the sign permit applicant has complied with the applicable regulations. 6. Residential on-premise informational signs shall be limited to one sign per feature, including but not limited to signs for information centers, model homes, parking areas or announcing features such as parks, playgrounds, or trails. Each sign shall not exceed 16 square feet in area, and shall not exceed six feet in height.E. Community event signs: 1. Community event signs shall be limited to announcing or promoting a non-profit sponsored community fair, festival or event; 2. Community event signs may be displayed no more than the time period specified in the temporary use permit issued pursuant to K.C.C. 21A.44. Community event signs that do not require a temporary use permit shall not be displayed earlier than one month before the event; and 3. Community event signs shall be removed by the event sponsor within two weeks following the end of the community fair, festival or event. (Ord. 16267 § 38, 2008: Ord. 11621 § 66, 1994: Ord. 10870 § 432, 1993).21A.20.130 Billboards: location and height standards.A. All billboard alterations or relocations shall comply with the following location and design standards: 1. Billboards shall only be located on sites zoned CB, RB or I; 2. No more than five billboard faces shall be oriented toward and visible from the same direction of travel within one mile of the proposed relocation site as measured along the adjacent roadway; 3. Billboards shall be located at least 100 feet from any other billboard, provided side-by-side, v-type and back-to-back billboard faces shall be considered one billboard for purposes of this subsection only; 4. The zoning on the opposite side of the street from a proposed relocation site must also permit billboards; 5. Type II billboards shall be at least one hundred feet from any rural area and residential zones. Type I billboards shall be at least three hundred thirty feet from rural area and residential zones; 6. No billboard shall extend beyond the property line of the billboard site; 7. No billboard shall be located more than one hundred feet from any adjacent arterial; 8. Billboards shall observe the same street setback as all buildings within fifty feet of the proposed billboard location; 9. Type I billboard faces shall only be located adjacent to arterials developed with at least two primary travel lanes in each direction. In all other locations, billboards shall be limited to Type II billboard faces; and 10. No single billboard structure shall support a total of more than two Type I billboard faces or the equivalent, and no single billboard structure shall orient more than one Type I billboard face or the equivalent in any single direction.B. Height: 1. Billboards located in the CB or RB zone shall not exceed fifteen feet above the average height of all buildings within three hundred thirty feet of the billboard or thirty-five feet, whichever is less; and 2. Billboards located in the I zone shall not exceed fifteen feet above the average height of all buildings within three hundred feet of the billboard or forty-five feet, whichever is less. (Ord. 17539 § 43, 2013: Ord. 10870 § 433, 1993).21A.20.140 Billboards: general requirements.A. The total number of billboard faces within unincorporated King County shall not exceed the total number of billboard faces existing on June 20, 1988, except as provided in K.C.C. 21A.20.160E. In addition, the total number of existing billboard faces within each zone permitting billboards shall not be exceeded except as provided in K.C.C. 21A.20.150.B. In the event that portions of unincorporated King County annex to incorporated cities or towns or incorporate after June 20, 1988, the total number of allowable billboard faces shall be decreased by the number of faces existing in such areas on the effective date of annexation or incorporation.C. As soon as practical after June 20, 1988, the county shall compile an inventory of existing billboards within the county. Until the inventory is completed, no billboard shall be erected, modified, or relocated, nor shall King County issue any permits. Following completion of the inventory, the county shall grant a billboard permit for each existing billboard reflecting the location, size, height, zoning, and the degree of conformity with the requirements of this chapter. Only inventoried billboards may be subsequently issued billboard alteration or relocation permits. Billboard owners can accelerate the inventory process by providing the necessary inventory information for their billboards. If owners have provided necessary inventory information for all billboards in their ownership, the county shall release billboard permits for that ownership, regardless of the degree of completion of the remainder of the inventory. (Ord. 10870 § 434, 1993).21A.20.150 Billboards: special restrictions in the CB zone.A. In the event that a billboard owner elects to relocate CB zoned billboards outside of the CB zone, the CB zoning classification shall be removed and that permit may not later be used to relocate a billboard in the CB zone.B. Billboards may be relocated only within the zone district identified on the valid billboard permit, except the number of billboards permitted within non-CB zone district may increase only as a result of billboard relocation from within the CB zone district. (Ord. 19146 § 53, 2020: Ord. 10870 § 435, 1993).21A.20.160 Billboards: alteration or relocation limitations.A. Except as provided in K.C.C. 21A.20.160D, billboards shall not be altered with regard to size, shape, orientation, height, or location without the prior issuance of a billboard alteration or relocation permit. All such permits shall require full compliance with the provisions of K.C.C. 21A.20.130 -.180.B. There shall be no time limit on the eligibility to alter or relocate inventoried billboards; however, individual alteration and relocation permits shall expire if the approved modifications are not completed within one year of permit issuance. Any project not completed within this period shall be placed in a holding category until a new permit is issued by King County, and no further work on the subject billboard shall occur until a permit is issued.C. Relocation of inventoried billboards shall also require the issuance of a demolition permit for the removal of the existing billboard. Billboard demolitions shall be completed within 90 days of permit issuance and prior to installation of the relocated billboard.D. Ordinary and necessary repairs which do not change the size, shape, orientation, height, or location of an inventoried billboard shall not require alteration permits. Billboard copy replacement may occur at any time and is exempt from the requirement for alteration permits, provided: 1. New Type II billboard faces do not exceed the size of previously inventoried faces, or 2. New Type I billboard faces may only exceed the size of the previously inventoried face with temporary cut-out extensions if the billboard is otherwise conforming, and if the extensions do not exceed a total of 125 square feet. Any extension shall be removed with the next change of billboard copy.E. Single Type I billboard faces may be replaced with two side-by-side Type II billboard faces, and likewise two side-by-side Type II billboard faces may be replaced with a single Type I billboard face, provided each resulting billboard face complies with the location and height standards of K.C.C. 21A.20.130.F. Any location or orientation alteration of billboards conforming to the provisions of K.C.C. 21A.20.130 - .180 shall be accompanied by the alteration or relocation of an equal number of billboards under the control of the same applicant which do not fully conform to these provisions, if any nonconforming billboards exist. Whenever more than one nonconforming billboard exists under a single ownership, they shall be made conforming in the following order: 1. Billboards deemed nonconforming pursuant to K.C.C. 21A.20.170; 2. Billboards located in zones which do not allow billboards; 3. Billboards located in billboard free areas; 4. Billboards located in the CB zone district; and 5. Any other nonconforming billboard. (Ord. 17029 § 2, 2011 (expired 12/31/2012): Ord. 10870 § 436, 1993).21A.20.170 Billboards: view and vegetative screening protections.A. Notwithstanding any other provision of K.C.C. 21A.20.130 through 21A.20.180 or other applicable laws or regulations, no billboard shall be located or oriented in a manner that is within the direct line-of-sight of views of Mt. Rainier, Mt. Baker, the Olympic Mountains, Puget Sound, or any lake or river from adjacent public roadways. All applications for billboard alteration or relocation shall be certified by the applicant as meeting this provision. Any billboard subsequently found to violate this provision shall be deemed nonconforming and shall be required to become the next nonconforming billboard relocated pursuant to K.C.C. 21A.20.160.B. Notwithstanding any other provision of K.C.C. 21A.20.130 through 21A.20.180 or other applicable law or regulation, no billboard owner or agent shall remove, cut, or otherwise alter any vegetative screening on public property or private landscaping required by code as a condition of permit approval in order to improve the visibility of a nearby billboard. Should such an alteration occur, any billboard so benefited shall be deemed nonconforming and shall be required to become the next nonconforming billboard relocated pursuant to K.C.C. 21A.20.160.F. (Ord. 18683 § 55, 2018: Ord. 11157 § 19, 1993: Ord. 10870 § 437, 1993).21A.20.180 Billboard-free areas.A. Notwithstanding any other provision of K.C.C. 21A.20.130 -.180, no billboard shall be relocated in any of the following areas: 1. Sites listed in either the Washington State or National Register of Historic Places or on sites designated as county landmarks or community landmarks; 2. Open space and scenic resource sites identified in the adopted King County Open Space Plan; 3. Between any sites identified in Sections 21A.20.180A.1 or 21A.20.180A.2 and the nearest adjacent public roadways; 4. Within 660 feet of any state or county park; 5. Redondo Beach Road and Redondo Way from Redondo Beach Road to 13th Avenue South; 6. South 292nd Street from 65th Avenue South to State Highway 181; 7. The south and east side of State Highway 522 from Northeast 149th Street to 68th Avenue Northeast; 8. Northeast 175th Street from 61st Avenue Northeast to 68th Avenue Northeast; 9. Rainier Avenue South from the Renton city limits to the Seattle city limits; 10. South 188th Street and Orillia Road South from 46th Avenue South to Military Road South; and 11. Within 300 feet of the intersection of South 144th Street and 51st Avenue South.B. After June 20, 1988, any billboard located in a designated billboard free area shall be deemed nonconforming and shall be relocated pursuant to K.C.C. 21A.20.160F. (Ord. 10870 § 438, 1993).21A.20.190 Community identification signs. Community identification signs are permitted subject to the following provisions:A. Only Unincorporated Activity Centers, urban planned developments or Rural Towns, or designated and delineated by the comprehensive plan, are eligible to be identified with community identification signs. Identification signs for Unincorporated Activity Centers, urban planned developments or Rural Towns shall be placed along the boundaries identified by the comprehensive plan;B. Two types of community identification signs are permitted. Primary signs are intended to mark the main arterial street entrances to a designated community, Unincorporated Activity Center, urban planned development or Rural Town. Auxiliary signs are intended to mark entrances to a designated community, Unincorporated Activity Center, urban planned development or Rural Town along local access streets;C. Primary signs are subject to the following provisions: l. No more than four primary signs shall be allowed per Unincorporated Activity Center, urban planned development, Rural Town or designated community; 2. Each primary sign shall be no more than thirty-two square feet in area and no more than six feet in height; and 3. Primary signs shall only be located along arterial streets, outside of the right-of-way;D. Auxiliary community identification signs are subject to the following provisions: 1. There shall be no limits on the number of auxiliary community identification signs allowed per Unincorporated Activity Center, urban planned development, Rural Town, or designated community; and 2. Each auxiliary sign shall be no more than two square feet, and shall be located only outside of the right-of-way; andE. No commercial advertisement shall be permitted on either primary or auxiliary signs except as follows: 1. When located on property within the RA, UR, R1-8 and R12-48 zones, signs may have a logo or other symbol of a community service or business group, such as Kiwanis, Chamber of Commerce or a similar group, sponsoring construction of the sign or signs. Any permitted logo or symbol shall be limited to an area of no more than two square feet on primary signs and no more than seventy-two square inches on auxiliary signs; or 2. When located on properties within the NB, CB, RB, O and I zones, signs may have a logo or other symbol of the company, community service or business group sponsoring construction of the sign or signs. Any permitted logo or symbol shall be limited to an area of no more than four square feet on primary signs and no more than seventy-two square inches on auxiliary signs; andF. Community identification signs shall be exempt from the provisions of K.C.C. 21A.20.060.A. that require signs to be on-premise. (17416 § 15, 2012: Ord. 16267 § 39, 2008: Ord. 13022 § 26, 1998).21A.22DEVELOPMENT STANDARDS - MINERAL EXTRACTIONSections:21A.22.010Purpose.21A.22.020Applicability of chapter.21A.22.030Grading permits required.21A.22.035Community meeting.21A.22.040Nonconforming uses regulated under this chapter.21A.22.050Periodic review.21A.22.060Site design standards.21A.22.070Operating conditions and performance standards for clearing and grading activity.21A.22.081Reclamation.21A22.085Mitigation and monitoring.21A.22.090Financial guarantees.21A.22.010 Purpose. The purpose of this chapter is to establish standards that minimize the impacts of mineral extraction or processing, coal mining, materials processing facilities and fossil fuel facilities upon surrounding properties by:A. Ensuring adequate review of operating aspects of mineral extraction or processing, coal mining, materials processing facility and fossil fuel facility sites;B. Requiring project phasing on large sites to minimize environmental impacts;C. Requiring minimum site areas large enough to provide setbacks and mitigations necessary to protect environmental quality; andD. Requiring periodic review of mineral extraction or processing, coal mining, materials processing facilities and fossil fuel facilities to ensure compliance with the approved operating standards. (Ord. 19146 § 54, 2020: Ord. 15032 § 23, 2004: Ord. 11157 § 20, 1993: Ord. 10870 § 439, 1993).21A.22.020 Applicability of chapter. This chapter shall only apply to the following uses or activities:A. Mineral extraction or processing, or both, and including SIC 10 and 14;B. Coal mining, including SIC 12;C. Materials processing facilities; andD. Fossil fuel facilities. (Ord. 19146 § 55, 2020: Ord. 15032 § 24, 2004: Ord. 10870 § 440, 1993).21A.22.030 Grading permits required. Mineral extraction or processing operations, coal mine operations and materials processing facility operations shall commence only after issuance of a grading permit by the county. (Ord. 19146 § 56, 2020: Ord. 15032 § 25, 2004: Ord. 10870 § 441, 1993).Reviser's note: Clearing and grading: See K.C.C. chapter 16.82.21A.22.035 Community meeting.A. Not later than thirty days after the department provides the notice of application to the public required by K.C.C. 20.20.060 for a use regulated under this chapter, or for an expansion of an existing use regulated under this chapter beyond the scope of the prior environmental review, the applicant shall hold a community meeting. The notice of application shall include notification of the date, time and location of the community meeting. At the meeting, the applicant shall provide information relative the proposal, including information on existing residences and lot patterns within one-quarter mile of potential sites and on alternative haul routes. The applicant shall also provide a preliminary evaluation at the meeting of any alternative routes that have been provided to the applicant in writing at least five days in advance of the meeting. The applicant shall provide to the department within fourteen days after the community meeting a written list of meeting attendees and documentation of the meeting.B. Public notice of the community meeting required by this section shall be prepared, posted and distributed in accordance with K.C.C. 20.20.060 at least two weeks before the community meeting. In addition, the department shall: 1. Publish a notice of the meeting in a local newspaper of general circulation in the affected area; 2. Mail the notice of the meeting to all property owners within one-quarter mile of the proposed or expanded site or to at least twenty of the property owners nearest to the site, whichever is greater; and 3. Mail the notice of the meeting to all property owners within five hundred feet of any proposed haul route from the site to the nearest arterial. (Ord. 19146 § 57, 2020: Ord. 17416 § 16, 2012: Ord. 15032 § 26, 2004).21A.22.040 Nonconforming uses regulated under this chapter. To the maximum extent practicable, nonconforming uses regulated under this chapter shall be brought into conformance with the operating conditions and performance standards of this chapter during permit renewal. The department shall establish a schedule for conformance during the first periodic review of the nonconforming operation or facility and incorporate such a schedule into the permit conditions. (Ord. 19146 § 58, 2020: Ord. 15032 § 27, 2004: Ord. 10870 § 442, 1993).21A.22.050 Periodic review.A. In addition to the review conducted as part of the annual renewal of a mineral extraction or processing operating permit, coal mine permit or materials processing facility permit, the department shall conduct a periodic review of mineral extraction or processing, coal mine, materials processing facility or fossil fuel facility site design, operating standards and financial responsibility at five-year intervals from the date of issuance of the permit.B. The periodic review is a Type 2 land use decision.C. The periodic review shall: 1. Determine whether the site is operating consistent with all existing permit conditions and, if not, establish corrective actions; and 2. Apply the most current site design and operating standards to the site through additional or revised permit conditions as necessary to mitigate identifiable environmental, public health and public safety impacts. (Ord. 19601 § 2, 2023: Ord. 19146 § 59, 2020: Ord. 15032 § 28, 2004: Ord. 11157 § 21, 1993: Ord. 10870 § 443, 1993).21A.22.060 Site design standards. Except as otherwise provided in K.C.C. 21A.22.040, in addition to requirements in this title, all uses regulated under this chapter shall comply with the following standards:A. The minimum site area shall be ten acres;B. On sites larger than twenty acres, activities shall occur in phases to minimize environmental impacts. The size of each phase shall be determined during the review process; C. If the department determines they are necessary to eliminate a safety hazard, fences or alternatives to fences shall be: 1. Provided in a manner that discourages access to areas of the site where: a. active extracting, processing, stockpiling and loading of materials is occurring; b. boundaries are in common with residential or commercial zone property or public lands; or c. any unstable slope or any slope exceeding a grade of forty percent is present; 2. At least six feet in height above the grade measured at a point five feet outside the fence and the fence material shall have no opening larger than two inches; 3. Installed with lockable gates at all openings or entrances; 4. No more than four inches from the ground to fence bottom; and 5. Maintained in good repair; D. Warning and trespass signs advising of the use shall be placed on the perimeter of the site adjacent to RA, UR or R zones at intervals no greater than two hundred feet along any unfenced portion of the site where the items noted in subsection C.1. of this section are present;E. Structural setbacks from property lines shall be as follows: 1. Buildings, structures and stockpiles used in the processing of materials shall be no closer than: a. one hundred feet from any residential zoned properties except that the setback may be reduced to fifty feet when the grade where such building or structures are proposed is fifty feet or greater below the grade of the residential zoned property; b. fifty feet from any other zoned property, except when adjacent to another use regulated under this chapter; c. the greater of fifty feet from the edge of any public street or the setback from residential zoned property on the far side of the street; and 2. Offices, scale facilities, equipment storage buildings and stockpiles, including those for reclamation, shall not be closer than fifty feet from any property line except when adjacent to another use regulated under this chapter or M or F zoned property. Facilities necessary to control access to the site, when demonstrated to have no practical alternative, may be located closer to the property line;F. On-site clearing, grading or excavation, excluding that necessary for required access, roadway or storm drainage facility construction or activities in accordance with an approved reclamation plan, shall not be permitted within fifty feet of any property line except along any portion of the perimeter adjacent to another use regulated under this chapter or M or F zoned property. If native vegetation is restored, temporary disturbance resulting from construction of noise attenuation features located closer than fifty feet shall be permitted;G. Landscaping consistent with type 1 screening K.C.C. chapter 21A.16, except using only plantings native to the surrounding area, shall be provided along any portion of the site perimeter where site disturbances associated with a use regulated under this chapter are performed, except where adjacent to another use regulated under this chapter, forestry operation or M or F-zoned property;H. Relevant clearing and grading operating standards from K.C.C. chapter 16.82 shall be applied; andI. Lighting shall: 1. Be limited to that required for security, lighting of structures and equipment, and vehicle operations; and 2. Not directly glare onto surrounding properties. (Ord. 19146 § 60, 2020: Ord. 15032 § 29, 2004: Ord. 11621 § 67, 1994: Ord. 11157 § 22, 1993: Ord. 10870 § 444, 1993).21A.22.070 Operating conditions and performance standards for clearing and grading activity. Operating conditions and performance standards for all clearing and grading activity for a use regulated under this chapter shall be as specified in K.C.C. chapter 16.82 except:A.1. Noise levels shall not exceed levels specified by K.C.C. chapter 12.86; 2. Hours of operation, unless otherwise specified by the director, shall be between 7:00 a.m. and 7:00 p.m. Monday through Saturday and between 10:00 a.m. and 5:00 p.m. Sunday and holidays; 3. Before approving any variation of the hours of operation, the department shall: a. determine whether on-site operations can comply with nighttime noise standards in accordance with K.C.C. 12.86.110, and K.C.C. 12.86.120; b. determine whether the variance would cause significant adverse noise impacts to the community in accordance with standards and methodologies developed by the Federal Transit Administration, Federal Highway Administration or World Health Organization, or any combination thereof, for evaluating noise impacts, or other comparable standards and methods; and c. require mitigation for any identified impacts before the department approves a variation in the hours of operation; and 4. The director's decision to approve a variation in the hours of operation shall be in writing and shall include a specific finding of compliance with the noise standards, the facts and conclusions supporting that finding and any mitigation, conditions or limitations imposed. All decisions made under this subsection shall be compiled by the department and made available for public inspection;B. Blasting shall be conducted under an approved blasting plan: 1. Consistent with the methods specified in the Office of Surface Mining Enforcement and Reclamation 1987 Blasting Guidance Manual in a manner that protects from damage all structures, excluding those owned and directly used by the operator, and persons in the vicinity of the blasting area, including, but not limited to, adherence to the following: a. Airblast levels shall not exceed one hundred thirty-three decibels measured by a two Hz or lower flat response system at the nearest residential property or place of public assembly; b. Flyrock shall not be cast one-half the distance to the nearest residential property, place of public assembly or the property boundary, whichever is less. For the purposes of this subsection B.1.b., "property boundary" means an imaginary line exterior to any enclosed structure, at ground surface, which separates the property of one or more persons from that owned by others, and its vertical extension; and c. Ground motion shall not exceed ground vibration levels damaging to structures using one of the four accepted methods in the Office of Surface Mining Enforcement and Reclamation 1987 Blasting Guidance Manual; 2. During daylight hours; and 3. According to a time schedule, provided to residents within one-half mile of the site, that features regular or predictable times, except in the case of an emergency. If requested by a resident, the operator shall provide notice of changes in the time schedule at least twenty four hours before the changes take effect;C.1. Dust and smoke shall be controlled by best management practices to comply with relevant regulations of the Puget Sound Clean Air Agency. 2. Dust and smoke shall be controlled in accordance with a valid operating permit from the Puget Sound Clean Air Agency, when required. Copies of the permit shall be kept onsite and available for department and public inspection. Copies of the Puget Sound Clean Air Agency monitoring results shall be provided to the department on permit monitoring data submittal dates. 3. Dust and smoke shall not significantly increase the existing levels of suspended particulates at the perimeter of the site;D. The applicant shall prevent rocks, dirt, mud and any raw or processed material from spilling from or being tracked by trucks onto public roadways and shall be responsible for cleaning debris or repairing damage to roadways caused by the operation;E. The applicant shall provide traffic control measures such as flaggers or warning signs as determined by the department during all hours of operation;F. The operator shall control surface water and site discharges to comply with K.C.C. chapter 9.04 and the surface water design manual and K.C.C. chapter 9.12 and the stormwater pollution prevention manual. For the life of the operation and until site reclamation is complete, the operator shall maintain a valid Washington state Department of Ecology National Pollutant Discharge Elimination System individual permit or maintain coverage under the sand and gravel general permit. The operator shall keep onsite and available for department review copies of the erosion and sediment control plan, the applicable National Pollution Discharge Elimination System individual or general permit and the Stormwater Pollution Prevention Plan. The operator shall make the plans and permit available for public inspection upon request. The operator shall provide to the department copies of the monitoring results on permit monitoring data submittal dates. The department shall make the monitoring results available for public inspection. If the department determines that National Pollution Discharge Elimination System monitoring frequency or type is not adequate to meet the demands of the site and the requirements of this subsection, the department may require more frequent and detailed monitoring and may require a program designed to bring the site into compliance;G. The operator shall not excavate below the contours determined through hydrologic studies necessary to protect groundwater and the upper surface of the saturated groundwater that could be used for potable water supply;H. If contamination of surface or ground water by herbicides is possible, to the maximum extent practicable, mechanical means shall be used to control noxious weeds on the site;I. Upon depletion of resources or abandonment of the site, the operator shall remove all structures, equipment and appurtenances accessory to operations; andJ. If the operator fails to comply with this section, the department shall require modifications to operations, procedures or equipment until compliance is demonstrated to the satisfaction of the department. If the modifications are inconsistent with the approved permit conditions, the department shall revise the permit accordingly. (Ord. 19146 § 61, 2020: Ord. 18000 § 103, 2015: Ord. 15032 § 30, 2004: Ord. 11621 § 68, 1994: Ord. 10870 § 445, 1993).21A.22.081 ReclamationA. A valid clearing and grading permit shall be maintained on a mineral extraction or coal mine site until the reclamation of the site required under chapter 78.44 RCW is completed.B. A reclamation plan approved in accordance with chapter 78.44 RCW shall be submitted before the effective date of a zone reclassification in Mineral-zoned properties or the acceptance of any development proposal for a subsequent use in Forest-zoned properties. The zone reclassification shall grant potential zoning that is only to be actualized, under K.C.C. chapter 20.22, upon demonstration of successful completion of all requirements of the reclamation plan. Development proposals in the Forest zone for uses subsequent to mineral extraction or coal mine operations shall not be approved until demonstration of successful completion of all requirements of the reclamation plan except that forestry activities may be permitted on portions of the site already fully reclaimed.C. Mineral extraction and coal mine operations that are not required to have an approved reclamation plan under chapter 78.44 RCW shall meet the following requirements: 1. Upon the exhaustion of minerals or materials or upon the permanent abandonment of the quarrying or mining operation, all nonconforming buildings, structures, apparatus or appurtenances accessory to the quarrying and mining operation shall be removed or otherwise dismantled to the satisfaction of the director; 2. Final grades shall: a. be such so as to encourage the uses permitted within the primarily surrounding zone or, if applicable, the underlying or potential zoning classification; and b. result in drainage patterns that reestablish natural conditions of water velocity, volume, and turbidity within six months of reclamation and that precludes water from collecting or becoming stagnant. Suitable drainage systems approved by the department shall be constructed or installed where natural drainage conditions are not possible or where necessary to control erosion. All constructed drainage systems shall be designed consistent with the Surface Water Design Manual; 3. All areas subject to grading or backfilling shall: a. incorporate only nonnoxious, nonflammable, noncombustible and nunputrescible solids; and b. except for roads and areas incorporated into drainage facilities, be surfaced with soil of a quality at least equal to the topsoil of the land areas immediately surrounding, and to a depth of the topsoil of land area immediately surrounding six inches, whichever is greater. The topsoil layer shall have an organic matter content of eight to thirteen percent and a pH of 6.0 to 8.0 or matching the pH of the original undisturbed soil layer. Compacted areas such as pit floors or compacted fill shall be tilled or scarified before topsoil placement; 4. All reclaimed slopes shall comprise an irregular sinuous appearance in both profile and plan view and blend with adjacent topography to a reasonable extent; 5. Where excavation has penetrated the seasonal or permanent water table creating a water body or wetland: a. All side slopes below the permanent water table and banks shall be graded or shaped as to not constitute a safety hazard; b. Natural features and plantings to provide beneficial wetland functions and promote wildlife habitat shall be provided; and c. Appropriate drainage controls shall be provided to stabilize the water level and not create potential flooding hazards; 6. All cleared, graded or backfilled areas, including areas surfaced with topsoil, shall be planted with a variety of trees, shrubs, legumes and grasses indigenous to the surrounding area and appropriate for the soil, moisture and exposure conditions; 7. Waste or soil piles shall be used for grading, backfilling or surfacing if permissible under this section, then covered with topsoil and planted in accordance with subsection C.3. and 6. of this section. Waste or soil piles not acceptable to be used for fill in accordance with this chapter or as top soil in accordance with subsection C.3. of this section shall be removed from the site; and 8. Where excavation has exposed natural materials that may create polluting conditions, including, but not limited to, acid-forming coals and metalliferous rock or soil, such conditions shall be addressed to the satisfaction of the department. The final ground surface shall be graded so that surface water drains away from any such materials remaining on the site.D. The department may modify any requirement of this section when not applicable or if it conflicts with an approved subsequent use for the site. (Ord. 19146 § 62, 2020: Ord. 18230 § 128, 2016: Ord. 15032 § 32, 2004; Ord. 14199 § 223, 2001: Ord. 3108 § 9, 1977: Ord. 1488 § 12, 1973. Formerly 16.82.110).21A.22.085 Mitigation and monitoring. The applicant shall mitigate adverse impacts resulting from the use regulated under this chapter and monitor to demonstrate compliance with this chapter. (Ord. 19146 § 63, 2020: Ord. 15032 § 34, 2004).21A.22.090 Financial guarantees. Financial guarantees shall be required consistent with K.C.C. Title 27A. (Ord. 15032 § 35, 2004: Ord. 12020 § 53, 1995: Ord. 11157 § 24, 1993: Ord. 10870 § 447, 1993).21A.23SEA LEVEL RISE RISK AREASections:21A.23.010Standards in sea level rise risk area - notice.21A.23.020Sea level rise risk area variance approval – determiniation – application – notice – review – records retention.21A.23.010 Standards in sea level rise risk area - notice. Within the sea level rise risk area the following standards apply:A. All new, substantially improved, or converted residential or nonresidential buildings shall be elevated on pilings and columns in a manner consistent with applicable floodplain development standards in this title, K.C.C. Title 16, the Federal Emergency Management Agency Coastal Construction Manual and other applicable requirements, and in a manner that provides the following, at a minimum: 1. The bottom of the lowest horizontal structural member of the lowest floor, excluding the pilings or columns, is elevated to or above the sea level rise protection elevation; 2. The pile or column foundation and building attached thereto is anchored to resist flotation, collapse and lateral movement due to the effects of flood water, wind and other loads as prescribed in this title acting simultaneously on all building components. Wind and water loading values shall each have a one percent chance of being equaled or exceeded in any given year; and 3. All building utilities are elevated to or above the flood protection elevation.B. A registered professional engineer licensed by the state of Washington shall prepare the structural design, specifications and plans for the building, and shall certify that the design and methods of construction to be used are in accordance with accepted standards of practice for meeting the provisions of subsection A. of this section, including applicable floodplain development standards in this title, K.C.C. Title 16, the Federal Emergency Management Agency Coastal Construction Manual and other applicable requirements;C. The applicant shall provide a complete Federal Emergency Management Agency elevation certificate on the most current version of the form completed by a land surveyor licensed by the state of Washington documenting the elevation of the bottom of the lowest structural member of the lowest floor, excluding pilings and columns, of all new and substantially improved buildings and additions affixed to the side of a building. The elevation certificate should note whether or not the buildings contain a basement. The department shall maintain the Federal Emergency Management Agency elevation certificates required by this section for public inspection and for certification under the National Flood Insurance Program;D. All new buildings and substantial improvements to existing buildings shall maintain the space below the lowest floor free of obstruction. Breakaway walls are prohibited. The space can include nonsupporting open wood lattice-work or insect screening that is intended to collapse under wind and wave loads without causing collapse, displacement or other structural damage to the elevated portion of the building or supporting foundation system. The space below the lowest floor can be used only for parking of vehicles, building access or limited storage of readily removable items. The space shall not be used for human habitation;E. Fill for structural support of buildings is prohibited;F. All manufactured homes to be placed or substantially improved within the sea level rise risk area shall meet the standards in subsections A. through E. of this section; andG. The department shall provide notice to all applicants for new development or redevelopment located within the sea level rise risk area that the development may be impacted by sea level rise and recommend that the applicant voluntarily consider setting the development back further than required by this title to allow for future sea level rise. (Ord. 19146 § 65, 2020).21A.23.020 Sea level rise risk area variance approval – determiniation – application – notice – review – records retention.A. The director may approve sea level rise risk area variances to this chapter. In reviewing and evaluating sea level rise risk area variance applications, the director shall consider all technical evaluations and relevant factors, including, but not limited to: 1. The danger that materials may be swept onto other lands to the injury of others; 2. The danger to life and property due to coastal flooding or erosion damage; 3. The susceptibility of the proposed building or facility and its contents to flood damage and the effect of the damage on the individual owner; 4. The importance of the services provided by the proposed building or facility to the community; 5. The necessity to the building or facility of a waterfront location; 6. The availability of alternative locations for the proposed use that are not subject to flooding or erosion damage; 7. The potential of the proposed development to create an adverse effect on a federally or state-protected species or habitat; 8. The compatibility of the proposed use with existing and anticipated development; 9. The relationship of the proposed use to the Comprehensive Plan, shoreline master program and Flood Management Plan; 10. The safety of access to the property in times of flooding for ordinary and emergency vehicles; 11. The expected heights, velocity, duration, rate of rise, sediment transport of the floodwaters and effects of wave action expected at the site; 12. The costs of providing governmental services during and after flood conditions, including emergency management services and maintenance and repair of public utilities and facilities such as sewer, gas, electrical, water systems, streets and bridges; and 13. Current and future risks from sea level rise conditions anticipated to occur over the next fifty years.B. The director may only approve a sea level rise risk area variance upon a determination that: 1. Failure to grant the sea level rise risk area variance would result in an exceptional hardship to the applicant; 2. The granting of a sea level rise risk area variance will not result in additional threats to public safety, extraordinary public expense, create nuisances, cause fraud on or victimization of the public or conflict with existing laws or ordinances; and 3. The sea level rise risk area variance is the minimum necessary, considering the flood or erosion hazard, to afford relief.C. An applicant for sea level rise risk area variance shall be given a written notice that the approval of the sea level rise risk area variance to construct a structure below the sea level rise protection elevation established in this chapter may result in higher future flood insurance premium rates up to amounts as high as twenty-five dollars per one hundred dollars of coverage and that the construction below the sea level rise protection elevation increases risks to life and property.D.1. An application for a sea level rise risk area variance shall be submitted in writing to the department of local services, permitting division, together with any supporting documentation that demonstrates how the proposal meets the criteria in this section. 2. An application for a sea level rise risk area variance under this section shall be reviewed as a Type II land use decision in accordance with K.C.C. 20.20.020. 3. Sea level rise risk area variances that allow the establishment of a use not otherwise permitted in the zone where the proposal is located shall not be permitted. 4. The variance standards in K.C.C. 21A.44.030 and the alteration exception standards in K.C.C. 21A.24.070 shall not be used for variances to the sea level rise risk area regulations of this chapter. 5. The department shall maintain in perpetuity a record of all requests for variances, including justification for their issuance. (Ord. 19820 § 9, 2024: Ord. 19146 § 66, 2020).21A.24CRITICAL AREAS (Formerly Environmentally Sensitive Areas)Sections:21A.24.010Purpose.21A.24.020Applicability.21A.24.030Appeals.21A.24.040Rules.21A.24.045Allowed alterations.21A.24.051Agricultural activities development standards.21A.24.055Rural stewardship plans.21A.24.061Public rules for rural stewardship and farm management plans.21A.24.065Basin and Shoreline Conditions Map.21A.24.070Alteration exception.21A.24.072Alteration exception-alternative.21A.24.090Disclosure by applicant.21A.24.100Critical area review.21A.24.110Critical area report requirement.21A.24.125Avoiding impacts to critical areas.21A.24.130Mitigation and monitoring.21A.24.133Off-site mitigation.21A.24.137Approval of mitigation through mitigation reserves program.21A.24.140Financial guarantees.21A.24.160Critical area markers and signs.21A.24.170Notice of critical areas.21A.24.180Critical area tracts and designations on site plans.21A.24.185Vegetation management plans.21A.24.200Building setbacks.21A.24.205Coal mine hazard areas - classifications.21A.24.210Coal mine hazard areas - development standards and alterations.21A.24.220Erosion hazard areas - development standards and alterations.21A.24.223Purpose of K.C.C. 21A.24.225 through K.C.C. 21A.24.272.21A.24.224Definitions for K.C.C. 21A.24.223 through K.C.C. 21A.24.272.21A.24.226Approval of variance to floodplain development regulations not otherwise allowed by chapter by director – considerations for review – riquirements – concurrence with critical areas alteration exemption request – notice – supplication requirements for submittal, review – certain variance standards not to be used.21A.24.228Approval of variances to nonresidential elevation and dry floodproofing standards for certain agricultural buildings – application – maintenance of requests – certain standards not to be used.21A.24.230Regulated flood hazard areas – components – delineation – proof area is subject to inundation by base flood in action to enforce K.C.C. Title 23 compliance.21A.24.240Zero-rise flood fringe - development standards and alterations.21A.24.250Zero-rise floodway - development standards and alterations.21A.24.260FEMA floodway - development standards and alterations.21A.24.270Flood hazard areas - certification by land surveyor21A.24.2705Flood hazard areas - appeals of actions alleging alterations without permits.21A.24.271Floodplain development permit.21A.24.272Coastal high hazard areas - development standards - exceptions to flood hazard standards.21A.24.274Channel migration - adoption of criteria, studies and maps - study delineating channel migration zone and component channel migration hazard areas.21A.24.275Channel migration zones - development standards and alterations.21A.24.280Landslide hazard areas - development standards and alterations.21A.24.290Seismic hazard areas - development standards and alterations.21A.24.300Volcanic hazard areas - development standards and alterations.21A.24.310Steep slope hazard areas - development standards and alterations.21A.24.311Critical aquifer recharge areas - maps adopted.21A.24.312Critical aquifer recharge areas - reclassification or declassification.21A.24.313Critical aquifer recharge areas - categories.21A.24.314Critical aquifer recharge areas - King County Code provisions adopted - Washington state underground tank provisions implemented.21A.24.315Board of Health regulations adopted.21A.24.316Critical aquifer recharge areas - development standards.21A.24.318Wetlands - identification of and delineation of boundaries – categories.21A.24.325Wetlands – buffers.21A.24.335Wetlands - development standards and alterations.21A.24.340Wetlands - specific mitigation requirements.21A.24.342Wetlands - agreement to modify mitigation ratios.21A.24.345Specific mitigation requirements - wetland mitigation banking.21A.24.355Aquatic areas - water types.21A.24.358Aquatic areas - buffers.21A.24.365Aquatic areas - development standards and alterations.21A.24.380Aquatic areas - specific mitigation requirements.21A.24.381Aquatic habitat restoration project approval.21A.24.382Wildlife habitat conservation areas - development standards.21A.24.383Wildlife habitat conservation areas - modification.21A.24.385Wildlife habitat networks - applicability.21A.24.386Wildlife habitat networks - development standards and alterations.21A.24.388Wildlife habitat conservation areas and wildlife networks - specific mitigation requirements.21A.24.500Critical area designation.21A.24.510Septic system design and critical area designation.21A.24.515Critical areas monitoring.21A.24.520Buffer modifications to achieve zoned density.21A.24.530Vesting period for lots in final short plats.21A.24.540Reliance upon standards established through critical area review of a previously approved conditional use permit.21A.24.550Consolidated site review for single-family residential development.21A.24.560Vesting of an approved on-site sewage disposal system.21A.24.010 Purpose. The purpose of this chapter is to implement the goals and policies of the Growth Management Act, chapter 3670A RCW, Washington state Environmental Policy Act, chapter 43.21C RCW, and the King County Comprehensive Plan, which call for protection of the natural environment and the public health and safety by:A. Establishing development and alteration standards to protect functions and values of critical areas;B. Protecting members of the general public and public resources and facilities from injury, loss of life, property damage or financial loss due to flooding, erosion, avalanche, landslides, seismic and volcanic events, soil subsidence or steep slope failures;C. Protecting unique, fragile and valuable elements of the environment including, but not limited to, fish and wildlife and their habitats, and maintaining and promoting countywide native biodiversity;D. Requiring mitigation of unavoidable impacts to critical areas, by regulating alterations in or near critical areas;E. Preventing cumulative adverse environmental impacts on water availability, water quality, ground water, wetlands and aquatic areas;F. Measuring the quantity and quality of wetland and aquatic area resources and preventing overall net loss of wetland and aquatic area functions;G. Protecting the public trust as to navigable waters, aquatic resources, and fish and wildlife and their habitat;H. Meeting the requirements of the National Flood Insurance Program and maintaining King County as an eligible community for federal flood insurance benefits;I. Alerting members of the public including, but not limited to, appraisers, owners, potential buyers or lessees to the development limitations of critical areas; andJ. Providing county officials with sufficient information to protect critical areas. (Ord. 15051 § 131, 2004: Ord. 11621 § 69, 1994: 10870 § 448, 1993).21A.24.020 Applicability.A. This chapter applies to all land uses in King County, and all persons within the county shall comply with this chapter.B. King County shall not approve any permit or otherwise issue any authorization to alter the condition of any land, water or vegetation or to construct or alter any structure or improvement without first ensuring compliance with this chapter.C. Approval of a development proposal in accordance with this chapter does not discharge the obligation of the applicant to comply with this chapter.D. When any other chapter of the King County Code conflicts with this chapter or when the provisions of this chapter are in conflict, the provision that provides more protection to environmentally critical areas apply unless specifically provided otherwise in this chapter or unless the provision conflicts with federal or state laws or regulations.E. This chapter applies to all forest practices over which the county has jurisdiction under chapter 76.09 RCW and Title 222 WAC. (Ord. 15051 § 132, 2004: Ord. 10870 § 449, 1993).21A.24.030 Appeals. An applicant may appeal a decision to approve, condition or deny a development proposal based on K.C.C. chapter 21A.24 according to and as part of the appeal procedure for the permit or approval involved as provided in K.C.C. 20.20.020. (Ord. 15051 § 133, 2004: Ord. 10870 § 450, 1993).21A.24.040 Rules. Applicable departments within King County are authorized to adopt, in accordance with K.C.C. chapter 2.98, such public rules and regulations as are necessary and appropriate to implement K.C.C. chapter 21A.24 and to prepare and require the use of such forms as are necessary to its administration. (Ord. 15051 § 134, 2004: Ord. 10870 § 451, 1993).21A.24.045 Allowed alterations.A. Within the following seven critical areas and their buffers all alterations are allowed if the alteration complies with the development standards, impact avoidance and mitigation requirements and other applicable requirements established in this chapter: 1. Critical aquifer recharge area; 2. Coal mine hazard area; 3. Erosion hazard area; 4. Flood hazard area except in the severe channel migration hazard area; 5. Landslide hazard area under forty percent slope; 6. Seismic hazard area; and 7. Volcanic hazard areas.B. Within the following seven critical areas and their buffers, unless allowed as an alteration exception under K.C.C. 21A.24.070, only the alterations on the table in subsection C. of this section are allowed if the alteration complies with conditions in subsection D. of this section and the development standards, impact avoidance and mitigation requirements and other applicable requirements established in this chapter: 1. Severe channel migration hazard area; 2. Landslide hazard area over forty percent slope; 3. Steep slope hazard area; 4. Wetland; 5. Aquatic area; 6. Wildlife habitat conservation area; and 7. Wildlife habitat network.C. In the following table where an activity is included in more than one activity category, the numbered conditions applicable to the most specific description of the activity governs. Where more than one numbered condition appears for a listed activity, each of the relevant conditions specified for that activity within the given critical area applies. For alterations involving more than one critical area, compliance with the conditions applicable to each critical area is required.A= alternation is allowed Numbers indicate applicable development condition in subsection D. of this sectionLandslide Hazard Over 40% and BufferSteep Slope Hazard and BufferWetland and BufferAquatic Area and Buffer and Severe Channel MigrationWildlife Habitat Conservation Area and Wildlife Habitat NetworkStructures Construction of new single detached dwelling unitA 1A 2Construction of a new tree-supported structureA 64A 64A 64Construction of nonresidential structure A 3A 3A 3, 4Maintenance or repair of existing structureA 5AA A A 4Expansion or replacement of existing structureA 5, 7A 5, 7A 7, 8A 6, 7, 8A 4, 7Interior remodelingAAAAA Construction of new dock or pierA 9A 9, 10, 11Maintenance, repair or replacement of dock or pierA 12A 10, 11A 4GradingGradingA 13A 14A 4, 14Construction of new slope stabilizationA 15A 15A 15A 15A 4, 15Maintenance of existing slope stabilizationA 16A 13A 17A 16, 17A 4Mineral extractionA A ClearingClearing A 18A 18 A 18, 20A 14, 18, 20A 4, 14, 18, 20Cutting firewood A 21A 21A 21A 4, 21Vegetation managementA 19A 19A 19A 19A 4, 19Removal of vegetation for fire safetyA 22A 22A 22A 22A 4, 22Removal of noxious weeds or invasive vegetationA 23A 23A 23A 23A 4, 23Forest PracticesForest management activityA A AA A 25RoadsConstruction of new public road right-of-way structure on unimproved right-of-wayA 26A 26Construction of new road in a platA 26A 26Maintenance of public road right-of-way structureA 16A 16A 16A 16A 16, 27 Expansion beyond public road right-of way structureA A A 26A 26Repair, replacement or modification within the roadwayA 16A 16A 16A 16A 16, 27 Construction of driveway or private access roadA 28A 28A 28A 28A 28Construction of farm field access driveA 29A 29A 29A 29A 29Maintenance of driveway, private access road, farm field access drive or parking lotA A A 17A 17A 17, 27Construction of a bridge or culvert as part of a driveway or private access roadA 39A 39A 39A 39A 39Bridges or culvertsMaintenance or repair of bridge or culvert A 16, 17A 16, 17A 16, 17A 16, 17A 16, 17, 27Construction of a new bridgeA 16, 39A 16, 39A 16, 39A16, 39A 4, 16, 39Replacement of bridge or culvertA 16A 16A 16A 16, 30A 16, 27Expansion of bridge or culvertA 16, 17A 16, 17A 16, 17, 31A 17, 31A 4Utilities and other infrastructureConstruction of new utility corridor or utility facilityA 32, 33A 32, 33A 32, 34A 32, 34A 27, 32, 35Construction or maintenance of a hydroelectric generating facilityA 67A 67A 66A 66A 4, 66Construction of a new residential utility service distribution lineA 32, 33A 32, 33A 32, 60A 32, 60A 27, 32, 60Maintenance, repair or replacement of utility corridor or utility facilityA 32, 33A 32, 33A 32, 34, 36 A 32, 34, 36A 4, 32, 37Construction of a new on-site sewage disposal system or wellA 24A 24A 63A 63Maintenance or repair of existing wellA 37A 37A 37A 37A 4, 37Maintenance or repair of on-site sewage disposal systemAAAA 37A 4Construction of new surface water conveyance system A 32, 33A 32, 33A 32, 38A 32, 38A 4Construction, maintenance or repair of in-water heat exchangerA 68A 68Maintenance, repair or replacement of existing surface water conveyance system A 33A 33 A 16, 32, 38A 16, 40, 41 A 4, 37Construction of new surface water flow control or surface water quality treatment facilityA 32A 32A 4, 32Maintenance or repair of existing surface water flow control or surface water quality treatment facilityA 16A 16A 16A 16A 4Construction of new flood protection facilityA 42A 42A 27, 42Maintenance, repair or replacement of flood protection facility A 33, 43A 33, 43A 43A 43A 27, 43Flood risk reduction gravel removalA 61A 61A 61A 61A 61Construction of new instream structure or instream workA 16A 16A 16A 16, 44, 45A 4, 16, 44, 45Maintenance or repair of existing instream structure A 16A A A A 4RecreationConstruction of new trailA 46A 46A 47A 47A 4, 47Maintenance of outdoor public park facility, trail or publicly improved recreation area A 48A 48A 48A 48A 4, 48Habitat, education and science projectsHabitat restoration or enhancement project A 49A 49A 49A 49A 4, 49Scientific sampling for salmonidsA 50A 50A 50Drilling and testing for critical areas reportA 51A 51A 51, 52A 51, 52A 4Environmental education projectA 62A 62A 62A 62A 62Agriculture Horticulture activity including tilling, discing, planting, seeding, harvesting, preparing soil, rotating crops and related activity A 53A 53A 53, 54A 53, 54A 53, 54Grazing livestockA 53A 53A 53, 54A 53, 54A 53, 54Construction or maintenance of a commercial fish farmA 53, 54A 53, 54A 53, 54Construction or maintenance of livestock manure storage facilityA 53, 54, 55A 53, 54, 55, 56A 53, 54Construction of a livestock heavy use areaA 53, 54, 55A 53, 54, 55, 56A 53, 54Construction or maintenance of a farm padA 56A 56Construction of agricultural drainageA 57A 57A 4, 57Maintenance or replacement of agricultural drainage A 23, 58A 23, 58A 23, 53, 54, 58A 23, 53, 54, 58A 4, 23, 53, 54, 58Maintenance of agricultural waterwayA 69A 69Construction or maintenance of farm pond, fish pond or livestock watering pondA 53A 53A 53, 54A 53, 54A 53, 54OtherShoreline water dependent or shoreline water oriented useA 65Excavation of cemetery graves in established and approved cemeteryAAAAA Maintenance of cemetery graves A A A A A Maintenance of lawn, landscaping or garden for personal consumptionA 59A 59A 59A 59A 59Maintenance of golf course A 17A 17 A 17A 17 A 4, 17D. The following alteration conditions apply: 1. Limited to farm residences in grazed or tilled wet meadows and subject to the limitations of subsection D.3. of this section. 2. Only allowed in a buffer of a lake that is twenty acres or larger on a lot that was created before January 1, 2005, if: a. at least seventy-five percent of the lots abutting the shoreline of the lake or seventy-five percent of the lake frontage, whichever constitutes the most developable lake frontage, has existing density of four dwelling units per acre or more; b. the development proposal, including mitigation required by this chapter, will have the least adverse impact on the critical area; c. existing native vegetation within the critical area buffer will remain undisturbed except as necessary to accommodate the development proposal and required building setbacks; d. access is located to have the least adverse impact on the critical area and critical area buffer; e. the site alteration is the minimum necessary to accommodate the development proposal and in no case in excess of five thousand square feet; f. the alteration is no closer than: (1) on a site with a shoreline environment designation of high intensity or residential, the greater of twenty-five feet or the average of the setbacks on adjacent lots on either side of the subject property, as measured from the ordinary high water mark of the lake shoreline; (2) on a site with a shoreline environment designation of rural, conservancy, resource or forestry, the greater of fifty feet or the average of the setbacks on adjacent lots on either side of the subject property, as measured from the ordinary high water mark; and (3) on a site with a shoreline environment designation of natural, the greater of one hundred feet or the average of the setbacks on adjacent lots on either side of the subject property, as measured from the ordinary high water mark; and g. to the maximum extent practical, alterations are mitigated on the development proposal site by enhancing or restoring remaining critical area buffers. 3. Limited to nonresidential farm-structures in grazed or tilled wet meadows or buffers of wetlands or aquatic areas where: a. the site is predominantly used for the practice of agriculture; b. the structure is in compliance with an approved farm management plan in accordance with K.C.C. 21A.24.051; c. the structure is either: (1) on or adjacent to existing nonresidential impervious surface areas, additional impervious surface area is not created waterward of any existing impervious surface areas and the area was not used for crop production; (2) higher in elevation and no closer to the critical area than its existing position; or (3) at a location away from existing impervious surface areas that is determined to be the optimum site in the farm management plan; d. all best management practices associated with the structure specified in the farm management plan are installed and maintained; e. installation of fencing in accordance with K.C.C. chapter 21A.30 does not require the development of a farm management plan if required best management practices are followed and the installation does not require clearing of critical areas or their buffers; and f. in a severe channel migration hazard area portion of an aquatic buffer only if: (1) there is no feasible alternative location on-site; (2) the structure is located where it is least subject to risk from channel migration; (3) the structure is not used to house animals or store hazardous substances; and (4) the total footprint of all accessory structures within the severe channel migration hazard area will not exceed the greater of one thousand square feet or two percent of the severe channel migration hazard area on the site. 4. No clearing, external construction or other disturbance in a wildlife habitat conservation area is allowed during breeding seasons established under K.C.C. 21A.24.382. 5. Allowed for structures when: a. the landslide hazard poses little or no risk of injury; b. the risk of landsliding is low; and c. there is not an expansion of the structure. 6. Within a severe channel migration hazard area allowed for: a. existing legally established primary structures if: (1) there is not an increase of the footprint of any existing structure; and (2) there is not a substantial improvement as defined in K.C.C. 21A.06.1270; and b. existing legally established accessory structures if: (1) additions to the footprint will not make the total footprint of all existing structures more than one-thousand square feet; and (2) there is not an expansion of the footprint towards any source of channel migration hazard, unless the applicant demonstrates that the location is less subject to risk and has less impact on the critical area. 7. Allowed only in grazed wet meadows or the buffer or building setback outside a severe channel migration hazard area if: a. the expansion or replacement does not increase the footprint of a nonresidential structure; b.(1) for a legally established dwelling unit, the expansion or replacement, including any expansion of a legally established accessory structure allowed under this subsection B.7.b., does not increase the footprint of the dwelling unit and all other structures by more than one thousand square feet, not including any expansion of a drainfield made necessary by the expansion of the dwelling unit. To the maximum extent practical, the replacement or expansion of a drainfield in the buffer should be located within areas of existing lawn or landscaping, unless another location will have a lesser impact on the critical area and its buffer; (2) for a structure accessory to a dwelling unit, the expansion or replacement is located on or adjacent to existing impervious surface areas and does not result in a cumulative increase in the footprint of the accessory structure and the dwelling unit by more than one thousand square feet; (3) the location of the expansion has the least adverse impact on the critical area; and (4) a comparable area of degraded buffer area shall be enhanced through removal of nonnative plants and replacement with native vegetation in accordance with an approved landscaping plan; c. the structure was not established as the result of an alteration exception, variance, buffer averaging or reasonable use exception; d. to the maximum extent practical, the expansion or replacement is not located closer to the critical area or within the relic of a channel that can be connected to an aquatic area; and e. The expansion of a residential structure in the buffer of a Type S aquatic area that extends towards the ordinary high water mark requires a shoreline variance if: (1) the expansion is within thirty-five feet of the ordinary high water mark; or (2) the expansion is between thirty-five and fifty feet of the ordinary high water mark and the area of the expansion extending towards the ordinary high water mark is greater than three hundred square feet. 8. Allowed upon another portion of an existing impervious surface outside a severe channel migration hazard area if: a. except as otherwise allowed under subsection D.7. of this section, the structure is not located closer to the critical area; b. except as otherwise allowed under subsection D.7. of this section, the existing impervious surface within the critical area or buffer is not expanded; and c. the degraded buffer area is enhanced through removal of nonnative plants and replacement with native vegetation in accordance with an approved landscaping plan. 9. Limited to piers or seasonal floating docks in a category II, III or IV wetland or its buffer or along a lake shoreline or its buffer where: a. the vegetation where the alteration is proposed does not consist of dominant native wetland herbaceous or woody vegetation six feet in width or greater and the lack of this vegetation is not the result of any violation of law; b. the wetland or lake shoreline is not a salmonid spawning area; c. hazardous substances or toxic materials are not used; and d. if located in a freshwater lake, the pier or dock conforms to the standards for docks under K.C.C. 21A.25.180. 10. Allowed on type N or O aquatic areas if hazardous substances or toxic materials are not used. 11. Allowed on type S or F aquatic areas outside of the severe channel migration hazard area if in compliance with K.C.C. 21A.25.180. 12. When located on a lake, must be in compliance with K.C.C. 21A.25.180. 13. Limited to regrading and stabilizing of a slope formed as a result of a legal grading activity. 14. The following are allowed in the severe channel migration hazard area if conducted more than one hundred sixty-five feet from the ordinary high water mark in the rural area and natural resource lands and one-hundred fifteen feet from the ordinary high water mark in the urban area: a. grading of up to fifty cubic yards on lot less than five acres; and b. clearing of up to one-thousand square feet or up to a cumulative thirty-five percent of the severe channel migration hazard area. 15. Only where erosion or landsliding threatens a structure, utility facility, roadway, driveway, public trails, aquatic area or wetland if, to the maximum extent practical, stabilization work does not disturb the slope and its vegetative cover and any associated critical areas. 16. Allowed when performed by, at the direction of or authorized by a government agency in accordance with regional road maintenance guidelines. 17. Allowed when not performed under the direction of a government agency only if: a. the maintenance or expansion does not involve the use of herbicides, hazardous substances, sealants or other liquid oily substances in aquatic areas, wetlands or their buffers; and b. when maintenance, expansion or replacement of bridges or culverts involves water used by salmonids: (1) the work is in compliance with ditch standards in public rule; and (2) the maintenance of culverts is limited to removal of sediment and debris from the culvert and its inlet, invert and outlet and the stabilization of the disturbed or damaged bank or channel immediately adjacent to the culvert and shall not involve the excavation of a new sediment trap adjacent to the inlet. 18. Allowed for the removal of hazard trees and vegetation as necessary for surveying or testing purposes. 19. The limited trimming, pruning or removal of vegetation under a vegetation management plan approved by the department: a. in steep slope and landslide hazard areas, for the making and maintenance of view corridors; and b. in all critical areas for habitat enhancement, invasive species control or forest management activities. 20. Harvesting of plants and plant materials, such as plugs, stakes, seeds or fruits, for restoration and enhancement projects is allowed. 21. Cutting of firewood is subject to the following: a. within a wildlife habitat conservation area, cutting firewood is not allowed; b. within a wildlife network, cutting shall be in accordance with a management plan approved under K.C.C. 21A.24.386; and c. within a critical area buffer, cutting shall be for personal use and in accordance with an approved forest management plan or rural stewardship plan. 22. Allowed only in buffers if in accordance with best management practices approved by the King County fire marshal. 23. Allowed as follows: a. if conducted in accordance with an approved forest management plan, farm management plan or rural stewardship plan; or b. without an approved forest management plan, farm management plan or rural stewardship plan, only if: (1) removal is undertaken with hand labor, including hand-held mechanical tools, unless the King County noxious weed control board otherwise prescribes the use of riding mowers, light mechanical cultivating equipment or herbicides or biological control methods; (2) the area is stabilized to avoid regrowth or regeneration of noxious weeds; (3) the cleared area is revegetated with native vegetation and stabilized against erosion; and (4) herbicide use is in accordance with federal and state law; 24. Allowed to repair or replace existing on site wastewater disposal systems in accordance with the applicable public health standards within Marine Recovery Areas adopted by the Public Health – Seattle & King County and: a. there is no alternative location available with less impact on the critical area; b. impacts to the critical area are minimized to the maximum extent practicable; c. the alterations will not subject the critical area to increased risk of landslide or erosion; d. vegetation removal is the minimum necessary to accommodate the septic system; and e. significant risk of personal injury is eliminated or minimized in the landslide hazard area. 25. Only if in compliance with published Washington state Department of Fish and Wildlife and Washington state Department of Natural Resources Management standards for the species. If there are no published Washington state standards, only if in compliance with management standards determined by the county to be consistent with best available science. 26. Allowed only if: a. there is not another feasible location with less adverse impact on the critical area and its buffer; b. the corridor is not located over habitat used for salmonid rearing or spawning or by a species listed as endangered or threatened by the state or federal government unless the department determines that there is no other feasible crossing site. c. the corridor width is minimized to the maximum extent practical; d. the construction occurs during approved periods for instream work; e. the corridor will not change or diminish the overall aquatic area flow peaks, duration or volume or the flood storage capacity; and f. no new public right-of-way is established within a severe channel migration hazard area. 27. To the maximum extent practical, during breeding season established under K.C.C. 21A.24.382, land clearing machinery such as bulldozers, graders or other heavy equipment are not operated within a wildlife habitat conservation area. 28. Allowed only if: a. an alternative access is not available; b. impact to the critical area is minimized to the maximum extent practical including the use of walls to limit the amount of cut and fill necessary; c. the risk associated with landslide and erosion is minimized; d. access is located where it is least subject to risk from channel migration; and e. construction occurs during approved periods for instream work. 29. Only if in compliance with a farm management plan in accordance with K.C.C. 21A.24.051. 30. Allowed only if: a. the new construction or replacement is made fish passable in accordance with the most recent Washington state Department of Fish and Wildlife manuals or with the National Marine and Fisheries Services guidelines for federally listed salmonid species; and b. the site is restored with appropriate native vegetation. 31. Allowed if necessary to bring the bridge or culvert up to current standards and if: a. there is not another feasible alternative available with less impact on the aquatic area and its buffer; and b. to the maximum extent practical, the bridge or culvert is located to minimize impacts to the aquatic area and its buffers. 32. Allowed in an existing roadway if conducted consistent with the regional road maintenance guidelines. 33. Allowed outside the roadway if: a. the alterations will not subject the critical area to an increased risk of landslide or erosion; b. vegetation removal is the minimum necessary to locate the utility or construct the corridor; and c. significant risk of personal injury is eliminated or minimized in the landslide hazard area. 34. Limited to the pipelines, cables, wires and support structures of utility facilities within utility corridors if: a. there is no alternative location with less adverse impact on the critical area and critical area buffer; b. new utility corridors meet all of the following to the maximum extent practical: (1) are not located over habitat used for salmonid rearing or spawning or by a species listed as endangered or threatened by the state or federal government unless the department determines that there is no other feasible crossing site; (2) the mean annual flow rate is less than twenty cubic feet per second; and (3) paralleling the channel or following a down-valley route near the channel is avoided; c. to the maximum extent practical utility corridors are located so that: (1) the width is the minimized; (2) the removal of trees greater than twelve inches diameter at breast height is minimized; (3) an additional, contiguous and undisturbed critical area buffer, equal in area to the disturbed critical area buffer area including any allowed maintenance roads, is provided to protect the critical area; d. to the maximum extent practical, access for maintenance is at limited access points into the critical area buffer rather than by a parallel maintenance road. If a parallel maintenance road is necessary the following standards are met: (1) to the maximum extent practical the width of the maintenance road is minimized and in no event greater than fifteen feet; and (2) the location of the maintenance road is contiguous to the utility corridor on the side of the utility corridor farthest from the critical area; e. the utility corridor or facility will not adversely impact the overall critical area hydrology or diminish flood storage capacity; f. the construction occurs during approved periods for instream work; g. the utility corridor serves multiple purposes and properties to the maximum extent practical; h. bridges or other construction techniques that do not disturb the critical areas are used to the maximum extent practical; i. bored, drilled or other trenchless crossing is laterally constructed at least four feet below the maximum depth of scour for the base flood; j. bridge piers or abutments for bridge crossing are not placed within the FEMA floodway or the ordinary high water mark; k. open trenching is only used during low flow periods or only within aquatic areas when they are dry. The department may approve open trenching of type S or F aquatic areas only if there is not a feasible alternative and equivalent or greater environmental protection can be achieved; and l. minor communication facilities may collocate on existing utility facilities if: (1) no new transmission support structure is required; and (2) equipment cabinets are located on the transmission support structure. 35. Allowed only for new utility facilities in existing utility corridors. 36. Allowed for onsite private individual utility service connections or private or public utilities if the disturbed area is not expanded and no hazardous substances, pesticides or fertilizers are applied. 37. Allowed if the disturbed area is not expanded, clearing is limited to the maximum extent practical and no hazardous substances, pesticides or fertilizers are applied. 38. Allowed if: a. conveying the surface water into the wetland or aquatic area buffer and discharging into the wetland or aquatic area buffer or at the wetland or aquatic area edge has less adverse impact upon the wetland or aquatic area or wetland or aquatic area buffer than if the surface water were discharged at the buffer's edge and allowed to naturally drain through the buffer; b. the volume of discharge is minimized through application of low impact development and water quality measures identified in the King County Surface Water Design Manual; c. the conveyance and outfall are installed with hand equipment where feasible; d. the outfall shall include bioengineering techniques where feasible; and e. the outfall is designed to minimize adverse impacts to critical areas. 39. Allowed only if: a. there is no feasible alternative with less impact on the critical area and its buffer; b. to the maximum extent practical, the bridge or culvert is located to minimize impacts to the critical area and its buffer; c. the bridge or culvert is not located over habitat used for salmonid rearing or spawning unless there is no other feasible crossing site; d. construction occurs during approved periods for in-stream work; and e. bridge piers or abutments for bridge crossings are not placed within the FEMA floodway, severe channel migration hazard area or waterward of the ordinary high water mark. 40. Allowed for an open, vegetated stormwater management conveyance system and outfall structure that simulates natural conditions if: a. fish habitat features necessary for feeding, cover and reproduction are included when appropriate; b. vegetation is maintained and added adjacent to all open channels and ponds, if necessary to prevent erosion, filter out sediments or shade the water; and c. bioengineering techniques are used to the maximum extent practical. 41. Allowed for a closed, tightlined conveyance system and outfall structure if: a. necessary to avoid erosion of slopes; and b. bioengineering techniques are used to the maximum extent practical. 42. Allowed in a severe channel migration hazard area or an aquatic area buffer to prevent bank erosion only: a. if consistent with the Integrated Streambank Protection Guidelines (Washington State Aquatic Habitat Guidelines Program, 2002) and if bioengineering techniques are used to the maximum extent practical, unless the applicant demonstrates that other methods provide equivalent structural stabilization and environmental function; b. based on a critical areas report, the department determines that the new flood protection facility will not cause significant impacts to upstream or downstream properties; and c. to prevent bank erosion for the protection of: (1) public roadways; (2) sole access routes in existence before February 16, 1995; (3) new primary dwelling units, accessory dwelling units or accessory living quarters and residential accessory structures located outside the severe channel migration hazard area if: (a) the site is adjacent to or abutted by properties on both sides containing buildings or sole access routes protected by legal bank stabilization in existence before February 16, 1995. The buildings, sole access routes or bank stabilization must be located no more than six hundred feet apart as measured parallel to the migrating channel; and (b) the new primary dwelling units, accessory dwelling units, accessory living quarters or residential accessory structures are located no closer to the aquatic area than existing primary dwelling units, accessory dwelling units, accessory living quarters or residential accessory structures on abutting or adjacent properties; or (4) existing primary dwelling units, accessory dwelling units, accessory living quarters or residential accessory structures if: (a) the structure was in existence before the adoption date of a King County Channel Migration Zone hazard map that applies to that channel, if such a map exists; (b) the structure is in imminent danger, as determined by a geologist, engineering geologist or geotechnical engineer; (c) the applicant has demonstrated that the existing structure is at risk, and the structure and supporting infrastructure cannot be relocated on the lot further from the source of channel migration; and (d) nonstructural measures are not feasible. 43. Applies to lawfully established existing structures if: a. the height of the facility is not increased, unless the facility is being replaced in a new alignment that is landward of the previous alignment and enhances aquatic area habitat and process; b. the linear length of the facility is not increased, unless the facility is being replaced in a new alignment that is landward of the previous alignment and enhances aquatic area habitat and process; c. the footprint of the facility is not expanded waterward; d. consistent with the Integrated Streambank Protection Guidelines (Washington State Aquatic Habitat Guidelines Program, 2002) and bioengineering techniques are used to the maximum extent practical; e. the site is restored with appropriate native vegetation and erosion protection materials; and f. based on a critical areas report, the department determines that the maintenance, repair, replacement or construction will not cause significant impacts to upstream or downstream properties. 44. Allowed in type N and O aquatic areas if done in least impacting way at least impacting time of year, in conformance with applicable best management practices, and all affected instream and buffer features are restored. 45. Allowed in a type S or F water when such work is: a. included as part of a project to evaluate, restore or improve habitat, and b. sponsored or cosponsored by a public agency that has natural resource management as a function or by a federally recognized tribe. 46. Allowed as long as the trail is not constructed of impervious surfaces that will contribute to surface water run-off, unless the construction is necessary for soil stabilization or soil erosion prevention or unless the trail system is specifically designed and intended to be accessible to handicapped persons. 47. Not allowed in a wildlife habitat conservation area. Otherwise, allowed in the buffer or for crossing a category II, III or IV wetland or a type F, N or O aquatic area, if: a. the trail surface is made of pervious materials, except that public multipurpose trails may be made of impervious materials if they meet all the requirements in K.C.C. chapter 9.12. A trail that crosses a wetland or aquatic area shall be constructed as a raised boardwalk or bridge; b. to the maximum extent practical, buffers are expanded equal to the width of the trail corridor including disturbed areas; c. there is not another feasible location with less adverse impact on the critical area and its buffer; d. the trail is not located over habitat used for salmonid rearing or spawning or by a species listed as endangered or threatened by the state or federal government unless the department determines that there is no other feasible crossing site; e. the trail width is minimized to the maximum extent practical; f. the construction occurs during approved periods for instream work; and g. the trail corridor will not change or diminish the overall aquatic area flow peaks, duration or volume or the flood storage capacity. h. the trail may be located across a critical area buffer for access to a viewing platform or to a permitted dock or pier; i. A private viewing platform may be allowed if it is: (1) located upland from the wetland edge or the ordinary high water mark of an aquatic area; (2) located where it will not be detrimental to the functions of the wetland or aquatic area and will have the least adverse environmental impact on the critical area or its buffer; (3) limited to fifty square feet in size; (4) constructed of materials that are nontoxic; and (5) on footings located outside of the wetland or aquatic area. 48. Only if the maintenance: a. does not involve the use of herbicides or other hazardous substances except for the removal of noxious weeds or invasive vegetation; b. when salmonids are present, the maintenance is in compliance with ditch standards in public rule; and c. does not involve any expansion of the roadway, lawn, landscaping, ditch, culvert, engineered slope or other improved area being maintained. 49. Limited to alterations to restore habitat forming processes or directly restore habitat function and value, including access for construction, as follows: a. projects sponsored or cosponsored by a public agency that has natural resource management as a primary function or by a federally recognized tribe; b. restoration and enhancement plans prepared by a qualified biologist; or c. conducted in accordance with an approved forest management plan, farm management plan or rural stewardship plan. 50. Allowed in accordance with a scientific sampling permit issued by Washington state Department of Fish and Wildlife or an incidental take permit issued under Section 10 of the Endangered Species Act. 51. Allowed for the minimal clearing and grading, including site access, necessary to prepare critical area reports. 52. The following are allowed if associated spoils are contained: a. data collection and research if carried out to the maximum extent practical by nonmechanical or hand-held equipment; b. survey monument placement; c. site exploration and gage installation if performed in accordance with state-approved sampling protocols and accomplished to the maximum extent practical by hand-held equipment and; or similar work associated with an incidental take permit issued under Section 10 of the Endangered Species Act or consultation under Section 7 of the Endangered Species Act. 53. Limited to activities in continuous existence since January 1, 2005, with no expansion within the critical area or critical area buffer. "Continuous existence" includes cyclical operations and managed periods of soil restoration, enhancement or other fallow states associated with these horticultural and agricultural activities. 54. Allowed for expansion of existing or new agricultural activities where: a. the site is predominantly involved in the practice of agriculture; b. there is no expansion into an area that: (1) has been cleared under a class I, II, III, IV-S or nonconversion IV-G forest practice permit; or (2) is more than ten thousand square feet with tree cover at a uniform density more than ninety trees per acre and with the predominant mainstream diameter of the trees at least four inches diameter at breast height, not including areas that are actively managed as agricultural crops for pulpwood, Christmas trees or ornamental nursery stock; c. the activities are in compliance with an approved farm management plan in accordance with K.C.C. 21A.24.051; and d. all best management practices associated with the activities specified in the farm management plan are installed and maintained. 55. Only allowed in grazed or tilled wet meadows or their buffers if: a. the facilities are designed to the standards of an approved farm management plan in accordance K.C.C. 21A.24.051 or an approved livestock management plan in accordance with K.C.C. chapter 21A.30; b. there is not a feasible alternative location available on the site; and c. the facilities are located close to the outside edge of the buffer to the maximum extent practical. 56. Only allowed in: a.(1) a severe channel migration hazard area located outside of the shorelines jurisdiction area; (2) grazed or tilled wet meadow or wet meadow buffer; or (3) aquatic area buffer; and only if: b.(1) the applicant demonstrates that adverse impacts to the critical area and critical area buffers have been minimized; (2) there is not another feasible location available on the site that is located outside of the critical area or critical area buffer; (3) the farm pad is designed to the standards in an approved farm management plan in accordance with K.C.C. 21A.24.051; and (4) for proposals located in the severe channel migration hazard area, the farm pad or livestock manure storage facility is located where it is least subject to risk from channel migration. 57. Allowed for new agricultural drainage in compliance with an approved farm management plan in accordance with K.C.C. 21A.24.051 and all best management practices associated with the activities specified in the farm management plan are installed and maintained. 58. If the agricultural drainage is used by salmonids, maintenance shall be in compliance with an approved farm management plan in accordance with K.C.C. 21A.24.051. 59. Allowed within existing landscaped areas or other previously disturbed areas. 60. Allowed for residential utility service distribution lines to residential dwellings, including, but not limited to, well water conveyance, septic system conveyance, water service, sewer service, natural gas, electrical, cable and telephone, if: a. there is no alternative location with less adverse impact on the critical area or the critical area buffer; b. the residential utility service distribution lines meet all of the following, to the maximum extent practical: (1) are not located over habitat used for salmonid rearing or spawning or by a species listed as endangered or threatened by the state or federal government unless the department determines that there is no other feasible crossing site; (2) not located over a type S aquatic area; (3) paralleling the channel or following a down-valley route near the channel is avoided; (4) the width of clearing is minimized; (5) the removal of trees greater than twelve inches diameter at breast height is minimized; (6) an additional, contiguous and undisturbed critical area buffer, equal in area to the disturbed critical area buffer area is provided to protect the critical area; (7) access for maintenance is at limited access points into the critical area buffer. (8) the construction occurs during approved periods for instream work; (9) bored, drilled or other trenchless crossing is encouraged, and shall be laterally constructed at least four feet below the maximum depth of scour for the base flood; and (10) open trenching across Type O or Type N aquatic areas is only used during low flow periods or only within aquatic areas when they are dry. 61. Allowed if sponsored or cosponsored by the countywide flood control zone district and the department determines that the project and its location: a. is the best flood risk reduction alternative practicable; b. is part of a comprehensive, long-term flood management strategy; c. is consistent with the King County Flood Management Plan policies; d. will have the least adverse impact on the ecological functions of the critical area or its buffer, including habitat for fish and wildlife that are identified for protection in the King County Comprehensive Plan; and e. has been subject to public notice in accordance with K.C.C. 20.44.060. 62.a. Not allowed in wildlife habitat conservation areas; b. Only allowed if: (1) the project is sponsored or cosponsored by a public agency whose primary function deals with natural resources management; (2) the project is located on public land or on land that is owned by a nonprofit agency whose primary function deals with natural resources management; (3) there is not a feasible alternative location available on the site with less impact to the critical area or its associated buffer; (4) the aquatic area or wetland is not for salmonid rearing or spawning; (5) the project minimizes the footprint of structures and the number of access points to any critical areas; and (6) the project meets the following design criteria: (a) to the maximum extent practical size of platform shall not exceed one hundred square feet; (b) all construction materials for any structures, including the platform, pilings, exterior and interior walls and roof, are constructed of nontoxic material, such as nontreated wood, vinyl-coated wood, nongalvanized steel, plastic, plastic wood, fiberglass or cured concrete that the department determines will not have an adverse impact on water quality; (c) the exterior of any structures are sufficiently camouflaged using netting or equivalent to avoid any visual deterrent for wildlife species to the maximum extent practical. The camouflage shall be maintained to retain concealment effectiveness; (d) structures shall be located outside of the wetland or aquatic area landward of the Ordinary High Water Mark or open water component (if applicable) to the maximum extent practical on the site; (e) construction occurs during approved periods for work inside the Ordinary High Water Mark; (f) construction associated with bird blinds shall not occur from March 1 through August 31, in order to avoid disturbance to birds during the breeding, nesting and rearing seasons; (g) to the maximum extent practical, provide accessibility for persons with physical disabilities in accordance with the International Building Code; (h) trail access is designed in accordance with public rules adopted by the department; (i) existing native vegetation within the critical area will remain undisturbed except as necessary to accommodate the proposal. Only minimal hand clearing of vegetation is allowed; and (j) disturbed bare ground areas around the structure must be replanted with native vegetation approved by the department. 63. Not allowed in the severe channel migration zone, there is no alternative location with less adverse impact on the critical area and buffer and clearing is minimized to the maximum extent practical. 64. Only structures wholly or partially supported by a tree and used as accessory living quarters or for play and similar uses described in K.C.C. 16.02.240.1, subject to the following: a. not allowed in wildlife habitat conservation areas or severe channel migration hazard areas; b. the structure's floor area shall not exceed two hundred square feet, excluding a narrow access stairway or landing leading to the structure; c. the structure shall be located as far from the critical area as practical, but in no case closer than seventy-five feet from the critical area; d. only one tree-supported structure within a critical area buffer is allowed on a lot; e. all construction materials for the structure, including the platform, pilings, exterior and interior walls and roof, shall be constructed of nontoxic material, such as nontreated wood, vinyl-coated wood, nongalvanized steel, plastic, plastic wood, fiberglass or cured concrete that the department determines will not have an adverse impact on water quality; f. to the maximum extent practical, the exterior of the structure shall be camouflaged with natural wood and earth tone colors to limit visual impacts to wildlife and visibility from the critical area. The camouflage shall be maintained to retain concealment effectiveness; g. the structure must not adversely impact the long-term health and viability of the tree. The evaluation shall include, but not be limited to, the following: (1) the quantity of supporting anchors and connection points to attach the tree house to the tree shall be the minimum necessary to adequately support the structure; (2) the attachments shall be constructed using the best available tree anchor bolt technology; and (3) an ISA Certified Arborist shall evaluate the tree proposed for placement of the tree house and shall submit a report discussing how the tree's long-term health and viability will not be negatively impacted by the tree house or associated infrastructure; h. exterior lighting shall meet the following criteria: (1) limited to the minimum quantity of lights necessary to meet the building code requirements to allow for safe exiting of the structure and stairway; and (2) exterior lights shall be fully shielded and shall direct light downward, in an attempt to minimize impacts to the nighttime environment; i. unless otherwise approved by the department, all external construction shall be limited to September 1 through March 1 in order to avoid disturbance to wildlife species during typical breeding, nesting and rearing seasons; j. trail access to the structure shall be designed in accordance with trail standards under subsection D.47. of this section; k. to the maximum extent practical, existing native vegetation shall be left undisturbed. Only minimal hand clearing of vegetation is allowed; and l. vegetated areas within the critical area buffer that are temporarily impacted by construction of the structure shall be restored by planting native vegetation according to a vegetation management plan approved by the department. 65. Shoreline water dependent and shoreline water oriented uses are allowed in the aquatic area and aquatic area buffer of a Type S aquatic area if consistent with K.C.C. chapter 21A.25, chapter 90.58 RCW and the King County Comprehensive Plan. 66. Only hydroelectric generating facilities meeting the requirements of K.C.C. 21A.08.100B.14., and only as follows: a. there is not another feasible location within the aquatic area with less adverse impact on the critical area and its buffer; b. the facility and corridor is not located over habitat used for salmonid rearing or spawning or by a species listed as endangered or threatened by the state or federal government unless the department determines that there is no other feasible location; c. the facility is not located in Category I wetlands or Category II wetlands with a habitat score of 8 points or greater; d. the corridor width is minimized to the maximum extent practical; e. paralleling the channel or following a down-valley route within an aquatic area buffer is avoided to the maximum extent practical; f. the construction occurs during approved periods for instream work; g. the facility and corridor will not change or adversely impact the overall aquatic area flow peaks, duration or volume or the flood storage capacity; h. the facility and corridor is not located within a severe channel migration hazard area; i. to the maximum extent practical, buildings will be located outside the buffer and away from the aquatic area or wetland; j. to the maximum extent practical, access for maintenance is at limited access points into the critical area buffer rather than by a parallel maintenance road. If a parallel maintenance road is necessary the following standards are met: (1) to the maximum extent practical the width of the maintenance road is minimized and in no event greater than fifteen feet; and (2) the location of the maintenance road is contiguous to the utility corridor on the side of the utility corridor farthest from the critical area; k. the facility does not pose an unreasonable threat to the public health, safety or welfare on or off the development proposal site and is consistent with the general purposes of this chapter and the public interest; and l. the facility connects to or is an alteration to a public roadway, public trail, a utility corridor or utility facility or other infrastructure owned or operated by a public utility. 67. Only hydroelectric generating facilities meeting the requirements of K.C.C. 21A.08.100.B.14, and only as follows: a. there is not another feasible location with less adverse impact on the critical area and its buffer; b. the alterations will not subject the critical area to an increased risk of landslide or erosion; c. the corridor width is minimized to the maximum extent practical; d. vegetation removal is the minimum necessary to locate the utility or construct the corridor; e. the facility and corridor do not pose an unreasonable threat to the public health, safety or welfare on or off the development proposal site and is consistent with the general purposes of this chapter, and the public interest and significant risk of personal injury is eliminated or minimized in the landslide hazard area; and f. the facility connects to or is an alteration to a public roadway, public trail, a utility corridor or utility facility or other infrastructure owned or operated by a public utility. 68. Only for a single detached dwelling unit on a lake twenty acres or larger and only as follows: a. the heat exchanger must be a closed loop system that does not draw water from or discharge to the lake; b. the lake bed shall not be disturbed, except as required by the county or a state or federal agency to mitigate for impacts of the heat exchanger; c. the in-water portion of system is only allowed where water depth exceeds six feet; and d. system structural support for the heat exchanger piping shall be attached to an existing dock or pier or be attached to a new structure that meets the requirements of K.C.C. 21A.25.180. 69. Only for maintenance of agricultural waterways if: a. the purpose of the maintenance project is to improve agricultural production on a site predominately engaged in the practice of agriculture; b. the maintenance project is conducted in compliance with a hydraulic project approval issued by the Washington state Department of Fish and Wildlife pursuant to chapter 77.55 RCW; c. the maintenance project complies with the King County agricultural drainage assistance program as agreed to by the Washington state Department of Fish and Wildlife, the department of local services, permitting division, and the department of natural resources and parks, and as reviewed by the Washington state Department of Ecology; d. the person performing the maintenance and the landowner have attended training provided by King County on the King County agricultural drainage assistance program and the best management practices required under that program; and e. the maintenance project complies with K.C.C. chapter 16.82. (Ord. 19820 § 10, 2024: Ord. 19034 § 23, 2019: Ord. 18791 § 172, 2018: Ord. 18767 § 7, 2018: Ord. 17841 § 38, 2014: Ord. 17539 § 44, 2013: Ord. 17485 § 18, 2012: Ord. 17191 § 40, 2011: Ord. 16985 § 120, 2010: Ord. 16950 § 24, 2010: Ord. 16267 § 40, 2008: Ord. 15051 § 137, 2004).21A.24.051 Agricultural activities development standards.A. The alterations identified in K.C.C. 21A.24.045 for agricultural activities are allowed to expand within the buffers of wetlands, aquatic areas and wildlife habitat conservation areas, when an agricultural activity is currently occurring on the site and the alteration is in compliance with an approved farm management plan in accordance with this section or, for livestock activities, a farm management plan in accordance with K.C.C. chapter 21A.30.B. This section does not modify any requirement that the property owner obtain permits for activities covered by the farm management plan.C. The department of natural resources and parks or its designee shall serve as the single point of contact for King County in providing information on farm management plans for purposes of this title. The department of natural resources and parks shall adopt a public rule governing the development of farm management plans. The rule may provide for different types of farms management plans related to different kinds of agricultural activities, including, but not limited to the best management practices for livestock management, livestock crossing, livestock heavy use areas, horticulture management, site development, farm pads, farm field access roads and agricultural drainage.D. A property owner or applicant seeking to use the process to allow alterations in critical area buffers shall develop a farm management plan based on the following goals, which are listed in order of priority: 1. To maintain the productive agricultural land base and economic viability of agriculture on the site; 2. To maintain, restore or enhance critical areas to the maximum extent practical in accordance with the site specific goals of the landowner; 3. To the maximum extent practical in accordance with the site specific goals of the landowner, maintain and enhance natural hydrologic systems on the site; 4. To use federal, state and local best management practices and best available science for farm management to achieve the goals of the farm management plan; and 5. To monitor the effectiveness of best management practices and implement additional practices through adaptive management to achieve the goals of the farm management plan.E. If a part or all of the site is located within the shoreline jurisdiction, the farm management plan shall: 1. Consider and be consistent with the goals of the shoreline management act and the policies of the King County shoreline master program; 2. Consider the priorities of the King County shoreline protection and restoration plan; and 3. Ensure no net loss of shoreline ecological functions.F. The property owner or applicant may develop the farm management plan as part of a program offered or approved by King County. The plan shall include, but is not limited to, the following elements: 1. A site inventory identifying critical areas, structures, cleared and forested areas, and other significant features on the site; 2. Site-specific performance standards and best management practices to maintain, restore or enhance critical areas and their buffers and maintain and enhance native vegetation on the site including the best management practices for the installation and maintenance of farm field access drives and agricultural drainages; 3. A plan for future changes to any existing structures or for any changes to the landscape that involve clearing or grading; 4. A plan for implementation of performance standards and best management practices; 5. A plan for monitoring the effectiveness of measures taken to protect critical areas and their buffers and to modify the farm management plan if adverse impacts occur.G. If applicable, a farm management plan shall include documentation of compliance with flood compensatory storage and flood conveyance in accordance with K.C.C. 21A.24.240.H. A farm management plan is not effective until approved by the county. Before approval, the county may conduct a site inspection, which may be through a program offered or approved by King County, to verify that the plan is reasonably likely to accomplish the goals in subsection D. of this section and consistent with subsection E. of this section.I. Once approved, activities carried out in compliance with the approved farm management plan shall be deemed in compliance with this chapter. In the event of a potential code enforcement action, the department of local services, permitting division, shall first inform the department of natural resources and parks of the activity. Before taking code enforcement action, the department of local services, permitting division, shall consult with the department of natural resources and parks and the King Conservation District to determine whether the activity is consistent with the farm management plan. (Ord. 18791 § 173, 2018: Ord. 17539 § 45, 2013: Ord. 17485 § 19, 2012: Ord. 17420 § 102, 2012: Ord. 15051 § 138, 2004).21A.24.055 Rural stewardship plans.A. On a site zoned RA, the department may approve a modification of the minimum buffer widths for aquatic areas, wetlands and wildlife habitat conservation areas and maximum clearing restrictions through a rural stewardship plan for single family detached residential development in accordance with this section.B. The property owner or applicant shall develop the rural stewardship plan as part of a rural stewardship program offered or approved by King County and has the option of incorporating appropriate components of a county-approved farm management or a county-approved forest stewardship plan.C. In its evaluation of any proposed modification of the minimum buffer widths for aquatic areas, wetlands and wildlife habitat conservation areas and maximum clearing restrictions, the department shall consider the following factors: 1. The existing condition of the drainage basin or marine shoreline as designated on the Basin and Shoreline Conditions Map; 2. The existing condition of wetland and aquatic area buffers; 3. The existing condition of wetland functions based on the adopted Washington State Wetland Rating System for Western Washington, Washington state Department of Ecology publication number 14-06-029, published October 2014; 4. The location of the site in the drainage basin; 5. The percentage of impervious surfaces and clearing on the site; and 6. Any existing development on the site that was approved as a result of a variance or alteration exception that allowed development within a critical area or critical area buffer. If the existing development was approved through a variance or alteration exception, the rural stewardship plan shall demonstrate that the plan will result in enhancing the functions and values of critical areas located on the site as if the development approved through the variance or alteration exception had not occurred.D. A rural stewardship plan does not modify the requirement for permits for activities covered by the rural stewardship plan.E. Modifications of critical area buffers shall be based on the following prioritized goals: 1. To the maximum extent practical, to avoid impacts to critical areas and, if applicable, to the shoreline jurisdiction; 2. To avoid impacts to the higher quality wetland or aquatic area or the more protected fish or wildlife species, if there is a potential to affect more than one category of wetland or aquatic area or more than one species of native fish or wildlife; 3. To maintain or enhance the natural hydrologic systems on the site to the maximum extent practical; 4. To maintain, restore or enhance native vegetation; 5. To maintain, restore or enhance the function and value of critical areas or critical area buffers located on the site; 6. To minimize habitat fragmentation and enhance corridors between wetlands, riparian corridors, wildlife habitat conservation areas and other priority habitats; 7. To minimize the impacts of development over time by implementing best management practices and meeting performance standards during the life of the development; and 8. To monitor the effectiveness of the stewardship practices and implement additional practices through adaptive management to maintain, restore or enhance critical area functions when necessary.F. If a part or all of the site is located within the shoreline jurisdiction, the rural stewardship plan shall: 1. Consider and be consistent with the goals of the Shoreline Management Act and the policies of the King County Shoreline Master Program; 2. Consider the priorities of the King County Shoreline Protection and Restoration Plan; and 3. Ensure no net loss of shoreline ecological functions.G. A rural stewardship plan may include, but is not limited to, the following elements: 1. Critical areas designation under K.C.C. 21A.24.500; 2. Identification of structures, cleared and forested areas and other significant features on the site; 3. Location of wetlands and aquatic areas and their buffers, and wildlife habitat; 4. Analysis of impacts of planned changes to any existing structures, for other changes to the site that involve clearing or grading or for new development; 5. Site-specific best management practices that mitigate impacts of development and that protect and enhance the ecological values and functions of the site; 6. A schedule for implementation of the elements of the rural stewardship plan; and 7. A plan for monitoring the effectiveness of measures approved under the rural stewardship plan and to modify if adverse impacts occur.H. A rural stewardship plan may be developed as part of a program offered or approved by King County and shall include a site inspection by the county to verify that the plan is reasonably likely to accomplish the goals in subsection E. of this section to protect water quality, reduce flooding and erosion, maintain, restore or enhance the function and value of critical areas and their buffers and maintain or enhance native vegetation on the site of this section.I. A property owner who completes a rural stewardship plan that is approved by the county may be eligible for tax benefits under the public benefit rating system in accordance with K.C.C. 20.36.100.J. If a property owner withdraws from the rural stewardship plan, in addition to any applicable penalties under the public benefit rating system, the following apply: 1. Mitigation is required for any structures constructed in critical area buffers under the rural stewardship plan; and 2. The property owner shall apply for buffer averaging or an alteration exception, as appropriate, to permit any structure or use that has been established under the rural stewardship plan and that would not otherwise be permitted under this chapter.K. A rural stewardship plan is not effective until approved by the county. Before approval, the county may conduct a site inspection, which may be through a program offered or approved by King County, to verify that the plan is reasonably likely to accomplish the goals in subsection E. of this section.L. Once approved, activities carried out in compliance with the approved rural stewardship plan shall be deemed in compliance with this chapter. In the event of a potential code enforcement action, the department of local services, permitting division, shall first inform the department of natural resources and parks of the activity. Before taking code enforcement action, the department of local services, permitting division, shall consult with the department of natural resources and parks to determine whether the activity is consistent with the rural stewardship plan. (Ord. 19034 § 24, 2019: Ord. 18791 § 174, 2018: Ord. 17420 § 103, 2012: Ord. 16985 § 121, 2010: Ord. 16267 § 41, 2008: Ord. 15051 § 139, 2004).21A.24.061 Public rules for rural stewardship and farm management plans.A. The King County council recognizes that rural stewardship plans and farm management plans are key elements of this chapter that provide flexibility to rural area residents to establish and maintain a rural lifestyle that includes activities such as farming and forestry while maintaining and enhancing rural character and environmental quality.B. The department of natural resources and parks and department of local services shall adopt public rules to implement K.C.C. 21A.24.045 and 21A.24.051 relating to rural stewardship plans and farm management plans, consistent with the provisions of this section. The rules shall not compromise the King Conservation District’s mandate or standards for farm management planning.C. County departments or approved agencies shall provide technical assistance and resources to landowners to assist them in preparing the plans. The technical assistance shall include, but is not limited to, web-based information, instructional manuals and classroom workshops. When possible, the assistance shall be provided at little or no cost to landowners. In addition, the department of natural resources and parks shall develop, in consultation as necessary with the department of local services, permitting division, and the King Conservation District, and make available to the public, model farm management, forest management and rural stewardship plans illustrating examples of plan application content, drawings and site plans, to assist landowners in their development of site-specific plans for their property.D. The department of natural resources and parks is the primary county agency responsible for rural stewardship plans and farm management plans that are filed with the county under this chapter. The department of natural resources and parks shall consult with the department of local services, permitting division, in carrying out its responsibilities under this chapter relating to rural stewardship plans and farm management plans. The department of natural resources and parks, the department of local services, permitting division, and the King Conservation District may enter into agreements to carry out the provisions of this chapter relating to rural stewardship plans and farm management plans.E. The department of natural resources and parks and department of local services, permitting division, shall monitor and evaluate the effectiveness of rural stewardship and farm management plans in meeting the goals and objectives of those plans established in this chapter. (Ord. 18791 § 175, 2018: Ord. 18635 § 31, 2017: Ord. 17420 § 104, 2012: Ord. 15051 § 140, 2004).21A.24.065 Basin and Shoreline Conditions Map.A. The Basin and Shoreline Conditions Map, included in Attachment A to Ordinance 15051*, is the basis for determining standards or modifications of standards related to aquatic areas, wetlands complexes and RA zone clearing limits.B. Basins and marine shorelines are rated as "high," "medium," or "low" using the criteria listed in subsection C of this section and can be generally characterized as follows: 1. High condition ratings are generally reflective of areas with low development intensity (e.g., substantial forest cover, relatively few roads crossing aquatic areas and wetlands, low amounts of impervious surfaces, and low amounts armoring and structures along shorelines) and a significant biological value (e.g., the presence or high use by critical species or the presence of rare, endangered or highly sensitive habitats). 2. Medium condition ratings are generally reflective of areas with either high or moderate development intensity and moderate or low insignificant biological value. 3. Low condition ratings are generally reflective of areas with high development intensity (e.g., reduced forest cover, many roads crossing aquatic areas and wetlands, significant amounts of impervious surfaces, and extensive amount of armoring and structures along shorelines) and a low biological value (e.g., the little presence or low use by critical species or little or no presence of rare, endangered or highly sensitive habitats).C. Ratings designated on the Basin and Shoreline Conditions Map shall be determined in accordance with the following criteria: 1. Basin conditions for riverine tributary systems are based on: a. presence and amount of use for spawning and rearing and habitat for chinook salmon, bull trout, coho salmon, chum salmon and cutthroat trout; b. total impervious surface area; c. number of acres of mapped category I wetlands; d. number of road crossings of aquatic areas; e. surrounding land use intensity; f. amount of forest cover; g. presence of mapped wildlife habitat network; and h. presence of mapped priority species nests or breeding habitat. 2. Conditions for marine shorelines are based on: a. presence and amount of forage fish, such as surf smelt and sand lance and the extent of their spawning sites within the drift cell; b. length and percentage of cell without eelgrass, with patchy eelgrass and with continuous eelgrass; c. the amount and type of forest cover; d. length and percentage of cell with low, moderate and high impervious surface; e. presence and amount of large woody debris and drift logs; f. length and percentage of cell armored and unstable slope armored g. number of docks, piers, groins, jetties, breakwaters and boat ramps; h. number of marsh areas present and length and percentage of cell within marsh habitat; i. length and percentage of cell within important bird area; and j. length and percentage of cell within marine reserve. (Ord. 15051 § 141, 2004).*Available in the King County Archives.21A.24.070 Alteration exception.A. The director may approve alterations to critical areas, critical area buffers and critical area setbacks, except for flood hazard areas, not otherwise allowed by this chapter as follows: 1. Except as otherwise provided in subsection A.2. of this section, for linear alterations, the director may approve alterations to critical areas, critical area buffers and critical area setbacks only when all of the following criteria are met: a. there is no feasible alternative to the development proposal with less adverse impact on the critical area; b. the proposal minimizes the adverse impact on critical areas to the maximum extent practical; c. the approval does not require the modification of a critical area development standard established by this chapter; d. the development proposal does not pose an unreasonable threat to the public health, safety or welfare on or off the development proposal site and is consistent with the general purposes of this chapter and the public interest; e. the linear alteration: (1) connects to or is an alteration to a public roadway, regional light rail transit line, public trail, a utility corridor or utility facility or other public infrastructure owned or operated by a public utility; or (2) is required to overcome limitations due to gravity; 2. In order to accommodate the siting of a regional light rail transit facility under RCW 36.70A.200, the director may approve alterations to critical areas, critical area buffers and critical area setbacks not otherwise allowed by this chapter and may impose reasonable conditions to minimize the impact of the light rail transit facility on the critical area and its buffer; and3. For nonlinear alterations the director may approve alterations to critical areas except wetlands, unless otherwise allowed under subsection A.3.h. of this section, aquatic areas and wildlife habitat conservation areas, and alterations to critical area buffers and critical area setbacks, when all of the following criteria are met: a. there is no feasible alternative to the development proposal with less adverse impact on the critical area; b. the alteration is the minimum necessary to accommodate the development proposal; c. the approval does not require the modification of a critical area development standard established by this chapter; d. the development proposal does not pose an unreasonable threat to the public health, safety or welfare on or off the development proposal site and is consistent with the general purposes of this chapter and the public interest; e. for dwelling units, no more than five thousand square feet or ten percent of the site, whichever is greater, may be disturbed by structures, building setbacks or other land alteration, including grading, utility installations and landscaping, but not including the area used for a driveway or for an on-site sewage disposal system. When the site disturbance is within a critical area buffer, the building setback line shall be measured from the building footprint to the edge of the approved site disturbance; f. to the maximum extent practical, access is located to have the least adverse impact on the critical area and critical area buffer; g. the critical area is not used as a salmonid spawning area; and h. the director may approve an alteration in a category II, III and IV wetland for development of a public school facility.B. The director may approve alterations to critical areas, critical area buffers and critical area setbacks, except for flood hazard areas, if the application of this chapter would deny all reasonable use of the property as follow: 1. If the critical area, critical area buffer or critical area setback is outside of the shoreline jurisdiction, the applicant may apply for a reasonable use exception under this subsection without first having applied for an alteration exception under this section if the requested reasonable use exception includes relief from development standards for which an alteration exception cannot be granted under this section. The director shall determine that all of the following criteria are met: a. there is no other reasonable use with less adverse impact on the critical area; b. development proposal does not pose an unreasonable threat to the public health, safety or welfare on or off the development proposal site and is consistent with the general purposes of this chapter and the public interest; c. any authorized alteration to the critical area or critical area buffer is the minimum necessary to allow for reasonable use of the property; and d. for dwelling units, no more than five thousand square feet or ten percent of the site, whichever is greater, may be disturbed by structures, building setbacks or other land alteration, including grading, utility installations and landscaping but not including the area used for a driveway or for an on-site sewage disposal system; and 2. If the critical area, critical area buffer or critical area setback is located within the shoreline jurisdiction, the request for a reasonable use exception shall be considered a request for a shoreline variance under K.C.C. 21A.44.090.C. For the purpose of this section: 1. "Linear" alteration means infrastructure that supports development that is linear in nature and includes public and private roadways, public trails, private driveways, railroads, regional light rail transit, hydroelectric generating facilities, utility corridors and utility facilities; and 2. For purposes of subsections A. and B. of this section, areas located within the shoreline jurisdiction that are below the ordinary high water mark shall not be included in calculating the site area.D. Alteration exceptions approved under this section shall meet the mitigation requirements of this chapter.E. An applicant for an alteration exception shall submit a critical area report, as required by K.C.C. 21A.24.110. (Ord. 19128 § 17, 2020: Ord. 18767 § 8, 2018: Ord. 17539 § 46, 2013: Ord. 17191 § 41, 2011: Ord. 16985 § 122, 2010: Ord. 16267 § 42, 2008: Ord. 16172 § 2, 2008: Ord. 15051 § 142, 2004: Ord. 13190 § 19, 1998: Ord. 12196 § 54, 1996: Ord. 11621 § 73, 1994: Ord. 10870 § 454, 1993).21A.24.072 Alteration exception – alternative.A. As an alternative to an alteration exception under K.C.C. 21A.24.070, during review of an application for a single detached dwelling unit, the director may approve an alteration to a wetland buffer, aquatic area buffer, steep slope hazard area and associated buffer, landslide hazard area and associated buffer and critical area setback as follows: 1. There is no feasible alternative to the development proposal with less adverse impact on the critical area; 2. The alteration is the minimum necessary to accommodate residential use of the property; 3. The approval does not require the modification of a critical area development standard established by this chapter; 4. The development proposal does not pose an unreasonable threat to the public health, safety or welfare on or off the development proposal site and is consistent with the general purposes of this chapter and the public interest; 5. No more than five thousand square feet or ten percent of the site, whichever is greater, are disturbed by structures, building setbacks or other land alteration, including grading, utility installations and landscaping, but not including the area used for a driveway or for an on-site sewage disposal system. For purposes of this section, areas located within the shoreline jurisdiction that are below the ordinary high water mark shall not be included in calculating the site area; 6. The applicant submits an approved rural stewardship plan or forest stewardship plan prepared in accordance with this chapter that addresses the development proposal and the proposed use of the property; and 7. The proposal complies with K.C.C. 21A.24.125 and 21A.24.130.B. The applicant for the waiver of the alteration exception process shall submit any critical areas studies, alternatives analysis and other documents requested by the department following a preapplication review meeting.C. Within fourteen calendar days after the department determines the application under this section is complete, it shall provide written mailed notice of the proposed alteration as provided in K.C.C. 20.20.060.H.D. The department shall allow twenty-one calendar days for comment before making a decision on the request under this section. The department's decision shall be mailed to the applicant and to any other person who requests a copy. The decision shall state the reasons for the decision and, if approved, shall include any required mitigation or conditions. (Ord. 19146 § 67, 2020: Ord. 17539 § 47, 2013).21A.24.090 Disclosure by applicant. If a development proposal site contains or is within a critical area, the applicant shall submit an affidavit which declares whether:A. The applicant has knowledge of any illegal alteration to any or all critical areas on the development proposal site; andB. The applicant previously has been found in violation of this chapter, in accordance with K.C.C. Title 23. If the applicant previously has been found in violation, the applicant shall declare whether the violation has been corrected to the satisfaction of King County. (Ord. 15051 § 145, 2004: Ord. 10870 § 456, 1993).21A.24.100 Critical area review.A. Before any clearing, grading or site preparation, the department shall perform a critical area review for any development proposal permit application or other request for permission to alter a site to determine whether there is: 1. A critical area on the development proposal site; 2. An active breeding site of a protected species on the development proposal site; or 3. A critical area or active breeding site of a protected species that has been mapped, identified within three hundred feet of the applicant's property or that is visible from the boundaries of the site.B. As part of the critical area review, the department shall review the critical area reports and determine whether: 1. There has been an accurate identification of all critical areas; 2. An alteration will occur to a critical area or a critical area buffer; 3. The development proposal is consistent with this chapter; 4. The sequence in K.C.C. 21A.24.125 has been followed to avoid impacts to critical areas and critical area buffers; and5. Mitigation to compensate for adverse impacts to critical areas is required and whether the mitigation and monitoring plans and bonding measures proposed by the applicant are sufficient to protect the general public health, safety and welfare, consistent with the goals, purposes, objectives and requirements of this chapter.C. If a development proposal does not involve any site disturbance, clearing, or grading and only requires a permit or approval under K.C.C. chapter 16.04 or 17.04, critical area review is not required, unless the development proposal is located within a: 1. Flood hazard area; 2. Critical aquifer recharge area; or 3. Landslide hazard area, seismic hazard area, or coal mine hazard area and the proposed development will cause additional loads on the foundation, such as by expanding the habitable square footage of the structure or by adding or changing structural features that change the load bearing characteristics of the structure. (Ord. 15051 § 146, 2004: Ord. 14449 § 9, 2002: Ord. 10870 § 457, 1993).21A.24.110 Critical area report requirement.A. An applicant for a development proposal that requires critical area review under K.C.C. 21A.24.100 shall submit a critical area report at a level determined by the department to adequately evaluate the proposal and all probable impacts.B. The applicant may combine a critical area report with any studies required by other laws and regulations.C. If the development proposal will affect only a part of the development proposal site, the department may limit the scope of the required critical area report to include only that part of the site that is affected by the development proposal. D.1. Floodplain development that was not assessed through the King County Programmatic Habitat Assessment prepared for the National Flood Insurance program and the Endangered Species Act shall include an assessment of the impact of the alteration on water quality and aquatic and riparian habitat. The assessment shall be: a. A Biological Evaluation or Biological Assessment that has received concurrence from the United States Fish and Wildlife Service or the National Marine Fisheries Service, pursuant to Section 7 of the Endangered Species Act; b. Documentation that the activity fits within a Habitat Conservation Plan approved pursuant to Section 10 of the Endangered Species Act; c. Documentation that the activity fits within Section 4(d) of the Endangered Species Act; d. An assessment prepared in accordance with Regional Guidance for Floodplain Habitat Assessment and Mitigation, FEMA Region X, 2010. The assessment shall determine if the project would adversely affect any one or more of the following: (1) the primary constituent elements identified when a species is listed as threatened or endangered; (2) Essential Fish Habitat designated by the National Marine Fisheries Service; (3) fish and wildlife habitat conservation areas; (4) vegetation communities and habitat structures; (5) water quality; (6) water quantity, including flood and low flow depths, volumes and velocities; (7) the river or stream channel's natural planform pattern and migration process; (8) spawning substrate, if applicable; and (9) floodplain refugia, if applicable. 2. The department must require a project with adverse effects to comply with the impact avoidance, minimization and mitigation requirements of K.C.C. 21A.24.125 and 21A.24.130.(Ord. 17539 § 48, 2013: Ord. 15051 § 147, 2004: Ord. 10870 § 458, 1993).21A.24.125 Avoiding impacts to critical areas.A. An applicant for a development proposal or alteration, shall apply the following sequential measures, which appear in order of priority, to avoid impacts to critical areas and critical area buffers: 1. Avoiding the impact or hazard by not taking a certain action; 2. Minimizing the impact or hazard by: a. limiting the degree or magnitude of the action with appropriate technology; or b. taking affirmative steps, such as project redesign, relocation or timing; 3. Rectifying the impact to critical areas by repairing, rehabilitating or restoring the affected critical area or its buffer; 4. Minimizing or eliminating the hazard by restoring or stabilizing the hazard area through engineered or other methods; 5. Reducing or eliminating the impact or hazard over time by preservation or maintenance operations during the life of the development proposal or alteration; 6. Compensating for the adverse impact by enhancing critical areas and their buffers or creating substitute critical areas and their buffers; and 7. Monitoring the impact, hazard or success of required mitigation and taking remedial action.B. The specific mitigation requirements of this chapter for each critical area or requirements determined through the resource mitigation reserves program apply when compensation for adverse impacts is required by the sequence in subsection A. of this section. (Ord. 15051 § 149, 2004).21A.24.130 Mitigation and monitoring.A. If mitigation is required under this chapter to compensate for adverse impacts, unless otherwise provided, an applicant shall: 1. Mitigate adverse impacts to: a. critical areas and their buffers; and b. the development proposal as a result of the proposed alterations on or near the critical areas; and 2. Monitor the performance of any required mitigation.B. The department shall not approve a development proposal until mitigation and monitoring plans are in place to mitigate for alterations to critical areas and buffers.C. Whenever mitigation is required, an applicant shall submit a critical area report that includes: 1. An analysis of potential impacts; 2. A mitigation plan that meets the specific mitigation requirements in this chapter for each critical area impacted; and 3. A monitoring plan that includes: a. a demonstration of compliance with this title; b. a contingency plan in the event of a failure of mitigation or of unforeseen impacts if: (1) the department determines that failure of the mitigation would result in a significant impact on the critical area or buffer; or (2) the mitigation involves the creation of a wetland; and c. a monitoring schedule that may extend throughout the impact of the activity or, for hazard areas, for as long as the hazard exists.D. Mitigation shall not be implemented until after the department approves the mitigation and monitoring plan. The applicant shall notify the department when mitigation is installed and monitoring is commenced and shall provide King County with reasonable access to the mitigation for the purpose of inspections during any monitoring period.E. If monitoring reveals a significant deviation from predicted impact or a failure of mitigation requirements, the applicant shall implement an approved contingency plan. The contingency plan constitutes new mitigation and is subject to all mitigation including a monitoring plan and financial guarantee requirements. (Ord. 15051 § 150, 2004: Ord. 10870 § 460, 1993).21A.24.133 Off-site mitigation.A. To the maximum extent practical, an applicant shall mitigate adverse impacts to a wetland, aquatic area, wildlife habitat conservation area or wildlife habitat network on or contiguous to the development site. The department may approve mitigation that is off the development site if an applicant demonstrates that: 1. It is not practical to mitigate on or contiguous to the development proposal site; and 2. The off-site mitigation will achieve equivalent or greater hydrological, water quality and wetland or aquatic area habitat functions.B. When off-site mitigation is authorized, the department shall give priority to locations within the same drainage subbasin as the development proposal site that meet the following: 1. Mitigation banking sites and resource mitigation reserves as authorized by this chapter; 2. Private mitigation sites that are established in compliance with the requirements of this chapter and approved by the department; and 3. Public mitigation sites that have been ranked in a process that has been supported by ecological assessments, including wetland and aquatic areas established as priorities for mitigation in King County basin plans or other watershed plans.C. The department may require documentation that the mitigation site has been permanently preserved from future development or alteration that would be inconsistent with the functions of the mitigation. The documentation may include, but is not limited to, a conservation easement or other agreement between the applicant and owner of the mitigation site. King County may enter into agreements or become a party to any easement or other agreement necessary to ensure that the site continues to exist in its mitigated condition.D. The department shall maintain a list of sites available for use for off-site mitigation projects.E.1. The department and the department of natural resources and parks have develop a program to allow the payment of a fee in lieu of providing mitigation on a development site. The program addresses: a. when the payment of a fee is allowed considering the availability of a site in geographic proximity with comparable hydrologic and biological functions and potential for future habitat fragmentation and degradation; and b. the use of the fees for mitigation on public or private sites that have been ranked according to ecological criteria through one or more programs that have included a public process. 2. The in lieu fee mitigation program shall submit a report by May 1 in the first year of the biennial budget cycle, filed in the form of a paper original and an electronic copy with the clerk of the council, who shall retain the original and provide an electronic copy to all councilmembers, the council chief of staff and the lead staff for the transportation economy and environment committee or its successor. The report should address the following: a. information on the amount and source of revenues received by the program; b. a description and rationale for projects selected for funding; c. an accounting of budgeted and actual expenditures made; d. the status of all projects approved in the previous five years, and anticipated completion date for those projects, if not yet complete. (Ord. 18302 § 1, 2016: Ord. 17254 § 4, 2012: Ord. 15051 § 151, 2004).21A.24.137 Approval of mitigation through mitigation reserves program. The department may approve mitigation to compensate for the adverse impacts of a development proposal to critical areas through [and through use of an in-lieu fee program]*. [or in-lieu fee program]* the King County mitigation reserves program. (Ord. 17539 § 49, 2013: Ord. 17254 § 5, 2012: Ord. 15051 § 152, 2004).*Reviser’s note: Language did not appear in Ordinance 17539 but was not struck through. See K.C.C. 1.24.075.21A.24.140 Financial guarantees. Financial guarantees shall be required consistent with the provisions of Title 27A. (Ord. 12020 § 54, 1995: Ord. 10870 § 461, 1993).21A.24.160 Critical area markers and signs.A. Development proposals shall include permanent survey stakes delineating the boundary between adjoining property and critical area tracts, using iron or concrete markers as established by current survey standards.B. The applicant shall identify the boundary between a critical area tract and contiguous land with permanent signs. The department may require signs and fences to delineate and protect critical areas and critical area buffers that are not in critical area tracts. (Ord. 15051 § 154, 2004: Ord. 10870 § 463, 1993).21A.24.170 Notice of critical areas.A. Except as otherwise provided in subsection of C. of this section, the owner of any property containing critical areas or buffers on which a development proposal is submitted or any property on which mitigation is established as a result of development shall file a notice approved by King County with the records and licensing services division. The notice shall inform the public of: 1. The presence of critical areas or buffers or mitigation sites on the property; 2. The application of this chapter to the property; and 3. The possible existence of limitations on actions in or affecting the critical areas or buffers or the fact that mitigation sites may exist.B. The applicant for a development proposal shall submit proof that the notice required by this section has been filed for public record before King County approves any development proposal for the property or, in the case of subdivisions, short subdivisions and binding site plans, at or before recording of the subdivision, short subdivision or binding site plan.C. The notice required under subsection A. of this section is not required if: 1. The property is a public right-of-way or the site of a permanent public facility; 2. The development proposal does not require sensitive area review under K.C.C. 21A.24.100.C; or 3. The property only contains a critical aquifer recharge area. (Ord. 16267 § 43, 2008: Ord. 15971 § 98, 2007: Ord. 15051 § 155, 2004: Ord. 14449 § 10, 2002: Ord. 14187 § 3, 2001: Ord. 10870 § 464, 1993).21A.24.180 Critical area tracts and designations on site plans.A. The applicant shall establish critical area tracts to delineate and protect those critical areas and buffers listed below in development proposals for subdivisions, short subdivisions or binding site plans and shall record the tracts on all documents of title of record for all affected lots: 1. All landslide hazard areas and buffers that are one acre or more in size; 2. All steep slope hazard areas and buffers that are one acre or more in size; 3. All wetlands and buffers; and 4. All aquatic areas and buffers.B. A critical area tract established under subsection A. of this section shall be held in an undivided interest by each owner of a building lot within the development with this ownership interest passing with the ownership of the lot, or shall be held by an incorporated homeowner's association or other legal entity that ensures the ownership, maintenance and protection of the tract. C. The long-term management goals for critical area tracts established under subsection A. of this section are to protect and enhance critical area functions and values, including, but not limited to, providing fish and wildlife habitat and protecting the public from geologic hazards and increased stormwater runoff. The specific management strategy for each tract shall be clearly defined before preliminary approval of the subdivision or binding site plan.D. In lieu of the requirements of subsection A. of this section, the director may allow an applicant to include critical areas in resource tracts established under K.C.C. 21A.14.040.B.7. The resource tract management plan shall clearly state that the purpose of the resource portion is for resource management and the purpose of the designated critical areas is for critical area protection and enhancement and protecting the public from geologic hazards and increased stormwater runoff.E. Site plans submitted as part of building permits, clearing and grading permits or other development permits shall include and delineate: 1. All flood hazard areas, as determined by King County in accordance with K.C.C. 21A.24.230; 2. Landslide, volcanic, coal mine and steep slope hazard areas; 3. Aquatic areas and wetlands; 4. Wildlife habitat conservation areas and the wildlife habitat network; 5. Buffers; and 6. Building setbacks as required by K.C.C. 21A.24.200.F. If only a part of the development site has been mapped, the part of the site that has not been mapped shall be clearly identified and labeled on the site plans. (Ord. 17539 § 50, 2013: Ord. 15051 § 156, 2004: Ord. 14449 § 11, 2002: Ord. 10870 § 465, 1993).21A.24.185 Vegetation management plans. A. If future alterations are proposed to a critical area tract created under this chapter or to an area where preservation of existing vegetation is required by ordinance, the applicant shall submit and have approved by the department a vegetation management plan before the establishment of the critical area tract or issuance of the permit requiring preservation of existing vegetation.B. The vegetation management plan shall describe the long-term management goals for the critical area tract or protected area. The management goals shall include, but are not limited to: 1. Wildlife habitat protection and enhancement; 2. Water quality protection and enhancement; 3. Maintaining or improving hydrologic conditions; and 4. Protecting the public health and safety from geologic hazards and erosion.C. If the vegetation management includes harvesting of merchantable timber, as defined in WAC 222-16-010, the vegetation management plan shall include a description of the proposed harvest practices demonstrating how the critical area management goals of this chapter will be met.D. Vegetation management practices shall avoid soil disturbance and shall be conducted in a manner that will not adversely affect slope stability, cause erosion or affect water quality. The management plan shall require the use of appropriate native plants for replacement or enhancement.E. Vegetation management plans shall be prepared by an arborist, landscape architect, forester or other qualified vegetation management specialist with technical assistance from a geologist where geologic hazard areas are involved or an ecologist or wildlife biologist or other qualified specialists where resource protection areas are involved. (Ord. 17539 § 51, 2013).21A.24.200 Building setbacks. Unless otherwise provided, an applicant shall set buildings and other structures back a distance of fifteen feet from the edges of all critical area buffers or from the edges of all critical areas, if no buffers are required. When the site disturbance is within a critical area buffer, the building setback line shall be measured from the building footprint to the edge of the approved site disturbance. The following are allowed in the building setback area:A. Landscaping;B. Uncovered decks;C. Building overhangs if the overhangs do not extend more than eighteen inches into the setback area; D. Impervious ground surfaces, such as driveways and patios, but the improvements are required to meet any special drainage provisions specified in public rules adopted for the various critical areas;E. Utility service connections as long as the excavation for installation avoids impacts to the buffer; and F. Minor encroachments if adequate protection of the buffer will be maintained. (Ord. 18767 § 9, 2018: Ord. 15051 § 157, 2004: Ord. 10870 § 467, 1993).21A.24.205 Coal mine hazard areas - classifications. Based upon a critical area report containing a coal mine hazard assessment prepared in accordance with this chapter, the department shall classify coal mine hazard areas as follows:A. Declassified coal mine areas are those areas where the risk of catastrophic collapse is not significant and that the hazard assessment report has determined do not require special engineering or architectural recommendations to prevent significant risks of property damage. Declassified coal mine areas typically include, but are not limited to, areas underlain or directly affected by coal mines at depths of more than three hundred feet as measured from the surface;B. Moderate coal mine hazard areas are those areas that pose significant risks of property damage that can be mitigated by implementing special engineering or architectural recommendations. Moderate coal mine hazard areas typically include, but are not limited to, areas underlain or directly affected by abandoned coal mine workings from a depth of zero, which is the surface of the land, to three hundred feet or with overburden-cover-to-seam thickness ratios of less than ten to one depending on the inclination of the seam; andC. Severe coal mine hazard areas are those areas that pose a significant risk of catastrophic ground surface collapse. Severe coal mine hazard areas typically include, but are not limited to, areas characterized by unmitigated openings such as entries, portals, adits, mine shafts, air shafts, timber shafts, sinkholes, improperly filled sinkholes and other areas of past or significant probability for catastrophic ground surface collapse; or areas characterized by , overland surfaces underlain or directly affected by abandoned coal mine workings from a depth of zero, which is the surface of the land, to one hundred fifty feet. (Ord. 15051 § 158, 2004).21A.24.210 Coal mine hazard areas - development standards and alterations. The following development standards apply to development proposals and alterations on sites containing coal mine hazard areas:A. The applicant shall design alterations within coal mine hazard areas to: 1. Minimize the risk of structural damage in a moderate coal mine hazard area; and 2. Eliminate or minimize significant risk of personal injury in a severe coal mine hazard area;B. Within declassified coal mine areas all alterations are allowed;C. Within moderate coal mine hazard areas and coal mine by-product stockpiles, all alterations are allowed when the risk of structural damage is minimized; andD. Within severe coal mine hazard areas the following alterations are allowed: 1. All grading, filling, stockpile removal, and reclamation activities undertaken in accordance with a coal mine hazard assessment report with the intent of eliminating or mitigating threats to human health, public safety, environmental restoration or protection of property if: a. signed and stamped plans have been prepared by a professional engineer; b. as-built drawings are prepared following reclamation activities; and c. the plans and as-built drawings are submitted to the department for inclusion with the coal mine hazard assessment report prepared for the property; 2. Private road construction when significant risk of personal injury is eliminated or minimized; 3. Buildings with less than four thousand square feet of floor area that contain no living quarters and that are not used as places of employment or public assembly when significant risk of personal injury is eliminated or minimized; and 4. Additional land use activities if consistent with recommendations contained within any mitigation plan required by a critical area report. (Ord. 15051 § 159, 2004: Ord. 13319 § 7, 1998: Ord. 11896 § 1, 1995: Ord. 10870 § 468, 1993).21A.24.220 Erosion hazard areas - development standards and alterations. The following development standards apply to development proposals and alterations on sites containing erosion hazard areas:A. Clearing in an erosion hazard area is allowed only from April 1 to October 1, except that: 1. Clearing of up to fifteen-thousand square feet within the erosion hazard area may occur at any time on a lot; 2. Clearing of noxious weeds may occur at any time; and 3. Forest practices regulated by the department are allowed at any time in accordance with a clearing and grading permit if the harvest is in conformance with chapter 76.09 RCW and Title 222 WAC;B. All subdivisions, short subdivisions, binding site plans or urban planned developments on sites with erosion hazard areas shall retain existing vegetation in all erosion hazard areas until building permits are approved for development on individual lots. The department may approve clearing of vegetation on lots if: 1. The clearing is a necessary part of a large scale grading plan; and 2. It is not feasible to perform the grading on an individual lot basis; andC. If the department determines that erosion from a development site poses a significant risk of damage to downstream wetlands or aquatic areas, based either on the size of the project, the proximity to the receiving water or the sensitivity of the receiving water, the applicant shall provide regular monitoring of surface water discharge from the site. If the project does not meet water quality standards established by law or public rules, the county may suspend further development work on the site until such standards are met. (Ord. 15051 § 160, 2004: Ord. 10870 § 469, 1993).21A.24.223 Purpose of K.C.C. 21A.24.225 through K.C.C. 21A.24.272. The purpose of K.C.C. 21A.24.224 through K.C.C. 21A.24.272 is to promote public health, safety and general welfare, and to minimize public and private losses due to flooding in flood hazard areas through provisions designed to:A. Protect human life and health;B. Minimize the expenditure of public money for costly flood-control projects;C. Minimize the need for rescue and relief efforts that are associated with flooding and generally undertaken at the expense of the general public;D. Minimize prolonged business interruptions;E. Minimize damage to public infrastructure, buildings and utilities such as water and gas mains; electric, telephone and sewer lines; and streets and bridges located in flood hazard areas;F. Help maintain a stable tax base by providing for the sound use and development of flood hazard areas so as to minimize blight areas caused by flooding;G. Notify potential buyers that the property is in a special flood hazard area;H. Notify those who occupy flood hazard areas that they assume responsibility for their actions; andI. Participate in and maintain eligibility for flood insurance and disaster relief. (Ord. 19128 § 18, 2020).21A.24.224 Definitions for K.C.C. 21A.24.223 through K.C.C. 21A.24.272. The definitions in K.C.C. chapter 21A.06 and the following definitions apply to K.C.C. 21A.24.223 through K.C.C. 21A.24.272. Where definitions in this section differ from the definitions in K.C.C. chapter 21A.06, the following definitions shall control:A. Accessory building: a nonresidential building on the same site as a principal building, the use of which is subordinate and incidental to the use of the principal building;B. Agricultural building: a nonresidential building used exclusively in connection with the production, harvesting, storage, raising or drying of agricultural products or aquatic animals or plants;C. Area of shallow flooding: an area designated as AO or AH Zone on the Flood Insurance Rate Map with a one percent or greater annual chance of flooding to an average depth of one to three feet, where a clearly defined channel does not exist, the path of flooding is unpredictable and velocity flow may be evident. Such flooding is characterized by ponding or sheet flow;D. Basement: any area of a building having its floor subgrade, which means below ground level, on all sides;E. Building: a walled and roofed structure that is principally above ground, including gas or liquid storage tanks and manufactured homes;F. Highest adjacent grade: the highest natural elevation of the ground surface before construction next to the proposed walls of a building;G. Lowest floor: the lowest floor of the lowest enclosed area, including the basement. An unfinished or flood-resistant enclosure, usable solely for parking of vehicles, building access or storage in an area other than a basement, is not considered a building's lowest floor, but only if the enclosure meets the design requirements of K.C.C. 21A.24.240;H. Nonresidential building: any building that is not a residential building;I. Recreational vehicle: a vehicle that is: 1. Built on a single chassis; 2. Four hundred square feet or less when measured at the largest horizontal projection; 3. Designed to be self-propelled or permanently towable by a light duty truck; and 4. Designed primarily not for use as a permanent dwelling unit but as a temporary living quarters for recreational camping, travel or seasonal use;J. Residential building: a building used for overnight human occupancy, except for a hospital;K. Start of construction: includes substantial improvement, and means the date the building permit was issued, but only if the actual start of construction, repair, reconstruction, rehabilitation, addition, placement or other improvement was within one hundred eighty days of the permit issuance date. "The actual start of construction" means either the first placement of permanent construction of a building on a site, such as the pouring of slab or footings, the installation of piles, the construction of columns or any work beyond the stage of excavation or the placement of a manufactured home on a foundation. Permanent construction does not include: land preparation, such as clearing, grading and filling; the installation of streets or walkways; excavation for a basement, footings, piers or foundations or the erection of temporary forms; or the installation on the property of accessory buildings, such as garages or sheds not occupied as dwelling units or not part of the main building. For a substantial improvement, "the actual start of construction" means the first alteration of any wall, ceiling, floor or other structural part of a building, whether or not that alteration affects the external dimensions of the building;L. Substantial damage: damage of any origin sustained by a building whereby the cost of restoring the building to before its damaged condition would equal or exceed fifty percent of the market value of the building before the damage occurred;M. Substantial improvement: 1. Any maintenance, repair, structural modification, reconstruction, addition or other improvement of a building, the cost of which equals or exceeds fifty percent of the market value of the building either: a. before the start of construction; or b. if the building has been damaged and is being restored, before the damage occurred; 2. Includes buildings that have incurred substantial damage regardless of the actual repair work performed; and 3. Does not include: a. improvement of a building to correct existing violations of state or local health, sanitary or safety code specifications that have been identified by the local code enforcement official and that are the minimum necessary to ensure safe living conditions; or b. alteration of a building listed on the national Register of Historic Places or a state or local inventory of historic resources, but only if the alteration will not preclude the building's continued designation as a historic building;N. Utility: an on-site system providing service to a building or structure. Utilities may be public or private and include, but are not limited to, sewer, gas, electrical, water systems, heating, ventilation, plumbing, air conditioning equipment and ductwork; andO. Water surface elevation: the height, in relation to the North American Vertical Datum, which is also known as NAVD, of 1988, or other datum, of floods of various magnitudes and frequencies in the floodplains of coastal or riverine areas. (Ord. 19128 § 19, 2020).21A.24.226 Approval of variance to floodplain development regulations not otherwise allowed by chapter by director – considerations for review – requirements – concurrence with critical areas alteration exemption request – notice – supplication requirements for submittal, review – certain variance standards not to be used.A. The director may approve variances to floodplain development regulations not otherwise allowed by this chapter. In reviewing and evaluating these variance applications, the director shall consider all technical evaluations, all relevant factors, applicable standards specified in other sections of the King County Code and: 1. The danger that materials may be swept onto other lands to the injury of others; 2. The danger to life and property due to flooding, erosion damage or channel migration; 3. The susceptibility of the proposed floodplain development and the contents of any building or structure to flood damage and the effect of such damage on the individual owner; 4. The importance of the services provided by the proposed floodplain development to the community; 5. The necessity to the floodplain development of a waterfront location, where applicable; 6. The availability of alternative locations for the proposed use that are not subject to flooding, erosion damage, or channel migration; 7. The potential of the proposed floodplain development to create an adverse effect on a federally or state-protected species or habitat; 8. The compatibility of the proposed floodplain development with existing and anticipated development; 9. The relationship of the proposed use to the Comprehensive Plan, shoreline master program, and Flood Management Plan; 10. The safety of access to the property in times of flooding for ordinary and emergency vehicles; 11. The expected heights, velocity, duration, rate of rise and sediment transport of the floodwaters, and effects of wave action, if applicable, expected at the site; and 12. The costs of providing governmental services during and after flood conditions, including emergency management services and maintenance and repair of public utilities and infrastructure such as sewer, gas, electrical, water systems, streets, and bridges.B. The director may approve variances to floodplain development regulations as follows: 1. A variance shall only be approved upon a showing by the applicant of good and sufficient cause and also upon a determination that failure to grant the variance would result in an exceptional hardship. An exceptional hardship shall not include economic or financial hardship or personal circumstances of the applicant, including inconvenience, aesthetic considerations, physical handicaps, personal preferences, or disapproval of neighbors; 2. A variance shall only be approved based upon a determination that the granting of the variance will not result in increased flood heights; 3. A variance shall only be approved based upon a determination that the granting of the variance will not result in additional threats to public safety, extraordinary public expense, create nuisances, cause fraud on or victimization of the public, or conflict with existing laws or ordinances; 4. A variance may be approved for new construction and substantial improvements to be erected on a lot of one-half acre or less in size contiguous to and surrounded by lots with existing buildings constructed below the flood protection elevation, but only if subsection A. of this section has been fully considered and all other criteria in this subsection B. have been met. As the lot size increases beyond one-half acre, the technical justification required for issuing the variance increases; 5. A variance shall not be approved within the FEMA floodway or the zero-rise floodway if any increase in water surface elevations would result; 6. A variance shall only be approved upon a determination that the variance is the minimum necessary, considering the flood, erosion, or channel migration hazard, to afford relief; 7. A variance shall not be approved that would conflict with K.C.C. 21A.24.260.C.; 8. A variance shall not be approved that allows establishment of a use that is not otherwise permitted in the zone in which the proposal is located; and 9. A variance to the nonresidential elevation and dry floodproofing standards in K.C.C. 21A.24.240.F. for agricultural buildings that equal or exceed a maximum assessed value of sixty-five thousand dollars must meet all criteria in this section as well as all criteria in K.C.C. 21A.24.228. The more restrictive requirements shall apply where there is a conflict.C. For a proposal where an applicant submits both a request for a variance as allowed under this section and a critical areas alteration exception request as allowed under K.C.C. 21A.24.070, the two requests shall be evaluated concurrently and the director's determination on both requests shall be issued at the same time.D. An applicant for a variance shall be given a written notice that the approval of the variance to construct a building below the flood protection elevation will result in increased flood insurance premium rates up to amounts as high as twenty-five dollars per one hundred dollars of coverage and will increase risks to life and property.E.1. An application for a variance to floodplain development regulations shall be submitted in writing to the department of local services, permitting division, together with any supporting documentation that demonstrates how the proposal meets the criteria in this section. 2. An application for a variance to floodplain development regulations under this section shall be reviewed as a Type II land use decision in accordance with K.C.C. 20.20.020.F. The department shall maintain in perpetuity a record of all requests for variances, including justification for their issuance.G. The variance standards in K.C.C. 21A.44.030 and the alteration exception standards in K.C.C. 21A.24.070 shall not be used for variances or exceptions to the floodplain regulations of this chapter. (Ord. 19820 § 11, 2024: Ord. 19128 § 20, 2020).21A.24.228 Approval of variances to nonresidential elevation and dry floodproofing standards for certain agricultural buildings – application – maintenance of requests – certain standards not to be used.A. The director may approve variances to the nonresidential elevation and dry floodproofing standards in K.C.C. 21A.24.240.F. for agricultural buildings that do not equal or exceed a maximum assessed value of sixty-five thousand dollars and meet the following requirements: 1. Use of the building shall be limited exclusively to production, harvesting, storage, raising or drying of, or storage of tools and equipment used for, agricultural products or aquatic animals or plants; 2. The building shall not be used in a manner that would create a threat to public safety, health and welfare, such as, but not limited to, confinement operations, structures with liquefied natural case terminals and facilities producing and storing highly volatile, toxic or water-reactive materials; 3. The building shall have low damage potential given the characteristics of the building’s construction and the base flood; 4. The building shall be constructed and placed on the site so as to offer the minimum resistance to the flow of floodwaters; 5. The portions of the building below the flood protection elevation shall be constructed with flood-resistant materials; 6. Building utilities shall not be installed except electrical fixtures, which must be elevated or dry floodproofed to or above the flood protection elevation; 7. The building shall be designed to automatically equalize hydrostatic flood forces on exterior walls by allowing for the entry and exit of floodwaters. Designs for meeting this requirement must either be certified by a registered professional engineer or architect or meet or exceed the following: a. a minimum of two openings having a net total area of no less than one square inch for every one square foot of enclosed space shall be provided. The openings shall be located on at least two opposite-side walls in the direction of flow; b. the bottom of all openings shall not be higher than one foot above the adjacent grade; c. openings may be equipped with screens, louvers, valves or other coverings or devices, but only if they allow the automatic entry and exit of floodwaters; and d. if a building has more than one room or enclosed area, each area shall have openings to allow floodwaters to automatically enter and exit; 8. The building shall not have all sides of the building below grade; 9. The building shall comply with the standards in K.C.C. 21A.24.250.B. and K.C.C. 21A.24.260.B; 10. The building shall not be located in the coastal high hazard area; 11. The applicant shall demonstrate that the strict enforcement of the standards of K.C.C. 21A.24.240.F would result in exceptional hardship to the property owner; and 12. A variance shall only be approved upon a determination that the variance is the minimum necessary, considering the flood, erosion or channel migration hazard, to afford relief.B.1. An application for a variance under this section shall be submitted in writing to the department of local services, permitting division, together with any supporting documentation that demonstrates how the proposal meets the criteria in this section. 2. An application for a variance under this section shall be reviewed as a Type I land use decision in accordance with K.C.C. 20.20.020.C. The department shall maintain in perpetuity a record of all requests for variances, including justification for their issuance.D. The variance standards in K.C.C. 21A.24.226, K.C.C. 21A.44.030 and the alteration exception standards in K.C.C. 21A.24.070 shall not be used for variances to the nonresidential elevation and dry floodproofing standards in K.C.C. 21A.24.240.F. for agricultural buildings that do not equal or exceed a maximum assessed value of sixty-five thousand dollars. (Ord. 19128 § 21, 2020).21A.24.230 Regulated flood hazard areas – components – delineation – proof area is subject to inundation by base flood in action to enforce K.C.C. Title 23 compliance.A. The regulated flood hazard area consists of one or more of the following components: 1. Floodplain; 2. Zero-rise flood fringe; 3. Zero-rise floodway; 4. FEMA floodway; and 5. Channel migration zones.B. The FEMA floodway and floodplain are identified in a scientific and engineering report entitled Flood Insurance Study for King County, Washington and Incorporated Areas, dated August 19, 2020, with accompanying Flood Insurance Rate Maps, and any revisions thereto.C.1. The department may delineate or require a delineation of a flood hazard area using data or information from any of the following sources, but only if the data is at least as restrictive as the data in the Flood Insurance Study and Flood Insurance Rate Maps referenced in subsection B. of this section. The department may also use data from the following sources to determine base flood elevations, floodway boundaries or other regulatory flood information: a. Flood Insurance Study; b. Flood Insurance Rate Maps; c. Preliminary Flood Insurance Study or pending Flood Insurance Study; d. Preliminary Flood Insurance Rate Maps or pending Flood Insurance Rate Maps; e. draft flood boundary work maps and associated technical reports; f. critical area reports prepared in accordance with FEMA standards contained in 44 C.F.R. Part 65 and consistent with the King County Surface Water Design Manual provisions for floodplain analysis; g. letters of map change; h. channel migration zone maps and studies; i. historical flood hazard information; j. basin plan or hydrologic study that includes projected flows under future developed conditions that have been completed and approved by King County; and k. any other available data that accurately classifies and delineates the flood hazard area or base flood elevation. 2. When there are multiple sources of flood hazard data for flood hazard area boundaries, FEMA floodway or zero-rise floodway boundaries, base flood elevations or cross-sections, the department may determine which data most accurately classifies and delineates the flood hazard area, as long as the data is at least as restrictive as the Flood Insurance Study and Flood Insurance Maps referenced in subsection B. of this section.D. Proof that a land use or development activity is occurring within the area mapped on the Flood Insurance Rate Maps shall be sufficient, but not required, to prove that the area of concern is subject to inundation by the base flood in an action to enforce code compliance under K.C.C. Title 23.E. A number of channel migration zones are mapped by the county for portions of river systems. These channel migration zones and the criteria and process used to designate and classify channel migration zones are specified by public rule adopted by the department. An applicant for a development proposal may submit a critical area report to the department to determine channel migration zone boundaries or classify channel migration hazard areas on a specific property if there is an apparent discrepancy between the site-specific conditions or data and the adopted channel migration zone maps. (Ord. 19128 § 22, 2020: Ord. 17841 § 39, 2014: Ord. 16686 § 2, 2009: Ord. 15051 § 161, 2004: Ord. 10870 § 470, 1993).21A.24.240 Zero-rise flood fringe - development standards and alterations. The following development standards apply to floodplain development and alterations on sites within the zero-rise flood fringe:A. Floodplain development and alterations shall not reduce the effective base flood storage volume of the floodplain. Floodplain development shall provide compensatory storage if grading or other activity displaces any effective flood storage volume. Compensatory storage is not required for grading or fill placed within the foundation of an existing residential building to bring the interior foundation grade to the same level as the lowest adjacent exterior grade. Compensatory storage shall: 1. Provide equivalent volume at equivalent elevations to that which is being displaced. For this purpose, equivalent elevations means having similar relationship to ordinary high water and to the best available ten-year, fifty-year and one-hundred-year water surface profiles. If the difference between the fifty-year and the one-hundred-year surface profiles is less than one foot, equivalent elevations means having similar relationships to ordinary high water and to the best available ten-year and one-hundred-year water surface profiles; 2. Hydraulically connect to the source of flooding; 3. Provide compensatory storage in the same construction season as when the displacement of flood storage volume occurs and before the flood season begins on September 30 for that year; 4. Occur on the site. The director may approve equivalent compensatory storage off the site if legal arrangements, acceptable to the department, are made to ensure that the effective compensatory storage volume will be preserved over time; and 5. The director may approve of off-site compensatory storage through a compensatory storage bank managed by the department of natural resources and parks;B. A structural engineer shall design and certify all elevated buildings and submit the design to the department;C. A civil engineer shall prepare a base flood depth and base flood velocity analysis and submit the analysis to the department. A base flood depth and base flood velocity analysis is not required for agricultural buildings. Floodplain development and alterations are not allowed if the base flood depth exceeds three feet and the base flood velocity exceeds three feet per second, except for the following projects: 1. Agricultural structures and farm pads; 2. Roads and bridges; 3. Utilities; 4. Surface water flow control or surface water conveyance systems; 5. Public park structures; and 6. Flood hazard mitigation projects, such as, but not limited to construction, repair or replacement of flood protection facilities or for building elevations or relocations;D. Subdivisions, short subdivisions, urban planned developments and binding site plans should be consistent with the need to minimize flood damage within the flood hazard area and shall meet the following requirements: 1. New building lots shall include five thousand square feet or more of buildable land outside the zero-rise floodway; 2. all public infrastructure and utilities such as sewer, gas, electrical and water systems are consistent with subsection J. of this section; 3. A civil engineer shall prepare detailed base flood elevations in accordance with FEMA guidelines for all new lots; 4. A development proposal shall provide adequate drainage in accordance with the King County Surface Water Design Manual to reduce exposure to flood damage; and 5. The face of the recorded subdivision, short subdivision, urban planned development or binding site plan shall include the following for all lots: a. setback areas restricting structures to designated buildable areas; b. base flood data and sources and flood hazard notes including, but not limited to, base flood elevation, required flood protection elevations, the boundaries of the floodplain and the zero-rise floodway, if determined, and channel migration zone boundaries, if determined; and c. include the following notice:"Lots and buildings located within flood hazard areas may be inaccessible by emergency vehicles during flood events. Residents and property owners should take appropriate advance precautions.";E. New, substantially improved or converted residential buildings and flood mitigation home elevations shall meet the following standards: 1. Elevate the lowest floor, including basement, to or above the flood protection elevation; 2. Fully enclosed areas below the lowest floor and below the flood protection elevation, including crawlspaces or attached garages, shall be designed to automatically equalize hydrostatic flood forces on exterior walls by allowing for the entry and exit of floodwaters. Designs for meeting this requirement must either be certified by a registered professional engineer or architect or meet or exceed the following: a. a minimum of two openings having a net total area of no less than one square inch for every one square foot of enclosed space shall be provided. The openings shall be located on at least two opposite-side walls in the direction of flow; b. the bottom of all openings shall not be higher than one foot above the adjacent grade; c. openings may be equipped with screens, louvers, valves or other coverings or devices, but only if they allow the automatic entry and exit of floodwaters; and d. if a building has more than one enclosed area, each area must have openings to allow floodwaters to automatically enter and exit; 3. Fully enclosed areas below the lowest floor meeting the criteria in subsection E.2. of this section shall not have all sides of the building below grade; 4. Fully enclosed areas below the lowest floor shall be used solely for the parking of vehicles, building access or limited storage of readily removable items; 5. Use materials and methods that are resistant to and minimize flood damage; and 6. Elevate or dry floodproof all building utilities to or above the flood protection elevation;F. New, substantially improved, or converted nonresidential buildings and flood mitigation elevations of existing nonresidential buildings shall meet the following standards: 1. Elevate the lowest floor to or above the flood protection elevation, except as otherwise provided in subsection G. of this section, or dry floodproof the building and building utilities to or above the flood protection elevation. The applicant shall provide certification by a civil or structural engineer that the dry floodproofing methods are adequate to withstand the flood-depths, pressures, velocities, impacts, uplift forces and other factors associated with the base flood. After construction, the engineer shall certify that the permitted work conforms to the approved plans and specifications; 2. Use materials and methods that are resistant to and minimize flood damage; 3. For nonresidential buildings that have not been dry floodproofed, design fully enclosed areas below the lowest floor and below the flood protection elevation, including crawlspaces or attached garages, to automatically equalize hydrostatic flood forces on exterior walls by allowing for the entry and exit of floodwaters. Designs for meeting this requirement must either be certified by a registered professional engineer or architect or meet or exceed the following: a. a minimum of two openings having a net total area of no less than one square inch for every one square foot of enclosed space shall be provided. The openings shall be located on at least two opposite-side walls in the direction of flow; b. the bottom of all openings shall not be higher than one foot above adjacent grade; c. openings may be equipped with screens, louvers, valves or other coverings or devices, but only if they allow the automatic entry and exit of floodwaters; and d. if a building has more than one enclosed area, each area shall have openings to allow floodwaters to automatically enter and exit; 4. Not have all sides of the building below grade for fully enclosed areas below the lowest floor meeting the criteria in subsection F.3. of this section; 5. Fully enclosed areas below the lowest floor shall be used solely for the parking of vehicles, building access or limited storage of readily removable items; and 6. Elevate or dry floodproof all building utilities to or above the flood protection elevation;G. New, substantially improved or converted accessory buildings may have the lowest floor below the flood protection elevation, but only if the building complies with the following: 1. The building shall not be used for human habitation; 2. The use of the building shall be limited to parking of vehicles or limited storage of readily removable items; 3. The floor area shall not exceed four hundred square feet; 4. The building should be constructed with materials and practices to minimize flood damage; 5. The building shall be built of and have flood-resistant materials for portions below the flood protection elevation; 6. The building shall be designed to automatically equalize hydrostatic flood forces on exterior walls by allowing for the entry and exit of floodwaters. Designs for meeting this requirement must either be certified by a registered professional engineer or architect or must meet or exceed the following: a. a minimum of two openings having a net total area of no less than one square inch for every one square foot of enclosed space shall be provided. The openings shall be located on at least two opposite-side walls in the direction of flow; b. the bottom of all openings shall not be higher than one foot above adjacent grade; and c. openings may be equipped with screens, louvers, valves or other coverings or devices, but only if they allow the automatic entry and exit of floodwaters; 7. Building utilities shall not be installed except electrical fixtures, which must be elevated or dry floodproofed to or above the flood protection elevation; and 8. The building shall be constructed and placed on the site so as to offer the minimum resistance to the flow of floodwaters;H. Anchor all new or substantially improved buildings to prevent flotation, collapse or lateral movement of the building. The department shall approve the method used to anchor the building;I.1. Newly sited manufactured homes and substantial improvements of existing manufactured homes shall meet the standards in subsections E. and H. of this section and shall be installed using methods and practices that minimize flood damage; 2. All manufactured homes within a new mobile home park or expansion of an existing mobile home park must meet the requirements of this subsection I.; 3. In a new or existing mobile home park located in a flood hazard area, no buildings other than mobile homes are allowed;J.1. New and replacement public infrastructure utilities including, but not limited to, sewage treatment and storage facilities, shall be elevated or dry floodproofed to or above the flood protection elevation; 2. New on-site sewage disposal systems should be located outside of the floodplain. When there is insufficient area outside the floodplain, new on-site sewage disposal systems are allowed only in the zero-rise flood fringe. On-site sewage disposal systems in the zero-rise flood fringe shall be designated and located to avoid: a. impairment to the system during flooding; and b. contamination from the system during flooding; 3. Design all new and replacement water supply systems to minimize or eliminate infiltration of floodwaters into the system; 4. above-ground utility transmission lines are allowed only for the transport of nonhazardous substances or electricity; 5. Underground utility transmission lines transporting hazardous substances shall be buried at a minimum depth of four feet below the maximum depth of scour for the base flood, as predicted by a civil engineer, and achieve sufficient negative buoyancy so that any potential for flotation or upward migration is eliminated; and 6. New water wells shall be located where not subject to ponding and not in the FEMA floodway. The well shall be protected to the flood protection elevation and shall be protected from any surface or subsurface drainage capable of impairing the quality of the groundwater supply, in accordance with WAC 173-160-171;K. Critical facilities are allowed within the zero-rise flood fringe only when a feasible alternative site is not available and the following standards are met, in addition to the other applicable standards in this section: 1. Elevate the lowest floor to the five-hundred year floodplain elevation or three or more feet above the base flood elevation, whichever is higher; 2. Dry floodproof and seal buildings to ensure that hazardous substances are not displaced by or released into floodwaters; and 3. Elevate access routes to or above the base flood elevation from the critical facility to the nearest maintained public street or roadway;L. New construction or expansion of existing farm pads is allowed only on a site with existing agriculture if emergency flood relief is required for the protection of livestock or assets or for operations that must continue during flood events as follows: 1. A farm pad is allowed only if there is no other suitable holding area on the site outside the floodplain; 2. Construct the farm pad to the standards in an approved farm management plan prepared in accordance with K.C.C. 21A.24.051 and K.C.C. chapter 21A.30; 3. The farm pad proposal shall demonstrate compliance with the following: a. flood storage compensation consistent with subsection A. of this section; b. siting and sizing that do not increase base flood elevations consistent with K.C.C. 21A.24.250.B. or, if any portion of the farm pad is located in the FEMA floodway, siting and sizing that do not increase base flood elevations consistent with K.C.C. 21A.24.260.B.; c. siting that is located in the area least subject to risk from floodwaters; and d. an alternatives analysis demonstrating adverse impacts to wetlands, wetland buffers and aquatic area buffers have been minimized; 4. The farm pad is constructed to base flood elevation plus one foot. An elevation report shall be completed after construction to demonstrate compliance with this elevation requirement; 5.a. The farm pad should be sized as is necessary for the protection of livestock and assets and operations that must continue during flood events; b. for farm pads larger than two thousand square feet of finished usable surface, a site specific evaluation of agricultural operations must demonstrate the need for the size of the pad; and c. for farm pads larger than ten thousand square feet, an area-wide analysis must demonstrate that sufficient flood storage is available for reasonably foreseeable future land use needs in the vicinity; 6. If there are multiple areas on a site that meet all of the applicable criteria, the farm pad should be located as far as practical from the interior property lines; 7. Agricultural buildings are allowed on a farm pad as shelter for livestock or other farm animals, greenhouses for plant starts to be used on the property, milking parlors, storage of farm vehicles and agricultural equipment and shelter for farm products including, but not limited to, feed, seeds, flower bulbs and hay and farm operations that must continue during a flood event. Agricultural buildings allowed on a farm pad shall not be used for retail operations or any residential or public use; and 8. The property owner shall file with the department of executive services, records and licensing services division, a notice approved by the department that restricts the use of the farm pad to nonresidential agricultural uses. The notice shall run with the land. The applicant shall submit to the department proof that the notice was filed before the department approves any permit for the construction of the farm pad;M. New or expanded livestock manure storage facilities are only allowed as follows: 1. There is not a feasible alternative area on the site outside the floodplain; 2. The livestock manure storage facility is constructed to the standards in an approved farm management plan prepared in accordance with K.C.C. 21A.24.051 and K.C.C. chapter 21A.30. The farm management plan shall demonstrate compliance with the following: a. flood storage compensation consistent with subsection A. of this section; b. siting and sizing that do not increase base flood elevations consistent with K.C.C. 21A.24.250.B. or, if the liquid manure storage facility is located in the FEMA floodway, siting and sizing that do not increase base flood elevations consistent with [K.C.C.] 21A.24.260.B.; c. dry floodproofing the liquid manure storage facility to one foot above the base flood elevation; and d. siting that is located in the area least subject to risk from floodwaters;N. Recreational vehicles must be on site for fewer than one hundred eighty consecutive days or be fully licensed and ready for highway use, which means on their wheels or jacking system, attached to the site only by quick-disconnect-type utilities and security devices and have no permanently attached additions; andO. Any alteration or relocation of a watercourse shall comply with the following standards, in addition to the other applicable standards in this title: 1. The department shall notify adjacent communities and the Washington state Department of Ecology before any alteration or relocation of a watercourse proposed by the applicant and shall submit evidence of the notification to the Federal Emergency Management Agency within six months; and 2. The applicant shall ensure that the flood-carrying capacity is maintained. (Ord. 19128 § 23, 2020: Ord. 17841 § 40, 2014: Ord. 17539 § 52, 2013: Ord. 16686 § 3, 2009: Ord. 16267 § 44, 2008: Ord. 16172 § 4, 2008: Ord. 15051 § 162, 2004: Ord. 11621 § 76, 1994: Ord. 10870 § 471, 1993).21A.24.250 Zero-rise floodway - development standards and alterations. The following development standards apply to floodplain development and alterations on sites within the zero-rise floodway:A. The development standards that apply to the zero-rise flood fringe also apply to the zero-rise floodway. The more restrictive requirements shall apply where there is a conflict;B. Floodplain development shall not increase the base flood elevation. The applicant shall perform an analysis to demonstrate that here will be no increase in the base flood elevation in accordance with Section 4.4.2 of the King County Surface Water Design Manual. The director may make an exception if appropriate legal documents are prepared and recorded in which all property owners affected by the increased flood elevations consent to the impacts on their property;C. If post and piling foundation construction techniques are used to elevate a building and the area underneath is not enclosed, blocked or otherwise obstructed, the following are presumed to produce no increase in the base flood elevation and a critical areas report is not required to establish this fact: 1. new residential buildings outside the FEMA floodway on lots in existence before November 27, 1990, that contain less than five thousand square feet of buildable land outside the zero-rise floodway if the total building footprint of all existing and proposed buildings on the lot does not exceed two-thousand square feet; 2. substantial improvements of existing residential buildings in the zero-rise floodway, but outside the FEMA floodway, if the footprint is not increased; or 3. substantial improvements of existing residential buildings that meet the standards for new residential buildings and building utilities in K.C.C. 21A.24.240.E.;D. When post or piling foundation construction techniques are not used, a critical areas report is required in accordance with K.C.C. 21A.24.110 demonstrating that the proposal will not increase the base flood elevation;E. During the flood season from September 30 to May 1 the following are not allowed in the zero-rise floodway; 1. Temporary seasonal shelters, such as tents, awnings and greenhouses, except for those used for agricultural activities and domestic household use; and 2. Staging or stockpiling of equipment, materials or substances that the director determines may be hazardous to the public health, safety or welfare except for those used for agricultural activities and domestic household use;F. New, substantially improved [or converted]* residential buildings and accessory buildings to a residential use shall be located: 1. Outside the FEMA floodway; 2. Only on lots in existence before November 27, 1990, that contain less than five thousand square feet of buildable land outside the zero-rise floodway; and 3. To the maximum extent practical, the farthest distance from the channel, unless the applicant can demonstrate that an alternative location is less subject to risk;G. New and replacement infrastructure or utilities are only allowed if: 1. The department determines that a feasible alternative site is not available; and 2. A waiver is granted by the Seattle-King County department of public health for new on-site sewage disposal facilities;H. Critical facilities, except for those listed in subsection I. of this section are not allowed within the zero-rise floodway; andI. Structures that are dependent upon the zero-rise floodway are allowed in the zero-rise floodway if the development proposal is approved by all agencies with jurisdiction and meets the development standards for the zero-rise floodway. These structures may include, but are not limited to: 1. Dams or diversions for water supply, flood control, hydroelectricproduction, irrigation or fisheries enhancement; 2. flood damage reduction facilities, such as levees, revetments and pumping stations; 3. stream bank stabilization structures only if a feasible alternative does not exist for protecting structures, public roadways, flood protection facilities or sole access routes. Bank stabilization projects must be consistent with the Integrated Streambank Protection Guidelines (Washington State Aquatic Habitat Guidelines Program, 2002) and use bioengineering techniques to the maximum extent practical. An applicant may use alternative methods to the guidelines if the applicant demonstrates that the alternative methods provide equivalent or better structural stabilization, ecological and hydrological functions and salmonid habitat; 4. Surface water conveyance facilities; 5. boat launches and related recreation structures; 6. bridge piers and abutments; and 7. Approved aquatic area or wetland restoration projects including, but not limited to, fisheries enhancement projects. (Ord. 19128 § 24, 2020: Ord. 16686 § 4, 2009: Ord. 16267 § 45, 2008: Ord. 15051 § 163, 2004: Ord. 10870 § 472, 1993).*Reviser's note: Added but not underlined in Ordinance 19128. See K.C.C. 1.24.075.21A.24.260 FEMA floodway - development standards and alterations. The following development standards apply to floodplain development and alterations on sites within the FEMA floodway:A. The development standards that apply to the zero-rise floodway also apply to the FEMA floodway. The more restrictive standards apply where there is a conflict;B. Floodplain development shall not increase the base flood elevation. A civil engineer shall certify, through hydrologic and hydraulic analyses performed in accordance with standard engineering practice, that any proposed floodplain development would not result in any increase in flood levels during the occurrence of the base flood discharge;C. New, substantially improved or converted residential buildings are prohibited in the FEMA floodway, except those buildings meeting the provisions of subsections F. or G. of this section. A residential building cannot be constructed on fill placed within the FEMA floodway;D. New nonresidential buildings are prohibited within the FEMA floodway, except for agricultural buildings within an agricultural production district that meet applicable compensatory storage and conveyance standards;E. New livestock manure storage facilities for liquid and slurry manure are prohibited in the FEMA floodway. Existing livestock manure storage facilities may be repaired or enlarged as necessary to comply with the standards in the farm’s nutrient management plan;F. Maintenance, repair, replacement or improvement of an existing residential building located within the agricultural production district on property that is zoned agriculture (A) is allowed in the FEMA floodway if the building meets the standards for residential buildings and building utilities in K.C.C. 21A.24.240 and also meets the following requirements: 1. The existing residential building was legally established; 2. The viability of the farm is dependent upon a residential building within close proximity to agricultural structures; and 3. Replacing an existing residential building within the FEMA floodway is only allowed if: a. there is not sufficient buildable area on the site outside the FEMA floodway for the replacement; b. the replacement residential building is not located in an area that increases the flood hazard in water depth, velocity or erosion; c. the building footprint of the existing residential building is not increased; and d. the existing building, including the foundation, is completely removed within ninety days of receiving a certificate of occupancy, or temporary certificate of occupancy, whichever occurs first, for the replacement building;G. Maintenance, repair or replacement of a substantially damaged existing residential building, other than a residential building located within the agricultural production district on property that is zoned agricultural (A), is allowed in the FEMA floodway if the building meets the standards for existing residential buildings and building utilities in K.C.C. 21A.24.240 and also meets the following requirements: 1. The Washington state Department of Ecology has assessed the flood characteristics of the site and determined: a. base flood depths will not exceed three feet; b. base flood velocities will not exceed three feet per second; c. there is no evidence of flood-related erosion, as determined by location of the project site in relationship to mapped channel migration zones or, if the site is not mapped, evidence of overflow channels and bank erosion; and d. a flood warning system or emergency plan is in operation; 2. The Washington state Department of Ecology has prepared a report of findings and recommendations to the department that determines the repair or replacement will not result in an increased risk of harm to life based on the characteristics of the site; 3. The department has reviewed the Washington state Department of Ecology report and concurs that the development proposal is consistent with the findings and recommendations in the report; 4. The development proposal is consistent with the findings and recommendations of the Washington state Department of Ecology report; 5. The existing residential building was legally established; and 6. Replacing an existing residential building within the FEMA floodway is only allowed if: a. there is not sufficient buildable area on the site outside the FEMA floodway; b. the replacement building is a residential building built as a substitute for a previously existing residential building of equivalent use and size; and c. the existing residential building, including the foundation, is removed within ninety days of receiving a certificate of occupancy, or temporary certificate of occupancy, whichever occurs first, for the replacement building;H. Maintenance or repair of a building that is identified as a historic resource, as defined in K.C.C. 21A.06.597, is allowed in the FEMA floodway if the building and building utilities meet the standards of K.C.C. 21A.24.240 for residential or nonresidential buildings, as appropriate; andI. Water wells shall be located outside of the FEMA floodway. (Ord. 19128 § 25, 2020: Ord. 17539 § 53, 2013: Ord. 16267 § 46, 2008: Ord. 16172 § 5, 2008: Ord. 15051 § 164, 2004: Ord. 10870 § 473, 1993).21A.24.270 Flood hazard areas - certification by land surveyor.A. For all new buildings, substantial improvements or additions affixed to the side of a building in a flood hazard area, the applicant shall provide a FEMA elevation certificate completed by a land surveyor licensed by the state of Washington documenting the as-built elevations of: 1. the top of the bottom floor, including basement, crawlspace or enclosure floor; 2. the top of the next-higher floor; 3. In coastal high hazard areas, the bottom of the lowest horizontal structure member; 4. The top of the slab of an attached garage; 5. The lowest elevation of machinery or equipment servicing the building; 6. The lowest adjacent finished grade next to the building; 7. The highest adjacent finished grade next to the building; and 8. The lowest adjacent grade at the lowest elevation of a deck or stairs, including structural support.B. The applicant shall submit a complete FEMA elevation certificate on the most current version of the form before the issuance of a certificate of occupancy or temporary certificate of occupancy, whichever occurs first. For unoccupied buildings, the applicant shall submit the FEMA elevation certificate before the issuance of the final letter of completion or temporary letter of completion, whichever occurs first.C. For all dry floodproofed nonresidential buildings, a FEMA floodproofing certificate shall be submitted by the applicant on the most current version of the form. A land surveyor licensed by the state of Washington shall complete the elevation information on the certificate and an engineer licensed by the state of Washington shall provide the floodproofed certification on the certificate. The certificate shall show the actual as-built elevation to which the building is dry floodproofed. In addition to the certificate, the following must be provided: 1. Photographs of and engineering performance documentation for all shields, gates, barriers and other components designed to provide floodproofing protection to the building; and 2. A comprehensive maintenance plan for the performance of the floodproofing components in times of flood. The maintenance plan shall address the storage or staging location of all shields, gates, barriers and floodproofing components, as well as all associated hardware and any materials or specialized tools necessary to seal the building. The maintenance plan shall also address maintenance of the following: a. exterior envelope of the building; b. all potential entry points of floodwater to the exterior of the building; c. all shields, gates, barriers or other components designed to provide floodproofing protection to the building; and d. all seals or gaskets for shields, gates, barriers, or other floodproofing components.D. The department shall maintain the certifications required by this section for public inspection and for certification under the National Flood Insurance Program. (Ord. 19128 § 26, 2020: Ord. 16686 § 5, 2009: Ord. 15051 § 165, 2004: Ord. 10870 § 474, 1993).21A.24.2705 Flood hazard areas - appeals of actions alleging alterations without permits. In an appeal of a code enforcement action taken by the department under K.C.C. Title 23 that alleges an alteration within the flood hazard area without a required permit, proof by the department by a preponderance of the evidence that the alteration occurred within any one component of the flood hazard area shall be sufficient to sustain the allegation. A finding under this section that an alteration has occurred in the flood hazard area shall not estop the department from delineating a different flood hazard area under K.C.C. 21A.24.230 during review of a development proposal. (Ord. 17841 § 42, 2014).21A.24.271 Floodplain development permit. Before initiating any new floodplain development, the person proposing the development shall obtain a floodplain development permit from King County. Exceptions to other permit requirements do not apply to floodplain development. The applicant shall ensure that all necessary permits have been obtained from those federal, state or local government agencies from which prior approval is required. (Ord. 19128 § 27, 2020: Ord. 17539 § 54, 2013).21A.24.272 Coastal high hazard areas - development standards - exceptions to flood hazard standards. Within coastal high hazard areas, which includes zone VE and adjacent zone AE areas on the Flood Insurance Rate Maps, the following applies:A. All new, substantially improved or converted residential or nonresidential buildings shall be elevated on pilings and columns so that: 1. The bottom of the lowest horizontal structural member of the lowest floor, excluding the pilings or columns, is elevated to or above the flood protection elevation; 2. The pile or column foundation and building attached thereto is anchored to resist flotation, collapse and lateral movement due to the effects of wind and water loads acting simultaneously on all building components. Wind and water loading values shall each have a one percent chance of being equaled or exceeded in any given year; and 3. All building utilities are elevated to or above the flood protection elevation;B. A registered professional engineer or architect licensed by the state of Washington shall prepare the structural design, specifications and plans for the building, and shall certify that the design and methods of construction to be used are in accordance with accepted standards of practice for meeting the provisions of subsection A. of this section. The information should be, in part, provided on a V Zone Design Certificate;C. The applicant shall provide a complete FEMA elevation certificate on the most current version of the form completed by a land surveyor licensed by the state of Washington documenting the elevation of the bottom of the lowest structural member of the lowest floor, excluding pilings and columns, of all new and substantially improved buildings and additions affixed to the side of a building. The elevation certificate should note whether or not such buildings contain a basement. The department shall maintain the FEMA elevation certificates required by this section for public inspection and for certification under the National Flood Insurance Program;D. All new buildings shall be located landward of the reach of mean high tide;E. All new buildings and substantial improvements to existing buildings shall maintain the space below the lowest floor free of obstruction. Breakaway walls are prohibited. The space can include nonsupporting open wood lattice-work or insect screening that is intended to collapse under wind and wave loads without causing collapse, displacement or other structural damage to the elevated portion of the building or supporting foundation system. The space below the lowest floor can be used only for parking of vehicles, building access or [limited]* storage of readily removeable items. The space shall not be used for human habitation;F. Fill for structural support of buildings is prohibited;G. Alterations of sand dunes is prohibited;H. All manufactured homes to be placed or substantially improved within coastal high hazard areas shall meet the standards in subsections A. through F. of this section;I. Recreational vehicles placed on sites within zones VE and adjacent AE zones must either: 1. Be on the site for fewer than one hundred eighty consecutive days; or 2. Be fully licensed and ready for highway use, which means on their wheels or jacking system, attached to the site only by quick-disconnect-type utilities and security devices and have no permanently attached additions; andJ. The following flood hazard standards do not apply to coastal high hazard areas: K.C.C. 21A.24.240.A., B., C., E., F. and G.; K.C.C. 21A.24.250; and K.C.C. 21A.24.260. (Ord. 19128 § 28, 2020: Ord. 17173 § 2, 2011).*Reviser's note: Added but not underlined in Ordinance 19128. See K.C.C. 1.24.075.21A.24.274 Channel migration - adoption of criteria, studies and maps - study delineating channel migration zone and component channel migration hazard areas.A. The department and the department of natural resources and parks, by public rule, shall adopt: 1. Criteria for channel migration designation, classification and mapping, taking into consideration, at a minimum, Washington state Department of Ecology channel migration zone mapping guidelines; and 2. Channel migration zone studies and channel migration zone maps. B. The channel migration zone and its component channel migration hazard areas shall be delineated in a channel migration zone study that is the basis for each channel migration zone map.C. The channel migration zone study: 1. Shall evaluate evidence of historical channel locations and movement, basin-scale physical characteristics, current channel conditions and other relevant factors in order to delineate the channel migration zone; 2. Shall include the present channel within the channel migration zone; 3. Shall determine the extent of channel migration hazard areas within the channel migration zone; and 4. May exclude areas from the channel migration zone that lie behind a lawfully established flood protection structure that is maintained by existing programs for public maintenance, transportation infrastructure, or other constructed feature if it is built above the elevation of the one hundred-year flood or if scientific or technical information otherwise demonstrate that the flood protection structure is not within the channel migration zone.D. An applicant for a development proposal may submit a critical area report to the department to determine channel migration zone boundaries or classify channel migration hazard areas on a specific property if there is an apparent discrepancy between the site-specific conditions or data and the adopted channel migration zone maps. If the department, in consultation with the department of natural resources and parks, based on the adopted criteria for channel migration designation, classification and mapping, determines that there is a discrepancy between the site conditions and the adopted channel migration zone maps, it shall make appropriate revisions to the maps. (Ord. 17841 § 41, 2014: Ord. 17485 §17, 2012).21A.24.275 Channel migration zones - development standards and alterations. The following development standards apply to development proposal and alterations on sites within channel migration zones that have been mapped and adopted by public rule:A. The development standards that apply to the aquatic area buffers in K.C.C. 21A.24.365 also apply to the severe channel migration zone and the portion of the moderate channel migration zone that is within the aquatic area buffer. The more-restrictive standards apply where there is a conflict;B. Only the alterations identified in K.C.C. 21A.24.045 are allowed within a severe channel migration hazard area; andC. The following standards apply to development proposals and alterations within the moderate channel migration hazard area: 1. Maintenance, repair or expansion of any use or structure is allowed if the existing structure's footprint is not expanded towards any source of channel migration hazard, unless the applicant can demonstrate that the location is the least subject to risk; 2. New primary dwelling units, accessory dwelling units or accessory living quarters, and required infrastructure, are allowed if: a. the structure is located on a separate lot in existence on or before February 16, 1995; b. a feasible alternative location outside of the channel migration hazard area is not available on-site; and c. to the maximum extent practical, the structure and supporting infrastructure is located the farthest distance from any source of channel migration hazard, unless the applicant can demonstrate that an alternative location is: (1) the least subject to risk; or (2) within the outer third of the moderate channel migration hazard area as measured perpendicular to the channel; 3. New accessory structures are allowed if: a. a feasible alternative location is not available on-site; and b. to the maximum extent practical, the structure is located the farthest distance from the migrating channel; and 4. The subdivision of property is allowed within the portion of a moderate channel migration hazard area located outside an aquatic area buffer if: a. All lots contain five-thousand square feet or more of buildable land outside of the moderate channel migration hazard area; b. Access to all lots does not cross the moderate channel migration hazard area; and c. All infrastructure is located outside the moderate channel migration hazard area except that an on-site septic system is allowed in the moderate channel migration hazard area if: (1) a feasible alternative location is not available on-site; and (2) to the maximum extent practical, the septic system is located the farthest distance from the migrating channel. (Ord. 16985 § 123, 2010: Ord. 15051 § 166, 2004: Ord. 11621 § 75, 1994).21A.24.280 Landslide hazard areas - development standards and alterations. The following development standards apply to development proposals and alterations on sites containing landslide hazard areas:A. Unless allowed as an alteration exception under K.C.C. 21A.24.070, only the alterations identified in K.C.C. 21A.24.045 are allowed within a landslide hazard area with a slope of forty percent or greater;B. A buffer is required from all edges of the landslide hazard area. To eliminate or minimize the risk of property damage or injury resulting from landslides caused in whole or part by the development, the department shall determine the size of the buffer based upon a critical area report prepared by a geotechnical engineer or geologist. If a critical area report is not submitted to the department, the minimum buffer is fifty feet. If the landslide hazard area has a vertical rise of more than two-hundred feet, the department may increase the minimum building setback in K. C. C. 21A.24.200 to one-hundred feet;C. Unless otherwise provided in K.C.C. 21A.24.045 or as a necessary part of an allowed alteration, removal of any vegetation from a landslide hazard area or buffer is prohibited;D. All alterations shall minimize disturbance to the landslide hazard area, slope and vegetation unless necessary for slope stabilization; andE. Alterations in a landslide hazard area located on a slope less than forty percent are allowed if: 1. The proposed alteration will not decrease slope stability on contiguous properties; and2. The risk of property damage or injury resulting from landsliding is eliminated or minimized. (Ord. 15051 § 167, 2004: Ord. 12822 § 9, 1997: Ord. 10870 § 475, 1993).21A.24.290 Seismic hazard areas - development standards and alterations. The following development standards apply to development proposals and alterations on sites containing seismic hazard areas:A. The department may approve alterations to seismic hazard areas only if: 1. the evaluation of site-specific subsurface conditions shows that the proposed development site is not located in a seismic hazard area; or 2. The applicant implements appropriate engineering design based on the best available engineering and geological practices that either eliminates or minimizes the risk of structural damage or injury resulting from seismically induced settlement or soil liquefaction; andB. The department may waive or reduce engineering study and design requirements for alterations in seismic hazard areas for: 1. Mobile homes; 2. Additions or alterations that do not increase occupancy or significantly affect the risk of structural damage or injury; and 3. One story buildings with less than two-thousand-five hundreds square feet of floor area or roof area, whichever is greater, and that are not dwelling units or used as places of employment or public assembly. (Ord. 16267 § 47, 2008: Ord. 15051 § 168, 2004: Ord. 10870 § 476, 1993).21A.24.300 Volcanic hazard areas - development standards and alterations. The following development standards apply to development proposal and alterations on sites containing volcanic hazard areas:A. Within volcanic hazard areas located along the White river upstream from Mud Mountain dam: 1. Critical facilities, apartments, townhouses or commercial structures are not allowed; 2. all new lots created by subdivision, short subdivision or binding site plan shall designate building areas and building setbacks outside of the volcanic hazard area; and 3. The notice of critical areas required under this chapter is required for new single detached dwellings on existing lots;B. Within volcanic hazard areas located along the White river downstream from Mud Mountain dam and the Green and Duwamish rivers, the department shall evaluate development proposals for critical facilities for risk of inundation or flooding resulting from mudflows originating on Mount Rainier. The applicant shall design critical facilities to withstand, without damage, the effects of mudflows equal in magnitude to the prehistoric Electron mudflow; andC. This section does not apply until King County has refined the mapping of volcanic hazard areas in cooperation with the United State Geological Survey and adopted volcanic hazard area maps by public rule. (Ord. 17539 § 55, 2013: Ord. 15051 § 169, 2004: Ord. 10870 § 477, 1993).21A.24.310 Steep slope hazard areas - development standards and alterations. The following development standards apply to development proposals and alterations on sites containing steep slope hazard areas:A. Except as provided in subsection D. of this section, unless allowed as an alteration exception under K.C.C. 21A.24.070, only the alterations identified in K.C.C. 21A.24.045 are allowed within a steep slope hazard area;B. A buffer is required from all edges of the steep slope hazard area. To eliminate or minimize the risk of property damage or injury resulting from slope instability, landsliding or erosion caused in whole or part by the development, the department shall determine the size of the buffer based upon a critical area report prepared by a geotechnical engineer or geologist. The department of local services shall adopt a public rule to implement this subsection, including implementing the requirements for development and review of a critical area report. 1. For new structures and substantial improvements to existing structures on sites where any portion of the steep slope hazard area extends into the coastal high hazard area or sea level rise risk area: a. The critical area report shall include an assessment of current and future risks of sea level rise conditions anticipated to occur over the next fifty years and a recommended buffer; b. If a critical area report is not submitted to the department, the minimum buffer shall be seventy-five feet; 2. For all other development not identified in subsection B.1.: a. If a critical area report is not submitted to the department, the minimum buffer shall be fifty feet; and b. For building permits for single detached dwelling units only, the department may waive the special study requirement and authorize buffer reductions if the department determines that the reduction will adequately protect the proposed development and the critical area;C. Unless otherwise provided in K.C.C. 21A.24.045 or as a necessary part of an allowed alteration, removal of any vegetation from a steep slope hazard area or buffer is prohibited; andD. All alterations are allowed in the following circumstance: 1. slopes which are forty percent or steeper with a vertical elevation change of up to twenty feet if no adverse impact will result from the exemption based on King County's review of and concurrence with a soils report prepared by a geologist or geotechnical engineer; and 2. The approved regrading of any slope which was created through previous legal grading activities. Any slope which remains forty percent or steeper following site development shall be subject to all requirements for steep slopes. (Ord. 19146 § 68, 2020: Ord. 15051 § 170, 2004: Ord. 13190 § 21, 1998: Ord. 11621 § 77, 1994: Ord. 11273 § 5, 1994: Ord. 10870 § 478, 1993).21A.24.311 Critical aquifer recharge areas - map adopted. The map entitled King County Critical Aquifer Recharge Areas, included in Attachment H* to Ordinance 17485, is hereby adopted as the designation of critical aquifer recharge areas in King County in accordance with RCW 36.70A.170. (Ord. 17485 § 21, 2012: Ord. 16267 § 48, 2008: Ord. 15051 § 172, 2004: Ord. 11481 § 2, 1994. Formerly K.C.C. 20.70.020).*Available in the King County Archives.21A.24.312 Critical aquifer recharge areas - reclassification or declassification. Upon application supported by a critical areas report that includes a hydrogeologic site evaluation, the department, in consultation with the department of natural resources and parks, may determine that an area that is or is not classified as a critical aquifer recharge area on the map adopted under K.C.C. 21A.24.311:A. Does not meet the criteria for a critical aquifer recharge area and declassify that area if it is classified as a critical aquifer recharge area;B. Has the wrong critical aquifer recharge area classification and determine the correct classification; orC. Has not been classified as a critical aquifer recharge area and should be so classified based on the standards of K.C.C. 21A.24.313. (Ord. 16267 § 49, 2008: Ord. 15051 § 173, 2004).21A.24.313 Critical aquifer recharge areas - categories. Critical aquifer recharge areas are categorized as follows:A. Category I critical aquifer recharge areas include those mapped areas that King County has determined are: 1. Highly susceptible to groundwater contamination and that are located within a sole source aquifer or a wellhead protection area; or 2. In an area where hydrogeologic mapping or a numerical flow transport model in a Washington department of health approved wellhead protection plan demonstrate that the area is within the one year time of travel to a wellhead for a Group A water system;B. Category II critical aquifer recharge areas include those mapped areas that King County has determined: 1. Have a medium susceptibility to ground water contamination and are located in a sole source aquifer or a wellhead protection area; or 2. Are highly susceptible to groundwater contamination and are not located in a sole source aquifer or wellhead protection area; andC. Category III critical aquifer recharge areas include those mapped areas that King County has determined have low susceptibility to groundwater contamination and are located over an aquifer underlying an island that is surrounded by saltwater. (Ord. 16267 § 50, 2008: Ord. 15051 § 174, 2004).21A.24.314 Critical aquifer recharge areas - King County Code provisions adopted - Washington state underground tank provisions implemented. To protect critical aquifer recharge areas, in accordance with chapter 36.70A RCW, the following provisions of the King County Code are determined to protect critical aquifer recharge areas: K.C.C. chapters 9.04, 9.12, 16.82, 21A.06, 21A.16, 21A.22 and 21A.24 and K.C.C. 17.04.010. For the purposes of RCW 90.76.040, King County declares critical aquifer recharge areas to be environmentally sensitive areas. (Ord. 16852 § 2, 2010: Ord. 15051 § 176, 2004: Ord. 11481 §§ 3, 5, 1994. Formerly K.C.C. 20.70.030).21A.24.315 Board of Health regulations adopted. The following Titles of the Code of King County Board of Health are hereby adopted in accordance with RCW 36.70A.060 to protect critical aquifer recharge areas: Title 10 "King County Solid Waste Regulations", Title 12 "King County Public Water System Rules and Regulations", and Title 13 "On-Site Sewage Disposal Systems." (Ord. 15051 § 177, 2004: Ord. 11481 § 4, 1994. Formerly K.C.C. 20.70.040).21A.24.316 Critical aquifer recharge areas - development standards. The following development standards apply to development proposals and alterations on sites containing critical aquifer recharge areas:A. Except as otherwise provided in subsection H. of this section, the following new development proposals and alterations are not allowed on a site located in a category I critical aquifer recharge area: 1. Transmission pipelines carrying petroleum or petroleum products; 2. Sand and gravel, and hard rock mining unless: a. the site has mineral zoning as of January 1, 2005; or b. mining is a permitted use on the site and the critical aquifer recharge area was mapped after the date a complete application for mineral extraction on the site was filed with the department; 3. Mining of any type below the upper surface of the saturated ground water that could be used for potable water supply; 4. Disposal of radioactive wastes, as defined in chapter 43.200 RCW; 5. Hydrocarbon extraction; 6. Commercial wood treatment facilities on permeable surfaces; 7. Underground storage tanks, including tanks that are exempt from the requirements of chapter 173 WAC, with hazardous substances, as defined in chapter 70.105 RCW, that do not comply with standards of chapter 173-360 WAC and K.C.C. Title 17; 8. Above-ground storage tanks for hazardous substances, as defined in chapter 70.105 RCW, unless protected with primary and secondary containment areas and a spill protection plan; 9. Golf courses; 10. Cemeteries; 11. Wrecking yards; 12. Landfills for hazardous waste, municipal solid waste or special waste, as defined in K.C.C. chapter 10.04; and 13. On lots smaller than one acre, an on-site septic system, unless: a. the system is approved by the Washington state Department of Health and has been listed by the Washington State Department of Health as meeting treatment standard N as provided in WAC chapter 426-272A; or b. the Seattle-King County department of public health determines that the systems required under subsection A.13.a. of this section will not function on the site.B. Except as otherwise provided in subsection H. of this section, the following new development proposals and alterations are not allowed on a site located in a category II critical aquifer recharge area: 1. Mining of any type below the upper surface of the saturated ground water that could be used for potable water supply; 2. Disposal of radioactive wastes, as defined in chapter 43.200 RCW; 3. Hydrocarbon extraction; 4. Commercial wood treatment facilities located on permeable surfaces; 5.a. Except for a category II critical aquifer recharge area located over an aquifer underlying an island that is surrounded by saltwater, underground storage tanks with hazardous substances, as defined in chapter 70.105 RCW, that do not meet the requirements of chapter 173-360 WAC and K.C.C. Title 17; and b. For a category II critical aquifer recharge area located over an aquifer underlying an island that is surrounded by saltwater, underground storage tanks, including underground storage tanks exempt from the requirements of chapter 173-360 WAC, with hazardous substances, as defined in chapter 70.105 RCW, that do not comply with the standards in chapter 173-360 WAC and K.C.C. Title 17; 6. Above-ground storage tanks for hazardous substances, as defined in chapter 70.105 RCW, unless protected with primary and secondary containment areas and a spill protection plan; 7. Wrecking yards; 8. Landfills for hazardous waste, municipal solid waste, or special waste, as defined in K.C.C. chapter 10.04; and 9. On lots smaller than one acre, an on-site septic systems, unless: a. the system is approved by the Washington state Department of Health and has been listed by the Washington state Department of Health as meeting treatment standard N as provided in WAC chapter 426-272A; or b. the Seattle-King County department of public health determines that the systems required under subsection B.9.a. of this section will not function on the site.C. Except as otherwise provided in subsection H. of this section, the following new development proposals and alterations are not allowed on a site located in a category III critical aquifer recharge area: 1. Disposal of radioactive wastes, as defined in chapter 43.200 RCW; 2. Hydrocarbon extraction; 3. Commercial wood treatment facilities located on permeable surfaces; 4. Underground storage tanks, including tanks exempt from the requirements of chapter 173-360 WAC, with hazardous substances, as defined in chapter 70.105 RCW, that do not comply with the requirements of chapter 173-360 WAC and K.C.C. Title 17; 5. Above ground storage tanks for hazardous substances, as defined in chapter 70.105 RCW, unless protected with primary and secondary containment areas and a spill protection plan; 6. Wrecking yards; and 7. Landfills for hazardous waste, municipal solid waste, or special waste, as defined in K.C.C. chapter 10.04.D. The following standards apply to development proposals and alterations that are substantial improvements on a site located in a critical aquifer recharge area: 1. The owner of an underground storage tank, including a tank that is exempt from the requirements of chapter 173 WAC, in a category I or III critical aquifer recharge area or a category II critical aquifer recharge area located over an aquifer underlying Vashon-Maury Island shall either bring the tank into compliance with the standards of chapter 173 WAC and K.C.C. Title 17 or properly decommission or remove the tank; and 2. The owner of an underground storage tank in a category II critical aquifer recharge area not located on located over an aquifer underlying Vashon-Maury Island shall bring the tank into compliance with the standards of chapter 173-360 WAC and K.C.C. Title 17 or shall properly decommission or remove the tank.E. In any critical aquifer recharge area, the property owner shall properly decommission an abandoned well.F. On a site located in a critical aquifer recharge area within the urban growth area, a development proposal for new residential development, including, but not limited to, a subdivision, short subdivision, or dwelling unit, shall incorporate best management practices included in the King County Surface Water Design Manual into the site design in order to infiltrate stormwater runoff to the maximum extent practical.G. For critical aquifer recharge areas on Vashon-Maury Island: 1. No new groundwater wells are permitted within a coastal high hazard area. A rainwater catchment system may be used as an alternative water supply source for a single family residence if the requirements of K.C.C. 13.04.070 are met; 2. All new groundwater wells within a sea level rise risk area shall include a surface seal that prevents risks of saltwater contamination caused by sea level rise conditions anticipated to occur over the next fifty years; and 3. The owner of a new well located within the sea level rise risk area shall test the well for chloride levels using testing protocols approved by the Washington state Department of Health. The owner shall report the results of the test to Seattle-King County department of public health and to the department of natural resources and parks. If the test results indicate saltwater intrusion is likely to occur, the department of natural resources and parks, in consultation with Seattle-King County department of public health, shall recommend appropriate measures in addition to the minimum requirements of this title to prevent saltwater intrusion.H. On a site greater than twenty acres, the department may approve a development proposal otherwise prohibited by subsections A., B. and C. of this section if the applicant demonstrates through a critical area report that the development proposal is located outside the critical aquifer recharge area and that the development proposal will not cause a significant adverse environmental impact to the critical aquifer recharge area.I. The provisions relating to underground storage tanks in subsections A. through D. of this section apply only when the proposed regulation of underground storage tanks has been submitted to and approved by the Washington state department of ecology, in accordance with 90.76.040 RCW and WAC 173-360-530. (Ord. 19146 § 69, 2020: Ord. 16267 § 51, 2008: Ord. 15051 § 179, 2004).21A.24.318 Wetlands - identification of and delineation of boundaries - categories.A. Identification of wetlands and delineation of their boundaries shall be done in accordance with the approved federal wetland delineation manual and applicable regional supplement as set forth in WAC 173-22-035.B. Wetlands shall be rated into category I, category II, category III and category IV based on the adopted Washington State Wetland Rating System for Western Washington, Washington state Department of Ecology publication number 14-06-029, published October 2014.C. Wetland rating categories shall not recognize illegal modifications. (Ord. 19034 § 25, 2019: Ord. 15051 § 183, 2004).21A.24.325 Wetlands – buffers.A. Except as otherwise provided in this section, buffers shall be provided from the wetland edge as follows: 1. The buffers shown on the following table apply unless modified in accordance with subsections B., C., D. and E. of this section:WETLAND CATEGORY AND CHARACTERISTICSINTENSITY OF IMPACT OF ADJACENT LAND USEHIGH IMPACTMODERATE IMPACTLOW IMPACTCategory I???Wetlands of High Conservation Value250 feet190 feet125 feetBog250 feet190 feet125 feetEstuarine200 feet150 feet100 feetCoastal Lagoon200 feet150 feet100 feetForestedBuffer width to be based on score for habitat functions or water quality functionsHabitat score from 8 to 9 points (high level of function)300 feet225 feet150 feetHabitat score from 6 to 7 points (moderate level of function)150 feet110 feet75 feetCategory I wetlands not meeting any of the criteria above100 feet75 feet50 feetCategory II???Estuarine150 feet110 feet75 feetHabitat score from 8 to 9 points (high level of function)300 feet225 feet150 feetHabitat score from 6 to 7 points (moderate level of function)150 feet110 feet75 feetCategory II wetlands not meeting any of the criteria above100 feet75 feet50 feetCategory III???Habitat score from 8 to 9 points (high level of function)300 feet225 feet150 feetHabitat score from 6 to 7 points (moderate level of function)150 feet110 feet75 feetCategory III wetlands not meeting any of the criteria above80 feet60 feet40 feetCategory IV50 feet40 feet25 feet 2. For purposes of this subsection A., unless the director determines a lesser level of impact is appropriate based on information provided by the applicant, the intensity of impact of the adjacent land use is determined as follows: a. High impact includes: (1) sites zoned commercial or industrial; (2) commercial, institutional or industrial use on a site regardless of the zoning classification; (3) nonresidential use on a site zoned for residential use; (4) high-intensity active recreation use on a site regardless of zoning, such as golf courses, ball fields and similar use; (5) all sites within the Urban Growth Area; or (6) Residential zoning greater than one dwelling unit per acre; b. Moderate impact includes: (1) residential uses on sites zoned residential one dwelling unit per acre or less; (2) residential use on a site zoned rural area, agriculture or forestry; (3) agricultural uses without an approved farm management plan; (4) utility corridors or right-of-way shared by several utilities, including maintenance roads; or (5) moderate-intensity active recreation or open space use, such as paved trails, parks with biking, jogging and similar use; and c. Low impact includes: (1) forestry use on a site regardless of zoning classification; (2) passive recreation uses, such as unpaved trails, nature viewing areas, fishing and camping areas, and other similar uses that do not require permanent structures, on a site regardless of zoning; (3) agricultural uses carried out in accordance with an approved farm management plan and in accordance with K.C.C. 21A.24.045.D.53. and K.C.C. 21A.24.045.D.54.; or (4) utility corridors without a maintenance road and little or no vegetation maintenance.B. The department may approve a modification of the minimum buffer width required by this section by averaging the buffer width if: 1. The department determines that: a. the buffer averaging will improve wetland protection if the wetland has significant differences in characteristics that effect habitat functions, such as a wetland with a forested component adjacent to a degraded emergent component or a "dual-rated" wetland with a Category I area adjacent to a lower-rated area; or b. averaging includes the corridors of a wetland complex; and 2. The resulting buffer meets the following standards: a. the total area of the buffer after averaging is equivalent to or greater than the area of the buffer before averaging; b. the additional buffer is contiguous with the standard buffer; c. the buffer at its narrowest point is never less than either seventy-five percent of the required width or seventy-five feet for Category I and II, fifty feet for Category III, and twenty-five feet for Category IV, whichever is greater; d. the averaged buffer will not result in degradation of wetland functions and values as demonstrated by a critical area report from a qualified wetland professional; and e. the buffer is increased adjacent to the higher functioning area of habitat or more sensitive portion of the wetland and decreased adjacent to the lower-functioning or less-sensitive portion as demonstrated by a critical area report from a qualified wetland professional.C. Wetland buffer widths shall also be subject to modifications under the following special circumstances: 1. For wetlands containing documented habitat for endangered, threatened or species of local importance, the following shall apply: a. the department shall establish the appropriate buffer, based on a habitat assessment, to ensure that the buffer provides adequate protection for the sensitive species; and b. the department may apply the buffer reduction rules in subsection C.6. of this section and the buffer averaging rules in subsection B. of this section; 2. For a wetland buffer that includes a steep slope hazard area or landslide hazard area, the buffer width is the greater of the buffer width required by the wetland's category in this section or the top of the hazard area; 3. For a wetland complex located outside the Urban Growth Area established by the King County Comprehensive Plan or located within the Urban Growth Area in a basin designated as "high" on the Basin and Shoreline Conditions Map, which is included as Attachment A to Ordinance 15051*, the buffer width is determined as follows: a. the buffer width for each individual wetland in the complex is the same width as the buffer width required for the category of wetland; b. if the buffer of a wetland within the complex does not touch or overlap with at least one other wetland buffer in the complex, a corridor is required from the buffer of that wetland to one other wetland buffer in the complex considering the following factors: (1) the corridor is designed to support maintaining viable wildlife species that are commonly recognized to exclusively or partially use wetlands and wetland buffers during a critical life cycle stage, such as breeding, rearing or feeding; (2) the corridor minimizes fragmentation of the wetlands; (3) higher category wetlands are connected through corridors before lower category wetlands; and (4) the corridor width is a least twenty-five percent of the length of the corridor, but no less than twenty-five feet in width; and (5) shorter corridors are preferred over longer corridors; c. wetlands in a complex that are connected by an aquatic area that flows between the wetlands are not required to be connected through a corridor; d. the department may exclude a wetland from the wetland complex if the applicant demonstrates that the wetland is unlikely to provide habitat for wildlife species that are commonly recognized to exclusively or partially use wetlands and wetland buffers during a critical life cycle stage, such as breeding, rearing or feeding; and e. the alterations allowed in a wetland buffer in K.C.C. 21A.24.045 are allowed in corridors subject to the same conditions and requirements as wetland buffers as long as the alteration is designed so as not to disrupt wildlife movement through the corridor; 4. Where a legally established roadway transects a wetland buffer, the department may approve a modification of the minimum required buffer width to the edge of the roadway if the part of the buffer on the other side of the roadway sought to be reduced: a. does not provide additional protection of the proposed development or the wetland; and b. provides insignificant biological, geological or hydrological buffer functions relating to the other portion of the buffer adjacent to the wetland; 5. If the site has an approved rural stewardship plan under K.C.C. 21A.24.055, the buffer widths shall be established under the rural stewardship plan and shall not exceed the standard for a low impact land use, unless the department determines that a larger buffer is necessary to achieve no net loss of wetland ecological function; and 6. The buffer widths required for proposed land uses with high intensity impacts to wetlands can be reduced to those required for moderate intensity impacts under the following conditions: a. For wetlands that score moderate or high for habitat, which means six points or higher, the width of the buffer can be reduced if both of the following criteria are met: (1) A relatively undisturbed vegetated corridor at least one-hundred feet wide is protected between the wetland and any other Priority Habitats as defined by the Washington state Department of Fish and Wildlife in the priority habitat and species list. The corridor must be protected for the entire distance between the wetland and the priority habitat and legally recorded via a conservation easement; and (2) Measures to minimize the impacts of different land uses on wetlands as identified in subsection C.6.b. of this section are applied; and b. For wetlands that score low for habitat, which means less than six points, the buffer width can be reduced to that required for moderate intensity impacts by applying measures to minimize impacts of the proposed land uses, as follows:DisturbanceMeasures to minimize impactsLightsDirect lights away from wetland. NoiseLocate activity that generates noise away from wetland. If warranted, enhance existing buffer with native vegetation plantings adjacent to noise source. For activities that generate relatively continuous, potentially disruptive noise, such as certain heavy industry or mining, establish an additional ten-foot heavily vegetated buffer strip immediately adjacent to the outer wetland buffer.Toxic runoffRoute all new untreated runoff away from wetland while ensuring wetland is not dewatered. Establish covenants limiting use of pesticides within 150 feet of wetland. Apply integrated pest management.Stormwater runoffRetrofit stormwater detention and treatment for roads and existing adjacent development. Prevent channelized flow from lawns that directly enters the buffer. Use low impact intensity development techniques identified in the King County Surface Water Design Manual.Change in water regimeInfiltrate or treat, detain and disperse into buffer new runoff from impervious surfaces and new lawns.Pets and human disturbanceUse privacy fencing or plant dense vegetation to delineate buffer edge and to discourage disturbance using vegetation appropriate for the ecoregion. Place wetland and its buffer in a separate tract or protect with a conservation easement.DustUse best management practices to control dust.D. The department may approve a modification to the buffers established in subsection A. of this section if the wetland was created or its characterization was upgraded as part of a voluntary enhancement or restoration project.E. If the site is located within the shoreline jurisdiction, the department shall determine that a proposal to reduce wetland buffers under this section will result in no net loss of shoreline ecological functions. (Ord. 19034 § 26, 2019: Ord. 16985 § 124, 2010: Ord. 16950 § 25, 2010: Ord. 16267 § 52, 2008: Ord. 15051 § 185, 2004).*Available in the King County Archives.21A.24.335 Wetlands - development standards and alterations. The following development standards apply to development proposals and alterations on sites containing wetlands or their buffers:A. Unless allowed as an alteration exception under K.C.C. 21A.24.070, only the alterations identified in K.C.C. 21A.24.045 are allowed in wetlands and wetland buffers;B. The applicant shall not introduce any plant or wildlife that is not indigenous to the Puget Sound lowland into any wetland or wetland buffer unless authorized by a state or federal permit or approval;C. A category IV wetland less than two-thousand-five-hundred square feet that is not part of a wetland complex may be altered in accordance with an approved mitigation plan by relocating the wetland into a new wetland, with equivalent or greater functions, or into an existing wetland at the ratios specified in K.C.C. 21A.24.340 based on the type of mitigation measures proposed; andD. Alterations to category I wetlands containing bogs or fens are limited to K.C.C. 21A.24.045 D.20. and D.52. (Ord. 16267 § 53, 2008: Ord. 15051 § 187, 2004).21A.24.340 Wetlands - specific mitigation requirements. In addition to the requirements in K.C.C. 21A.24.125 and 21A.24.130, the following applies to mitigation to compensate for the adverse impacts associated with an alteration to a wetland or wetland buffer:A. Mitigation measures must achieve equivalent or greater wetland functions, including, but not limited to: 1. Habitat complexity, connectivity and other biological functions; and 2. Seasonal hydrological dynamics, as provided in the King County Surface Water Design Manual;B. The following ratios of area of mitigation to area of alteration apply to mitigation measures for permanent alterations: 1. For alterations to a wetland buffer, a ratio of one to one; and 2. For alterations to a wetland:Category and type of wetlandWetland reestablishment or creationWetland rehabilitation1:1 Wetland reestablishment or wetland creation (R/C) and wetland enhancement (E)Wetland enhancement onlyCategory IV1.5:13:11:1 R/C and 2:1 E6:1Category III2:14:11:1 R/C and 2:1 E8:1Category II estuarineCase-by-case4:1 rehabilitation of an estuarine wetlandCase-by-caseCase-by-caseAll other Category II3:18:11:1 R/C and 4:1 E12:1Category I forested6:112:11:1 R/C and 10:1 ECase-by-caseAll other Category I4:18:11:1 R/C and 6:1 ECase-by-caseCategory I wetlands of high conservation valueNot allowed6:1 rehabilitation of a wetland of high conservation valueCase-by-caseCase-by-caseCategory I coastal lagoonNot allowed6:1 rehabilitation of a coastal lagoonCase-by-caseCase-by-caseCategory I bogNot allowed6:1 rehabilitation of a bogCase-by-caseCase-by-caseCategory I estuarineCase-by-case6:1 rehabilitation of an estuarine wetlandCase-by-caseCase-by-caseC. The following ratios of area of mitigation to area of alteration apply to mitigation measures for temporary alterations where wetlands will not be impacted by permanent fill material:Wetland categoryPermanent conversion of forested and shrub wetlands into emergent wetlandsMitigation for temporal loss of forested and shrub wetlands when the impacted wetlands will be revegetated to forest or shrub communitiesEnhancementRehabilitationCreation or restorationEnhancementRehabilitationCreation or restorationCategory I6:14.5:13:13:12:11.5:1Category II3:12:11.5:11.5:11:1.75:1Category III2:11.5:11:11:1.75:1.5:1Category IV1.5:11:1.75:1Not applicableNot applicableNot applicableD. The department may increase the mitigation ratios provided in subsections B. and C. of this section under the following circumstances: 1. The department determines there is uncertainty as to the probable success of the proposed restoration or creation; 2. A significant period of time will elapse between the impact caused by the development proposal and the establishment of wetland functions at the mitigation site; 3. The proposed mitigation will result in a lower category wetland or reduced functions relative to the wetland being impacted; or 4. The alteration causing the impact was an unauthorized impact.E. The department may decrease the mitigation ratios provided in subsections B. and C. of this section under the following circumstances: 1. The applicant demonstrates by documentation submitted by a qualified wetland specialist that the proposed mitigation actions have a very high likelihood of success based on hydrologic data and prior experience; 2. The applicant demonstrates by documentation by a qualified wetland specialist that the proposed actions for compensation will provide functions and values that are significantly greater than the wetland being impacted; 3. The applicant demonstrates that the proposed actions for mitigation have been conducted in advance of the impact caused by the development proposal and that the actions are successful; or 4. In wetlands where several wetland hydrogeomorphic classes, including, but not limited to depressional, slope, riverine and flow through, are found within one delineated boundary, the department may decrease the ratios if: a. impacts to the wetland are all within an area that has a different hydrogeomorphic class from the one used to establish the category; b. the category of the area with a different class is lower than that of the entire wetland; and c. the applicant provides adequate hydrologic and geomorphic data to establish that the boundary between the hydrogeomorphic classes lies outside of the footprint of the impacts.F. For temporary alterations to a wetland or its buffer that are predominately woody vegetation, the department may require mitigation in addition to restoration of the altered wetland or buffer; andG. Mitigation of an alteration to a buffer of a wetland that occurs along an aquatic area lake shoreline in accordance with an allowed alteration under this chapter shall include, but is not limited to, on-site revegetation, maintenance and other restoration of the buffer or setback area to the maximum extent practical. (Ord. 19034 § 27, 2019: Ord. 16267 § 54, 2008: Ord. 15051 § 188, 2004: Ord. 14045 § 48, 2001: Ord. 13190 § 23, 1998: Ord. 11621 § 79, 1994: Ord. 10870 § 481, 1993).21A.24.342 Wetlands - agreement to modify mitigation ratios.A. The department may enter into an agreement with an applicant to establish mitigation ratios to compensate for the adverse impacts to wetlands of the applicant’s development proposals that differ from the ratios required by K.C.C. 21A.24.340.B. The agreement shall require that the applicant: 1. Demonstrate with scientifically-valid data that the program implemented by the applicant has achieved long-term success in reducing the risk of failure and temporal loss of function of the applicant’s wetland mitigation projects; and 2. Implement a scientifically rigorous mitigation, monitoring and adaptive management program that includes the following elements: a. a mitigation planning process that requires mitigation plans to be prepared and signed by a qualified wetland specialist. The mitigation planning process shall use the guidelines contained in Washington State Department of Ecology - U.S. Army Corps of Engineers Publication 04-06-013b "Guidance on Wetland Mitigation in Washington State" or an alternative approach acceptable to the department; b. construction oversight by a qualified wetland specialist; c. postconstruction monitoring and reporting by experienced and qualified personnel using scientifically rigorous and accepted methodologies to assess whether the mitigation has been installed and whether it meets the approved goals, objectives and performance standards identified in the mitigation plan; d. ongoing mitigation site maintenance to facilitate the achievement of the approved goals, objectives and performance standards identified in the mitigation plan. Maintenance includes, but not limited to, the removal and control of nonnative vegetation, replacement of dead or dying planted vegetation and trash and debris removal; e. financing or funding guarantees for the duration of the mitigation and monitoring program. At a minimum, funding guarantees must be in place until mitigation activities have met the established performance standards and have been approved by the department; and f. an adaptive management program that requires the evaluation and adjustment of remedial actions contained within the contingency plan developed as part of the mitigation planning process.B. The mitigation ratios established by the agreement authorized by this section shall be based on data prepared by the applicant regarding the effectiveness of past and ongoing mitigation projects implemented and monitored by the applicant. In establishing the mitigation ratios, the department shall consider: 1. The applicant’s demonstrated success in meeting mitigation performance standards for the different types of mitigation, such as re-establishment, creation, rehabilitation, and enhancement; and 2. The hydrogeomorphic classification, such as slope, riverine, depressional and tidal fringe, of the wetland. C. The applicant may request coordinated review of the agreement with the Washington state Department of Ecology and the United States Army Corps of Engineers. (Ord. 15051 § 189, 2004).21A.24.345 Specific mitigation requirements - wetland mitigation banking. The department may approve mitigation in advance of unavoidable adverse impacts to wetlands caused by the development activities through an approved wetland mitigation bank. Wetland mitigation banking is not allowed in the agricultural production districts if the purpose is to compensate for filling wetlands for development outside of the agricultural production districts. (Ord. 15051 § 190, 2004: Ord. 14045 § 49, 2001: Ord. 11621 § 72, 1994).*Available in the King County Archives.21A.24.355 Aquatic areas — water types.A. Aquatic areas are categorized or "typed" as follows: 1. Type S waters include all aquatic areas inventoried as "shorelines of the state" under King County's Shoreline Master Program, K.C.C. chapter 21A.25, in accordance with chapter 90.58 RCW; 2. Type F waters include all segments of aquatic areas that are not type S waters and that contain fish or fish habitat, including waters diverted for use by a federal, state or tribal fish hatchery from the point of diversion for one-thousand-five-hundred feet or the entire tributary if the tributary is highly significant for protection of downstream water quality; 3. Type N waters include all segments of aquatic areas that are not type S or F waters and that are physically connected to type S or F waters by an above-ground channel system, stream or wetland; and 4. Type O waters include all segments of aquatic areas that are not type S, F or N waters and that are not physically connected to type S, F or N waters by an above-ground channel system, pipe or culvert, stream or wetland.B. For the purposes of the water types in subsection A. of this section, an above-ground channel system is considered to be present if the one-hundred year floodplains of both the contributing and receiving waters are connected.C. The department may determine that an area upstream of a legal human-made barrier is not fish habitat considering the following factors: 1. The human-made barrier is located beneath public infrastructure that is unlikely to be replaced and it is not feasible to remove the barrier without removing the public infrastructure; 2. The human-made barrier is in the Urban Growth Area established by the King County Comprehensive Plan and is located beneath one or more dwelling units and it is not feasible to remove the barrier without removing the dwelling unit; 3. The human-made barrier is located in a subbasin that is not designated "high" on the Basin and Shoreline Conditions Map which is included as Attachment A to Ordinance 15051**; or 4. The human-made barrier is not identified for removal by a public agency or in an adopted watershed plan. (Ord. 19034 § 28, 2019: Ord. 16267 § 55, 2008: Ord. 15051 § 192, 2004).21A.24.358 Aquatic areas - buffers.A. Aquatic area buffers shall be measured as follows: 1. From the ordinary high water mark or from the top of bank if the ordinary high water mark cannot be identified; 2. If the aquatic area is located within a mapped severe channel migration area, the aquatic area buffer width shall be the greater of the aquatic area buffer width as measured consistent with subsection A.1. of this section or the outer edge of the severe channel migration area; and 3. If the aquatic area buffer includes a steep slope hazard area or landslide hazard area, the aquatic area buffer width is the greater of either the aquatic area buffer in this section or the top of the hazard area.B. Within the Urban Growth Area, aquatic area buffers shall be as follows: 1. A type S or F aquatic area buffer is one-hundred-fifteen-feet; 2. A type S or F aquatic area buffer in a basin or shoreline designated as "high" on the Basin and Shoreline Conditions Map is one-hundred-sixty-five-feet; 3. A type N aquatic area buffer is sixty-five-feet; and 4. A type O aquatic area buffer is twenty-five-feet.C. Outside the Urban Growth Area, aquatic area buffers shall be as follows: 1. A type S or F aquatic area buffer is one-hundred-sixty-five-feet; 2. A type N aquatic area buffer is sixty-five-feet; and 3. A type O aquatic area buffer is twenty-five-feet.D. Within the Bear Creek drainage basin a type N aquatic area buffer in a designated regionally significant resource area is one-hundred-feet.E. The department may approve a modification of buffer widths if: 1.a. The department determines that through buffer averaging the ecological structure and function of the resulting buffer is equivalent to or greater than the structure and function before averaging and meets the following standards: (1) the total area of the buffer is not reduced; (2) the buffer area is contiguous; and (3) averaging does not result in the reduction of the minimum buffer for the buffer area waterward of the top of the associated steep slopes or for a severe channel migration hazard area; b. the applicant demonstrates that the buffer cannot provide certain functions because of soils, geology or topography, in which case the department shall establish a buffers width that protects the remaining ecological functions that the buffer can provide; c. the site is zoned RA and is subject to an approved rural stewardship plan. In modifying the buffers, the department shall consider factors such as, the basin and shoreline condition, the location of the site within the basin and shoreline, the buffer condition and the amount of clearing; d. a legally established roadway transects an aquatic area buffer, the roadway edge closest to aquatic area shall be the extent of the buffer, if the part of the buffer on the other side of the roadway provides insignificant biological or hydrological function in relation to the portion of the buffer adjacent to the aquatic area; or e. the aquatic area is created or its type is changed as a result of enhancement or restoration projects that are not mitigation for a development proposal or alteration; and 2. If the site is located within the shoreline jurisdiction, that no net loss of shoreline ecological functions will result when considering projects that combine reduced buffers and habitat restoration. (Ord. 16985 § 125, 2010: Ord. 16950 § 26, 2010: Ord. 16267 § 56, 2008: Ord. 15051 § 193, 2004).21A.24.365 Aquatic areas - development standards and alterations. The following development standards apply to development proposals and alterations on sites containing aquatic areas or their buffers:A. Unless allowed as an alteration exception under K.C.C. 21A.24.070, only the alterations identified in K.C.C. 21A.24.045 are allowed in aquatic areas and aquatic area buffers;B. Grading for allowed alterations in aquatic area buffers is only allowed from May 1 to October 1. This period may be modified when the department determines it is necessary along marine shorelines to protect critical forage fish and salmonid migration or as provided in K.C.C. 16.82.095;C. The moisture-holding capacity of the topsoil layer on all areas of the site not covered by impervious surfaces should be maintained by: 1. Minimizing soil compaction, or 2. Reestablishing natural soil structure and the capacity to infiltrate;D. New structures within an aquatic area buffer should be sited to avoid the creation of future hazard trees and to minimize the impact on groundwater movement; andE. To the maximum extent practical: 1. The soil duff layer should not be disturbed, but if disturbed, should be redistributed to other areas of the project site where feasible; 2. A spatial connection should be provided between vegetation within and outside the aquatic area buffer to prevent creation of wind throw hazards; and 3. Hazard trees should be retained in aquatic area buffers and either topped or pushed over toward the aquatic area; andF. If a restoration, enhancement or mitigation project proposes to place large woody debris waterward of the ordinary high water mark of a Type S aquatic area, the applicant shall consider the potential for recreational hazards in project design. (Ord. 16267 § 57, 2008: Ord. 15051 § 195, 2004).21A.24.380 Aquatic areas - specific mitigation requirements. In addition the requirements in K.C.C. 21A.24.130, 21A.24.125 and 21A.24.133, the following applies to mitigation to compensate for the adverse impacts associated with an alteration to an aquatic area or aquatic area buffer:A. Mitigation measures must achieve equivalent or greater aquatic area functions including, but not limited to: 1. Habitat complexity, connectivity and other biological functions; 2. Seasonal hydrological dynamics, water storage capacity and water quality; and 3. Geomorphic and habitat processes and functions;B. To the maximum extent practical, permanent alterations that require restoration or enhancement of the altered aquatic area, aquatic area buffer or another aquatic area or aquatic area buffer must consider the following design factors, as applicable to the function being mitigated: 1. The natural channel or shoreline reach dimensions including its depth, width, length and gradient; 2. The horizontal alignment and sinuosity; 3. The channel bed, sea bed or lake bottom with identical or similar substrate and similar erosion and sediment transport dynamics; 4. Bank and buffer configuration and erosion and sedimentation rates; and 5. Similar vegetation species diversity, size and densities in the channel, sea bed or lake bottom and on the riparian bank or buffer;C. Mitigation to compensate for adverse impacts shall meet the following standards: 1. Not upstream of a barrier to fish passage; 2. Is equal or greater in biological function; and 3. To the maximum extent practical is located on the site of the alteration or within one-half mile of the site and in the same aquatic area reach at a 1:1 ratio of area of mitigation to area of alteration; or 4. Is located in the same aquatic area drainage subbasin or marine shoreline and attains the following ratios of area of functional mitigation to area of alteration: a. a 3:1 ratio for a type S or F aquatic area; and b. a 2:1 ratio for a type N or O aquatic area;D. For purposes of subsection C. of this section, a mitigation measure is in the same aquatic area reach if the length of aquatic area shoreline meets the following criteria: 1. Similar geomorphic conditions including slope, soil, aspect and substrate; 2. Similar processes including erosion and transport of sediment and woody debris; 3. Equivalent or better biological conditions including invertebrates, fish, wildlife and vegetation; and 4. Equivalent or better biological functions including mating, reproduction, rearing, migration and refuge; or 5. For tributary streams, a distance of no more than one-half mile;E. The department may reduce the mitigation ratios in subsection C. of this section to 2:1 ratio for a type S or F aquatic area and 1.5:1 ratio for a type N or O aquatic area if the applicant provides a scientifically rigorous mitigation monitoring program that includes the following elements: 1. Monitoring methods that ensure that the mitigation meets the approved performance standards identified by the department; 2. Financing or funding guarantees for the duration of the monitoring program; and 3. Experienced, qualified staff to perform the monitoring;F. For rectifying an illegal alteration to any type of aquatic area or its buffer, mitigation measures must meet the following standards: 1. Located on the site of the illegal alteration at a 1:1 ratio of area of mitigation to area of alteration; and 2. To the maximum extent practical, replicates the natural prealteration configuration at its natural prealteration location including the factors in subsection B. of this section; andG. The department may modify the requirements in this section if the applicant demonstrates that, with respect to each aquatic area function, greater functions can be obtained in the affected hydrologic unit that the department may determine to be the drainage subbasin through alternative mitigation measures.H. For temporary alterations to an aquatic area or its buffer that is predominately woody vegetation, the department may require mitigation in addition to restoration of the altered aquatic area or buffer. (Ord. 16267 § 58, 2008: Ord. 15051 § 197, 2004: Ord. 10870 § 485, 1993).21A.24.381 Aquatic habitat restoration project approval. To ensure that agriculture will remain the predominate use in the agriculture production district, the department shall only approve an aquatic habitat restoration project, a floodplain restoration project or a project under the mitigation reserves program that is proposed for a site located within an agricultural production district, as follows:A. The project shall be allowed only when supported by owners of the land where the proposed project is to be sited;B. Except as provided in subsection C. of this section, the project shall be located on lands that the department of natural resources and parks determines are unsuitable for direct agricultural production purposes, such as portions of property that have not historically been farmed due to soil conditions or frequent flooding and that it determines cannot be returned to productivity by drainage maintenance; andC. If the project is located on land determined by the department of natural resources and parks to be suitable for direct agriculture, then: 1. The applicant shall demonstrate to the satisfaction of the department that there are no unsuitable lands available within the agricultural production district that meet the technical or locational requirements of the project; 2. The applicant shall demonstrate to the satisfaction of the department of natural resources and parks that the project will not reduce the ability to farm in the area and that agriculture will remain the predominate use in the agricultural production district; and 3. The project must either: a. be included in, or be consistent with, an approved Water Resources Inventory Area Plan, Farm Management Plan, Flood Management Plan or other similar watershed scale plan; or b. not reduce the baseline agricultural productivity within the agricultural production district. (Ord. 19820 § 12, 2024: Ord. 17485 § 22, 2012: Ord. 16267 § 59, 2008).21A.24.382 Wildlife habitat conservation areas - development standards.The following development standards apply to development proposals and alterations on sites containing wildlife habitat conservation areas:A. Unless allowed as an alteration exception under K.C.C. 21A.24.070, only the alterations identified in K.C.C. 21A.24.045 are allowed within a wildlife habitat conservation area;B. For a bald eagle: 1. The wildlife habitat conservation area is an area with a four-hundred-foot radius from an active nest; 2. Between March 15 and April 30, alterations are not allowed within eight hundred feet of the nest; and 2. Between January 1 and August 31, land clearing machinery, such as bulldozers, graders or other heavy equipment, may not be operated within eight hundred feet of the nest;C. For a great blue heron: 1. The wildlife habitat conservation area is an area with an eight-hundred-twenty-foot radius from the rookery. The department may increase the radius up to an additional one-hundred sixty-four feet if the department determines that the population of the rookery is declining; and 2. Between January 1 and July 31, clearing or grading are not allowed within nine-hundred-twenty-four feet of the rookery;D. For a marbled murrelet, the wildlife habitat conservation area is an area with a one-half-mile radius around an active nest;E. For a northern goshawk, the wildlife habitat conservation area is an area with a one-thousand-five-hundred-foot radius around an active nest located outside of the urban growth area;F. For an osprey: 1. The wildlife habitat conservation area is an area with a two-hundred-thirty-foot radius around an active nest; and 2. Between April 1 and September 30, alterations are not allowed within six-hundred-sixty feet of the nest;G. For a peregrine falcon: 1. The wildlife habitat conservation area is an area extending for a distance of one-thousand feet of an eyrie on a cliff face, the area immediately above the eyrie on the rim of the cliff, and the area immediately below the cliff; 2. Between March 1 and June 30, land-clearing activities that result in loud noises, such as from blasting, chainsaws or heavy machinery, are not allowed within one-half mile of the eyrie; and 3. New power lines may not be constructed within one-thousand feet of the eyrie;H. For a spotted owl, the wildlife habitat conservation area is an area with a three-thousand-seven-hundred-foot radius from an active nest;I. For a Townsend's big-eared bat: 1. Between June 1 and October 1, the wildlife habitat conservation area is an area with a four-hundred-fifty-foot radius from the entrance to a cave or mine, located outside of the urban area, with an active nursery colony 2. Between November 1 and March 31, the wildlife habitat conservation area is an area with a four-hundred-fifty-foot radius around the entrance to a cave or mine located outside the urban growth area serving as a winter hibernacula; 3. Between March 1 and November 30, a building, bridge, tunnel, or other structure used solely for day or night roosting may not be altered or destroyed; 4. Between May 1 and September 15, the entrance into a cave or mine that is protected because of bat presence is protected from human entry; and 5. A gate across the entrance to a cave or mine that is protected because of bat presence must be designed to allow bats to enter and exit the cave or mine;J. For a Vaux's swift: 1. The wildlife habitat conservation area is an area with a three-hundred-foot radius around an active nest located outside of the urban growth areas; 2. Between April 1 and October 31, clearing, grading, or outdoor construction is not allowed within four hundred feet of an active or potential nest tree. The applicant may use a species survey to demonstrate that the potential nest tree does not contain an active nest;K. The department shall require protection of an active breeding site of any federal or state listed endangered, threatened, sensitive and candidate species or King County species of local importance not listed in subsections B. through J. of this section. If the Washington state Department of Fish and Wildlife has adopted management recommendations for a species covered by this subsection, the department shall follow those management recommendations. If management recommendations have not been adopted, the department shall base protection decisions on best available science. (Ord. 17485 § 23, 2012: Ord. 15051 § 198, 2004).21A.24.383 Wildlife habitat conservation areas - modification. Upon request of the applicant and based upon a site-specific critical areas report that includes, but is not limited to, an evaluation of the tolerance of the animals occupying the nest or rookery to the existing level of development in the vicinity of the nest or rookery, the department may approve a reduction of the wildlife habitat conservation area for the following species:A. Bald eagle;B. Great blue heron; andC. Osprey. (Ord. 17485 § 24, 2012: Ord. 15051 § 199, 2004).21A.24.385 Wildlife habitat networks - applicability. The department shall make certain that segments of the wildlife habitat network are set aside and protected along the designated wildlife habitat network adopted by the King County Comprehensive Plan as follows:A. This section applies to the following development proposals on parcels that include a segment of the designated wildlife habitat network: 1. All urban planned developments, fully contained communities, binding site plans, subdivisions and short subdivisions; and 2. All development proposals on individual lots unless a segment of the wildlife habitat network in full compliance with K.C.C. 21A.24.386 already exists in a tract, easement or setback area, and a notice of the existence of the segment has been recorded;B. Segments of the wildlife habitat network must be identified and protected in one of the following ways: 1. In urban planned developments, fully contained communities, binding site plans, subdivisions and short subdivisions, native vegetation is placed in a contiguous permanent open-space tract with all developable lots sited on the remaining portion of the project site, or the lots are designed so that required setback areas can form a contiguous setback covering the network segments; or 2. For individual lots, the network is placed in a county-approved setback area. To the maximum extent practical, existing native vegetation is included in the network. The notice required by K.C.C. 21A.27.170 is required; andC. All wildlife habitat network tracts or setback areas must meet the design standards in K.C.C. 21A.24.386. (Ord. 15051 § 201, 2004: Ord. 13694 § 90, 1999: Ord. 11621 § 52, 1994. Formerly K.C.C. 21A.14.260).21A.24.386 Wildlife habitat networks - development standards and alterations. The following standards apply to development proposals and alterations on sites containing wildlife habitat network:A. Unless allowed as an alteration exception under K.C.C. 21A.24.070, only the alterations identified in K.C.C. 21A.24.045 are allowed in the wildlife habitat network;B. The wildlife habitat network is sited to meet the following conditions: 1. The network forms one contiguous tract or setback area that enters and exits the property where the network crosses the property boundary; 2. To the maximum extent practical, the network maintains a width of three-hundred feet. The network width shall not be less than one-hundred-fifty feet at any point; and 3. The network is contiguous with and includes critical areas and their buffers; 4. To the maximum extent practical, the network connects isolated critical areas or habitat; and 5. To the maximum extent practical, the network connects with wildlife habitat network segments, open space tracts or wooded areas on adjacent properties, if present;C. The wildlife habitat network tract must be permanently marked in accordance with this chapter;D. An applicant proposing recreation, forestry or any other use compatible with preserving and enhancing the habitat value of the wildlife habitat network located within the site must have an approved management plan. The applicant shall include and record the approved management plan for a binding site plan or subdivision with the covenants, conditions and restrictions (CCRs), if any. Clearing within the wildlife habitat network in a tract or tracts is limited to that allowed by an approved management plan;E. If the wildlife habitat network is contained in a setback area, a management plan is not required. Clearing is not allowed within a wildlife habitat network within a setback area on individual lots, unless the property owner has an approved management plan;F. In urban planned developments, fully contained communities, binding site plans, subdivisions and short subdivisions a homeowners association or other entity capable of long term maintenance and operation shall monitor and assure compliance with any approved management plan;G. Segments of the wildlife habitat network set aside in tracts, conservation easements or setback area must comply with K.C.C. 16.82.150;H. The department may credit a permanent open space tract containing the wildlife habitat network toward the other applicable requirements such as surface water management and the recreation space requirement of K.C.C. 21A.14.180, if the proposed uses within the tract are compatible with preserving and enhancing the wildlife habitat value. Restrictions on other uses within the wildlife habitat network tract shall be clearly identified in the management plan;I. The director may waive or reduce these standards for public facilities such as schools, fire stations, parks and road projects. (Ord. 15051 § 203, 2004: Ord. 11621 § 53, 1994. Formerly K.C.C. 21A.14.386).21A.24.388 Wildlife habitat conservation areas and wildlife networks - specific mitigation requirements.In addition to the requirements in K.C.C. 21A.24.130, 21A.24.125 and 21A.24.133, the following applies to mitigation to compensate for the adverse impacts associated with wildlife habitat conservation areas and wildlife habitat networks:A. Mitigation to compensate for the adverse impacts to a wildlife habitat conservation area must prevent disturbance of each protected species. On-site mitigation may include management practices, such as timing of the disturbance. Off-site mitigation is limited to sites that will enhance the wildlife habitat conservation area;B. Mitigation to compensate for the adverse impacts to the wildlife habitat network must achieve equivalent or greater biologic functions including, but not limited to, habitat complexity and connectivity functions. Specific mitigation requirements for impacts to the wildlife habitat network shall: 1. Expand or enhance the wildlife network as close to the location of impact as feasible; and 2. Attain the following ratios of area of mitigation to area of alteration: a. for mitigation on site: (1) 1:1 ratio for rectifying an illegal alteration to a wildlife habitat network; and (2) 1.5:1 ratio for enhancement or restoration; and b. for mitigation off-site: (1) 2:1 ratio for rectifying an illegal alteration to a wildlife habitat network; and (2) 3:1 ratio for enhancement or restoration;C. For temporary alterations, the department may require rectification, restoration or enhancement of the altered wildlife habitat network;D. The department may increase the width of the wildlife habitat network to mitigate for risks to habitat functions;E. To the maximum extent practical, mitigation projects involving wildlife habitat network restoration should provide replication of the site's prealteration natural environment including: 1. Soil type, conditions and physical features; 2. Vegetation diversity and density; and 3. Biologic and habitat functions; andF. The department may modify the requirements in this section if the applicant demonstrates that greater wildlife habitat functions will be obtained in the same wildlife habitat conservation area or wildlife habitat network through alternative mitigation measures. (Ord. 15051 § 204, 2004).21A.24.500 Critical area designation.A.1. A property owner or the property owner's agent may request a critical area designation for part or all of a site, without seeking a permit for a development proposal, by filing with the department a written application for a critical area designation on a form provided by the department. If the request is for review of a portion of a site, the application shall include a map identifying the portion of the site for which the designation is sought. 2. The designation may include an evaluation or interpretation of the applicability of critical area buffers and other critical area standards to a future development proposal.B. In preparing the critical area designation, the department shall perform a critical area review to: 1. Determine whether any critical area exists on the site and confirm its type, location, boundaries and classification; 2. Determine whether a critical area report is required to identify and characterize the location, boundaries and classification of the critical area; 3. Evaluate the critical area report, if required; and 4. Document the existence, location and classification of any critical area.C. If required by the department, the applicant for a critical area designation shall prepare and submit to the department the critical area report required by subsection B.2. of this section. For sites zoned for single detached dwelling units involving wetlands or aquatic areas, the applicant may elect to have the department conduct the special study in accordance with K.C.C. Title 27;D. The department shall make the determination of a critical area designation in writing within one hundred twenty days after the application for a critical area designation is complete, as provided in K.C.C. 20.20.050. The periods in K.C.C. 20.20.100.A.1. through 5. are excluded from the one-hundred-twenty-day period. If the determination applies to less than an entire site, the determination shall clearly identify the portion of the site to which the determination applies.E.1. The written determination made under this section is effective for five years as to the existence, location, classification of a critical area and critical area buffers on the site, unless: a. there is a change in site conditions; b. a state or federal agency adopts critical area maps that conflict with the department's written determination. 2. As part of its review of a complete application for a permit or approval, the department shall establish whether the written determination is still effective.F. If the department designates critical areas on a site under this section, the applicant for a development proposal on that site shall submit proof that a critical area notice has been filed as required by K.C.C. 21A.24.170. Except as provided in this subsection, the department's determination under this section is final. If the department relies on a critical area designation made under this section during its review of an application for a permit or other approval of a development proposal and the permit or other approval is subject to an administrative appeal, any appeal of the designation shall be consolidated with and is subject to the same appeal process as the underlying development proposal. If the King County hearing examiner makes the county’s final decision with regard to the permit or other approval type for the underlying development proposal, the hearing examiner’s decision constitutes the county’s final decision on the designation. If the King County council, acting as a quasi-judicial body, makes the county’s final decision with regard to the permit or other approval type for the underlying development proposal, the King County council’s decision constitutes the county’s final decision on the designation. (Ord. 17841 § 43, 2014: Ord. 16267 § 60, 2008: Ord. 15051 § 209, 2004: Ord. 14187 § 1, 2001).21A.24.510 Septic system design and critical area designation. An applicant proposing to install a septic system or locate a well shall apply for a critical area designation under K.C.C. 21A.24.500 before seeking approval of the septic system design or well location from the Seattle-King County department of public health. (Ord. 15051 § 211, 2004: Ord. 14187 § 2, 2001).21A.24.515 Critical areas monitoring. The department of natural resources and parks, in consultation with the department, shall conduct monitoring to evaluate the effect of this chapter on protecting the functions and values of critical areas. (Ord. 17420 § 105, 2012: Ord. 16267 § 61, 2008: Ord. 15051 § 230, 2004).21A.24.520 Buffer modifications to achieve zoned density. If a property owner is unable to subdivide a RA zoned parcel twenty acres or smaller at the density allowed under K.C.C. 21A.12.030 after application of the requirements of this chapter, the director may approve modifications to requirements for critical area buffers if:A. The applicant demonstrates that after the use of all provisions of this title, including but not limited to, clustering and buffer averaging, reduction in critical area buffers required by this chapter is necessary to achieve the density allowed under K.C.C. 21A.12.030;B. To the maximum extent practical, the subdivision or short subdivision design has the least adverse impact on the critical area and critical area buffer;C. The modification does not pose an unreasonable threat to the public health, safety or welfare on or off the development proposal site and is consistent with the general purposes of this chapter and the public interest; andD. The applicant provides mitigation to compensate for the adverse impacts to critical areas and buffers resulting from any modification to critical area buffers approved under this section. (Ord. 17539 § 56, 2013: Ord. 15051 § 231, 2004).21A.24.530 Vesting period for lots in final short plats. Unless the department finds that a change in conditions creates a serious threat to the public health or safety in the short subdivision, for a period of five years after recording, a lot within a short subdivision shall be governed by the provisions of this chapter in effect at the time a fully completed application for short subdivision approval was filed in accordance with K.C.C. chapter 20.20. (Ord. 15051 § 232, 2004).21A.24.540 Reliance upon standards established through critical area review of a previously approved conditional use permit. For a development proposal that requires a conditional use permit, the provisions of this chapter in effect at the time a complete application for the conditional use permit was submitted shall apply to the development proposal if:A. Critical areas on the development proposal site have been categorized and delineated and the impacts of development on the critical areas have been considered in the review of the conditional use permit;B. There are no outstanding violations of the conditions of the approved conditional use permit relating to the protection of the critical area; C. The development proposal is in compliance with all conditions that have been imposed as part of the approved conditional use permit; andD. The conditional use permit has not expired. (Ord. 15051 § 233, 2004).21A.24.550 Consolidated site review for single-family residential development.A. A development proposal shall be deemed to comply with this chapter and the department shall not require additional critical areas, fire or drainage review of a development proposal for a single-family residential development that is consistent with the conditions established by the department in its review of the development proposal if the applicant meets all of the following requirements: 1. The applicant provides to the department a critical areas report prepared by a preferred consultant, as provided in K.C.C. Title 27, for the critical areas on the development proposal site; 2. The department has issued a critical areas designation under K.C.C. 21A.24.500. If applicable, the designation shall be issued before septic system design, application and approval; 3. The development proposal qualifies for simplified drainage review and does not require targeted drainage review under K.C.C. chapter 9.04; 4. The development proposal does not require an alteration exception or reasonable use exception under this chapter, a variance from road standards under K.C.C. Title 14 or a drainage adjustment under K.C.C. chapter 9.04; and 5. The development proposal locates structures, on-site septic drainfield areas, the well location, and other impervious surfaces, including but not limited to driveways, within the areas identified by the department.B. If an applicant indicates on a form approved by the department that a development proposal for a single family residence will be proposed for review under this section, the department shall consolidate critical areas, drainage, road standards, and fire review. Based on the information provided by the applicant under this section, the department shall identify a development footprint on the property where the applicant may clear and place structures and other impervious surfaces in order to meet the requirements of this chapter and K.C.C. chapters 9.04 and 16.82. At the time of development permit application, the department shall screen the proposal for compliance with the conditions established by the department under this section, set the conditions of permit approval and, if required, establish the mitigation financial guarantee. (Ord. 18257 § 23, 2016: Ord. 15051 § 234, 2004).21A.24.560 Vesting of an approved on-site sewage disposal system. An on-site sewage disposal system approved prior to January 1, 2005, shall be subject to the provisions of this chapter in effect at the time of the on-site sewage disposal system approval. (Ord. 15051 § 235, 2004).21A.25SHORELINESSections:21A.25.010Shoreline master program elements.21A.25.020Definitions.21A.25.030Liberal construction.21A.25.040Shoreline master program goals - required for permits or appeals.21A.25.050Shoreline jurisdiction delineated.21A.25.060Names of shoreline environments designations.21A.25.070Boundary determination.21A.25.080Sequence of mitigation measures - priority.21A.25.090Shoreline use and modification - defined - no net loss of shoreline ecological functions allowed - sequencing compliance.21A.25.100Shoreline use.21A.25.110Aquaculture.21A.25.120Public boat launching facilities.21A.25.130Forest practices.21A.25.140Public access.21A.25.150Recreational development.21A.25.160Shoreline modification.21A.25.170Shoreline stabilization.21A.25.180Dock, pier, moorage pile or buoy, float or launching facility.21A.25.190Excavation, dredging, dredge material disposal and filling.21A.25.200Channel migration zone - new development to avoid future shoreline stabilization.21A.25.210Expansion of a dwelling unit or residential accessory structure.21A.25.220Shoreline dimensions and density.21A.25.230Subdivisions.21A.25.240Historic resources.21A.25.250Parking facilities.21A.25.260New utility facilities and repair and replacement of existing utility facilities.21A.25.280Transportation facilities.21A.25.290Development limitations - mitigation - substantial development - record of review - conditions of approval - programmatic statement of exemption - exception to statement of exemption.21A.25.300Permits - prerequisite to other permits.21A.25.310Application review for expansion or replacement of a nonconforming use or development.21A.25.320Appeals.21A.25.010 Shoreline master program elements. The King County shoreline master program elements are established in K.C.C. 20.12.200. (Ord. 16985 § 17, 2010).21A.25.020 Definitions. The definitions in K.C.C. chapter 21A.06, chapter 90.58 RCW and chapters 173-26 and 173-27 WAC apply within the shoreline jurisdiction. The definitions in chapter 90.58 RCW and chapters 173-26 and 173-27 WAC apply if there is a conflict with the definitions in K.C.C. chapter 21A.06. Other definition sections of the King County Code shall apply where applicable and where not in conflict with the chapters of the RCW and the WAC listed in this section. In addition, the following definitions apply to this chapter unless the context clearly requires otherwise:A. "Development" means any development as defined in chapter 173-27 WAC; andB. "Shoreline mixed use" means shoreline development that contains a water-dependent use combined with a water related, water enjoyment or a non-water-oriented use in a single building or on a single site in an integrated development proposal. Water dependent uses must comprise a significant portion of the floor area or site area in a shoreline mixed use development. (Ord. 19034 § 29, 2019: Ord. 18767 § 10, 2018: Ord. 16985 § 19, 2010: Ord. 11792 § 23, 1995: Ord. 3688 Ch. 2 (part), 1978. Formerly K.C.C. 25.08.010).21A.25.030 Liberal construction. This chapter is exempted from the rule of strict construction and shall be liberally construed to give full effect to the objectives and purposes for which it was enacted. (Ord. 16985 § 21, 2010: Ord. 3688 § 104, 1978. Formerly K.C.C. 25.04.040).21A.25.040 Shoreline master program goals - required for permits or appeals. The goals, policies, and regulations of the King County shoreline master program must be met before issuing any permits or approvals on land within the shoreline jurisdiction. (Ord. 16985 § 23, 2010: Ord. 11792 § 22, 1995: Ord. 11016 § 17, 1993: Ord. 9614 § 110, 1990: Ord. 5317 § 17, 1981: Ord. 3688 § 105, 1978. Formerly K.C.C. 25.04.050).21A.25.050 Shoreline jurisdiction delineated.A. [The requirements of the shoreline master program apply to all uses and development occurring within the shoreline jurisdiction.]* The King County shoreline jurisdiction consists of shorelines, shorelines of statewide significance, and shorelands as defined in RCW 90.58.030 and K.C.C. chapter 21A.06, and the one-hundred-year floodplain.B. The shoreline jurisdiction does not include tribal reservation lands and lands held in trust by the federal government for tribes. Nothing in the King County shoreline master program or action taken under that program shall affect any treaty right to which the United States is a party.C. The lakes and segments of rivers and streams constituting the King County shoreline jurisdiction are set forth in Attachment H to Ordinance 19146**. The King County shoreline jurisdiction is shown on a map adopted in chapter 6 of the King County Comprehensive Plan. If there is a discrepancy between the map and the criteria established in subsection A. of this section, the criteria shall constitute the official King County shoreline jurisdiction. The county shall update the shoreline master program to reflect the new designation within three years of the discovery of the discrepancy. (Ord. 19146 § 71, 2020: Ord. 19034 § 30, 2019: Ord. 18767 § 11, 2018: Ord. 17485 § 25, 2012: Ord. 16985 § 25, 2010: Ord. 3688 § 303, 1978. Formerly K.C.C. 25.12.030).Reviser's notes:*Added but not underlined in Ordinance 19034. See K.C.C. 1.24.075.**Available in the King County Archives.21A.25.060 Names of shoreline environments designations.A. In order to accomplish the goals, policies and regulations of the King County shoreline master program, the following shoreline environment designations have been established: 1. High Intensity shoreline; 2. Residential shoreline; 3. Rural shoreline; 4. Conservancy shoreline; 5. Resource shoreline; 6. Forestry shoreline; 7. Natural shoreline; and 8. Aquatic.B. The shoreline environment designations are included on a map in chapter 6 of the King County Comprehensive Plan. If there is a discrepancy between the map and the criteria established in chapter 6 of the King County Comprehensive Plan for shoreline environment designations, the criteria shall constitute the official King County shoreline environment designation. Any parcel of land included within the shoreline jurisdiction without a shoreline environment designation shall be considered within the Conservancy environment.C. The purpose of each shoreline environment designation is defined as follows: 1. The purpose of the High Intensity shoreline is to provide for high intensity water-oriented commercial and industrial uses; 2. The purpose of the Residential shoreline is to accommodate residential and commercial uses on a scale appropriate with urban residential zones; 3. The purpose of the Rural shoreline is to accommodate land uses normally associated with rural area levels of development while providing appropriate public access and recreational uses to the maximum extent practicable; 4. The purpose of the Conservancy shoreline is to conserve areas that are a high priority for restoration, include valuable historic properties or provide recreational opportunities; 5. The purpose of the Resource shoreline is to allow for mining and agricultural uses on lands that are designated under the Growth Management Act as agricultural land of long term commercial significance or mineral resource lands; 6. The purpose of the Forestry shoreline is to allow for forestry uses; 7. The purpose of the Natural shoreline is to protect those shoreline areas that are relatively free of human influence or have high ecological quality. This designation allows only very low intensity uses in order to maintain the existing high levels of ecological process and function; and 8. The Aquatic environment is to protect, restore and manage the unique characteristics and resources of the areas waterward of the ordinary high water mark. (Ord. 18767 § 12, 2018: Ord. 16985 § 27, 2010: Ord. 3688 § 302, 1978. Formerly K.C.C. 25.12.020).21A.25.070 Boundary determination.A. Where different environment designations have been given to a tributary and the main stream at the point of confluence, the environment designation given to the main stream shall extend for a distance of two hundred feet up the tributary.B. In case of uncertainty as to a wetland or environment boundary, the director shall determine its exact location in accordance with RCW 90.58.030 and this chapter. (Ord. 16985 § 29, 2010: Ord. 3688 § 305, 1978. Formerly K.C.C. 25.12.050).21A.25.080 Sequence of mitigation measures - priority.A. Mitigation measures shall be applied in the following sequence of steps listed in order of priority, with subsection A.1. of this section being top priority: 1. Avoiding the impact altogether by not taking a certain action or parts of an action; 2. Minimizing impacts by limiting the degree or magnitude of the action and its implementation by using appropriate technology or by taking affirmative steps to avoid or reduce impacts; 3. Rectifying the impact by repairing, rehabilitating or restoring the affected environment; 4. Reducing or eliminating the impact over time by preservation and maintenance operations; 5. Compensating for the impact by replacing, enhancing or providing substitute resources or environments; and 6. Monitoring the impact and the compensation projects and taking appropriate corrective measures.B. In determining appropriate mitigation measures applicable to shoreline development, lower priority measures shall be applied only where higher priority measures are determined to be infeasible or inapplicable.C. Mitigation shall be designed to: 1. Achieve no net loss of ecological functions for each new development; 2. Not require mitigation in excess of that necessary to assure that the development will result in no net loss of shoreline ecological functions; and 3. Not result in a significant adverse impact on other shoreline ecological functions.D. When compensatory measures are appropriate under the mitigation priority sequence in subsection A. of this section, preferential consideration shall be given to measures that replace the impacted functions directly and in the immediate vicinity of the impact. The department may approve alternative compensatory mitigation within the watershed if the mitigation addresses limiting factors or identified critical needs for shoreline resource conservation based on watershed or comprehensive resource management plans applicable to the area of impact. The department may require appropriate safeguards, terms or conditions as necessary to ensure no net loss of shoreline ecological functions as conditions of approval for compensatory mitigation measures. (Ord. 16985 § 129, 2010).21A.25.090 Shoreline use and modification - defined - no net loss of shoreline ecological functions allowed - sequencing compliance.A. Shoreline use is an activity that is allowed within a specific shoreline environment. Shoreline uses are identified in K.C.C. 21A.25.100.B. Shoreline modification is construction of a physical element such as a bulkhead, groin, berm, jetty, breakwater, dredging, filling, vegetation removal or alteration or application of chemicals that changes the natural or existing shoreline conditions. Shoreline modifications are identified in K.C.C. 21A.25.160.C. King County shall ensure that uses and modifications within the shoreline jurisdiction do not cause a net loss of shoreline ecological functions and comply with the sequencing requirements under K.C.C. 21A.25.080. (Ord. 16985 § 30, 2010).21A.25.100 Shoreline use.A. The shoreline use table in this section determines whether a specific use is allowed within each of the shoreline environments. The shoreline environment is located on the vertical column and the specific use is located on the horizontal row of the table. The specific uses are grouped by the shoreline use categories in WAC 173-26-241. The specific uses are defined by those uses in K.C.C. chapter 21A.08. The table should be interpreted as follows: 1. If the cell is blank in the box at the intersection of the column and the row, the use is prohibited in that shoreline environment; 2. If the letter "P" appears in the box at the intersection of the column and the row, the use may be allowed within the shoreline environment; 3. If the letter "C" appears in the box at the intersection of the column and the row, the use may be allowed within the shoreline environment subject to the shoreline conditional use review procedures specified in K.C.C. 21A.44.100. 4. If a number appears in the box at the intersection of the column and the row, the use may be allowed subject to the appropriate review process in this section, the general requirements of this chapter and the specific development conditions indicated with the corresponding number in subsection C. of this section. If more than one number appears after a letter, all numbers apply. 5. If more than one letter-number combination appears in the box at the intersection of the column and the row, the use is allowed in accordance with each letter-number combination. 6. A shoreline use may be allowed in the aquatic environment only if that shoreline use is allowed in the adjacent shoreland environment. 7. This section does not authorize a land use that is not allowed by the underlying zoning, but may add additional restrictions or conditions or prohibit specific land uses within the shoreline jurisdiction. When there is a conflict between the permitted land uses in K.C.C. chapter 21A.08 and shoreline uses in this section, preference for shoreline uses shall first be given to water-dependent uses, then to water related uses and finally to water enjoyment uses. All uses in the shoreline jurisdiction must comply with all relevant county code provisions and with the King County Shoreline Master Program.B. Shoreline usesP - Permitted Use C - Shoreline Conditional Use Blank - Prohibited. Shoreline uses are allowed only if the underlying zoning allows the use. Shoreline uses are allowed in the aquatic environment only if the adjacent upland environment allows the use.High IntensityResidentialRuralConservancyResourceForestryNaturalAquaticAgricultureAgriculture (K.C.C. 21A.08.090)PPPPPP1Aquaculture (fish and wildlife management K.C.C. 21A.08.090)Nonnative marine finfish aquacultureCommercial salmon net pensNoncommercial native salmon net pensP2P2P2P2P2P2P2P2Native non-salmonid finfish net pensC2C2C2C2Geoduck aquacultureC2C2C2C2C2C2C2C2Aquaculture, not otherwise listedP2P2P2P2P2P2P2P2Boating FacilitiesMarinas (K.C.C. 21A.08.040)C3C3C3C3Commercial DevelopmentGeneral services (K.C.C. 21A.08.050)P4P5P5Business services, except SIC Industry No. 1611, automotive parking and off-street required parking lot (K.C.C. 21A.08.060)P6Retail (K.C.C. 21A.08.070)P7P8Government ServicesGovernment services except commuter parking lot, utility facility and private stormwater management facility (K.C.C. 21A.08.060)P9P9P9P9P9P9P9C10Forest PracticesForestry (K.C.C. 21A.08.090)P11P11P11P11P11C11IndustryManufacturing (K.C.C. 21A.08.080)P12In-stream structural usesHydroelectric generation facility, wastewater treatment facility and municipal water production (K.C.C. 21A.08.100)C13C13C13C13C13In-stream utility facilities (K.C.C. 21A.08.060)P14P14P14P14P14P14P14C14In-stream transportation portion of SIC 1611 highway and street construction (K.C.C. 21A.08.060)C15In-stream fish and wildlife management, except aquaculture (K.C.C. 21A.08.090)C16MiningMineral uses (K.C.C. 21A.08.090)C17C17C17Recreational DevelopmentRecreational/cultural except for marinas and docks and piers (K.C.C. 21A.08.040)P18P19P19P20P19P21CResidential DevelopmentSingle detached dwelling units (K.C.C. 21A.08.030)PPPPC22C22Townhouse, apartment, mobile home park, cottage housing (K.C.C. 21A.08.030)P23PPGroup residences (K.C.C. 21A.08.030)P23PAccessory uses (K.C.C. 21A.08.030)P24P24P24P24P24C22 and 24C22 and 24Temporary lodging (K.C.C. 21A.08.030)P23P27P27C27C27Live-aboardsP28P28P28P28Transportation and parkingTransportation facilitiesP29P29P29C29P29P29C29C29Commuter parking lot (K.C.C. 21A.08.060)Automotive parking (K.C.C. 21A.08.060)Off-street required parking lot (K.C.C. 21A.08.060)UtilitiesUtility facility (K.C.C. 21A.08.060)P26P26P26P26P26P26P26C26Regional land usesRegional uses except hydroelectric generation facility, wastewater treatment facility and municipal water production (K.C.C. 21A.08.100)P30C. Development conditions: 1. In the Natural environment, limited to low intensity agriculture, such as livestock use with an animal unit density of no more than one per two acres in the shoreline jurisdiction, seasonal hay mowing and related activities and horticulture not to exceed twenty percent of the site area located within the shoreline jurisdiction. 2.a. The supporting infrastructure for aquaculture may be located landward of the aquaculture operation, subject to the limitations of K.C.C. Title 21A. b. The aquaculture operation must meet the standards in K.C.C. 21A.25.110. c. In aquatic areas adjacent to the residential shoreline environment, net pen facilities shall be located no closer than one thousand five hundred feet from the ordinary high water mark of this environment, unless the department allows a specific lesser distance that it determines is appropriate based upon a visual impact analysis. Other types of floating culture facilities may be located within one thousand five hundred feet of the ordinary high water mark if supported by a visual impact analysis. d. In aquatic areas adjacent to the rural shoreline environment, net pen facilities shall be located no closer than one thousand five hundred feet from the ordinary high water mark of this environment, unless the department allows a specific lesser distance that it determines is appropriate based upon a visual impact analysis. e. In the natural shoreline environment and aquatic areas adjacent to the natural shoreline environment, commercial net pens are prohibited and other aquaculture activities are limited to activities that do not require structures, facilities or mechanized harvest practices and that will not alter the natural systems, features or character of the site. f. Farm-raised geoduck aquaculture requires a shoreline substantial development permit if a specific project or practice causes substantial interference with normal public use of the surface waters. g. A conditional use permit is required for new commercial geoduck aquaculture only, consistent with WAC 173-26-241(3)(b). All subsequent cycles of planting and harvest shall not require a new conditional permit. 3.a. New marinas are not allowed along the east shore of Maury Island, from Piner Point to Point Robinson. b. Marinas must meet the standards in K.C.C. 21A.25.120. 4. Water dependent general services land uses in K.C.C. 21A.08.050 are allowed. Non-water dependent general services land uses in K.C.C. 21A.08.050 are only allowed on sites that are not contiguous with the ordinary high water mark or on sites that do not have an easement that provides direct access to the water. 5.a. Water-dependent general services land uses in K.C.C. 21A.08.050 are allowed. b. Non-water-dependent general services land uses in K.C.C. 21A.08.050 are only allowed as part of a shoreline mixed-use development that includes water-dependent uses. c. Non-water-oriented general services land uses must provide a significant public benefit by helping to achieve one or more of the following shoreline master program goals: (1) economic development for water-dependent uses; (2) public access; (3) water-oriented recreation; (4) conservation of critical areas, scenic vistas, aesthetics or fish and wildlife habitat; and (5) protection and restoration of historic properties. 6. Water-dependent business services uses in K.C.C. 21A.08.050 are allowed. Water-related business services uses are only allowed as part of a shoreline mixed-use development and only if they support a water-dependent use. The water-related business services uses must comprise less than one-half of the square footage of the structures or the portion of the site within the shoreline jurisdiction. 7.a Water-dependent retail uses in K.C.C. 21A.08.050 are allowed. b. Non-water-dependent retail uses in K.C.C. 21A.08.050 are only allowed as part of a shoreline mixed-use development if the non-water-dependent retail use supports a water-dependent use. Non-water-dependent uses must comprise less than one-half of the square footage of the structures or the portion of the site within the shoreline jurisdiction. c. Non-water-oriented retail uses must provide a significant public benefit by helping to achieve one or more of the following shoreline master program goals: (1) economic development for water-dependent uses; (2) public access; (3) water-oriented recreation; (4) conservation of critical areas, scenic vistas, aesthetics or fish and wildlife habitat; and (5) protection and restoration of historic properties. 8. Water-dependent retail uses in K.C.C. 21A.08.050 are allowed. Non-water-dependent retail uses in K.C.C. 21A.08.050 are only allowed if the retail use provides a significant public benefit by helping to achieve one or more of the following shoreline master program goals: a. economic development for water-dependent uses; b. public access; c. water-oriented recreation; d. conservation of critical areas, scenic vistas, aesthetics or fish and wildlife habitat; and e. protection and restoration of historic properties. 9.a. Water-dependent government services in K.C.C. 21A.08.060 are allowed. b. Non-water-dependent government services in K.C.C. 21A.08.060 are only allowed as part of a shoreline mixed-use development if the non-water-dependent government use supports a water-dependent use. Non-water-dependent uses must comprise less than one-half of the square footage of the structures or the portion of the site within the shoreline jurisdiction. Only low-intensity water-dependent government services are allowed in the Natural environment. 10. The following standards apply to government services uses within the Aquatic environment: a. Stormwater and sewage outfalls are allowed if upland treatment and infiltration to groundwater, streams or wetlands is not feasible and there is no impact on critical saltwater habitats, salmon migratory habitat and the nearshore zone. However, stormwater and sewage outfalls are not allowed in the Maury Island Aquatic Reserve, except from Piner Point to Point Robinson; b. Water intakes shall not be located near fish spawning, migratory or rearing areas. Water intakes must adhere to Washington state Department of Fish and Wildlife fish screening criteria. To the maximum extent practical, intakes should be placed at least thirty feet below the ordinary high water mark; c. Desalinization facilities shall not be located near fish spawning, migratory or rearing areas. Intakes should generally be placed deeper than thirty feet below the ordinary high water mark and must adhere to Washington state Department Fish and Wildlife fish screening criteria. Discharge of desalination wastewater or concentrated mineral is not allowed in the Maury Island Aquatic Reserve, except that outside the Inner and Outer Harbormaster Harbor, discharge may be considered if there is no impact on critical saltwater habitats, salmon migratory habitat and the nearshore zone; d. Cable crossings for telecommunications and power lines shall: (1) be routed around or drilled below aquatic critical habitat or species; (2) be installed in sites free of vegetation, as determined by physical or video seabed survey; (3) be buried, preferably using directional drilling, from the uplands to waterward of the deepest documented occurrence of native aquatic vegetation; and (4) use the best available technology; e. Oil, gas, water and other pipelines shall meet the same standards as cable crossings and in addition: (1) pipelines must be directionally drilled to depths of seventy feet or one half mile from the ordinary high water mark; and (2) use the best available technology for operation and maintenance; f. Breakwaters are not allowed within the Maury Island Aquatic Reserve or within the Aquatic environment adjacent to the Conservancy and Natural shorelines. 11. In the Natural environment, limited to low intensity forest practices that conserve or enhance the health and diversity of the forest ecosystem or ecological and hydrologic functions conducted for the purpose of accomplishing specific ecological enhancement objectives. In all shoreline environments, forest practices must meet the standards in K.C.C. 21A.25.130. 12. Manufacturing uses in the shoreline environment must give preference first to water-dependent manufacturing uses and second to water-related manufacturing uses: a. Non-water-oriented manufacturing uses are allowed only: (1) as part of a shoreline mixed-use development that includes a water-dependent use, but only if the water-dependent use comprises over fifty percent of the floor area or portion of the site within the shoreline jurisdiction; (2) on sites where navigability is severely limited; or (3) on sites that are not contiguous with the ordinary high water mark or on sites that do not have an easement that provides direct access to the water; and (4) all non-water-oriented manufacturing uses must also provide a significant public benefit, such as ecological restoration, environmental clean-up, historic preservation or water-dependent public education; b. public access is required for all manufacturing uses unless it would result in a public safety risk or is incompatible with the use; c. shall be located, designed and constructed in a manner that ensures that there are no significant adverse impacts to other shoreline resources and values. d. restoration is required for all new manufacturing uses; e. boat repair facilities are not permitted within the Maury Island Aquatic Reserve, except as follows: (1) engine repair or maintenance conducted within the engine space without vessel haul-out; (2) topside cleaning, detailing and bright work; (3) electronics servicing and maintenance; (4) marine sanitation device servicing and maintenance that does not require haul-out; (5) vessel rigging; and (6) minor repairs or modifications to the vessel's superstructure and hull above the waterline that do not exceed twenty-five percent of the vessel's surface area above the waterline. 13. The water-dependent in-stream portion of a hydroelectric generation facility, wastewater treatment facility and municipal water production are allowed, including the upland supporting infrastructure, and shall provide for the protection and preservation, of ecosystem-wide processes, ecological functions, and cultural resources, including, but not limited to, fish and fish passage, wildlife and water resources, shoreline critical areas, hydrogeological processes, and natural scenic vistas. 14. New in-stream portions of utility facilities may be located within the shoreline jurisdiction if: a. there is no feasible alternate location; b. provision is made to protect and preserve ecosystem-wide processes, ecological functions, and cultural resources, including, but not limited to, fish and fish passage, wildlife and water resources, shoreline critical areas, hydrogeological processes, and natural scenic vistas; and c. the use complies with the standards in K.C.C. 21A.25.260. 15. Limited to in-stream infrastructure, such as bridges, and must consider the priorities of the King County Shoreline Protection and Restoration Plan when designing in-stream transportation facilities. In-stream structures shall provide for the protection and preservation, of ecosystem-wide processes, ecological functions, and cultural resources, including, but not limited to, fish and fish passage, wildlife and water resources, shoreline critical areas, hydrogeological processes, and natural scenic vistas. 16. Limited to hatchery and fish preserves. 17. Mineral uses: a. must meet the standards in K.C.C. chapter 21A.22; b. must be dependent upon a shoreline location; c. must avoid and mitigate adverse impacts to the shoreline environment during the course of mining and reclamation to achieve no net loss of shoreline ecological function. In determining whether there will be no net loss of shoreline ecological function, the evaluation may be based on the final reclamation required for the site. Preference shall be given to mining proposals that result in the creation, restoration, or enhancement of habitat for priority species; d. must provide for reclamation of disturbed shoreline areas to achieve appropriate ecological functions consistent with the setting; e. may be allowed within the active channel of a river only as follows: (1) removal of specified quantities of sand and gravel or other materials at specific locations will not adversely affect the natural processes of gravel transportation for the river system as a whole; (2) the mining and any associated permitted activities will not have significant adverse impacts to habitat for priority species nor cause a net loss of ecological functions of the shoreline; and (3) if no review has been previously conducted under this subsection C.17.e., prior to renewing, extending or reauthorizing gravel bar and other in-channel mining operations in locations where they have previously been conducted, the department shall require compliance with this subsection C.17.e. If there has been prior review, the department shall review previous determinations comparable to the requirements of this section C.17.e. to ensure compliance with this subsection under current site conditions; and f. Must comply with K.C.C. 21A.25.190. 18. Only water-dependent recreational uses are allowed, except for public parks and trails, in the High Intensity environment and must meet the standards in K.C.C. 21A.25.140 for public access and K.C.C. 21A.25.150 for recreation. 19. Water-dependent and water-enjoyment recreational uses are allowed in the Residential, Rural and Forestry environments and must meet the standards in K.C.C. 21A.25.140 for public access and K.C.C. 21A.25.150 for recreation. 20. In the Conservancy environment, only the following recreation uses are allowed and must meet the standards in K.C.C. 21A.25.140 for public access and K.C.C. 21A.25.150 for recreation: a. parks; and b. trails. 21. In the Natural environment, only passive and low-impact recreational uses are allowed. 22. Single detached dwelling units must be located outside of the aquatic area buffer and set back from the ordinary high water mark to the maximum extent practical. 23. Only allowed as part of a water-dependent shoreline mixed-use development where water-dependent uses comprise more than half of the square footage of the structures on the portion of the site within the shoreline jurisdiction. 24. Residential accessory uses must meet the following standards: a. docks, piers, moorage, buoys, floats or launching facilities must meet the standards in K.C.C. 21A.25.180; b. residential accessory structures located within the aquatic area buffer shall be limited to a total footprint of one-hundred fifty square feet; and c. accessory structures shall be sited to preserve visual access to the shoreline to the maximum extent practical. 25. New highway and street construction is allowed only if there is no feasible alternate location. Only low-intensity transportation infrastructure is allowed in the Natural environment. 26. Utility facilities are subject to the standards in K.C.C. 21A.25.260. 27. Only bed and breakfast guesthouses. 28. Only in a marina. 29. Transportation facilities are subject to the standards in K.C.C. 21A.25.280. 30. Only solid waste transfer stations and subject to K.C.C. 21A.25.260. (Ord. 19034 § 31, 2019: Ord. 17485 § 26, 2012: Ord. 16985 § 31, 2010).21A.25.110 Aquaculture. An applicant for an aquaculture facility must use the sequential measures in K.C.C. 21A.25.080. The following standards apply to aquaculture:A. Unless the applicant demonstrates that the substrate modification will result in an increase in native habitat diversity, aquaculture that involves little or no substrate modification shall be given preference over aquaculture that involves substantial substrate modification and the degree of proposed substrate modification shall be limited to the maximum extent practical.B. The installation of submerged structures, intertidal structures and floating structures shall be limited to the maximum extent practical.C. Aquaculture proposals that involve substantial substrate modification or sedimentation through dredging, trenching, digging, mechanical clam harvesting or other similar mechanisms, shall not be permitted in areas where the proposal would adversely impact critical saltwater habitats.D. Aquaculture activities that after implementation of mitigation measures would have a significant adverse impact on natural, dynamic shoreline processes or that would result in a net loss of shoreline ecological functions shall be prohibited.E. Aquaculture should not be located in areas that will result in significant conflicts with navigation or other water-dependent uses.F. Aquaculture facilities shall be designed, located and managed to prevent the spread of diseases to native aquatic life or the spread of new nonnative species.G. Aquaculture practices shall be designed to minimize use of artificial chemical substances and shall use chemical compounds that are least persistent and have the least impact on plants and animals. Herbicides and pesticides shall be used only in conformance with state and federal standard and to the minimum extent needed for the health of the aquaculture activity.H. Noncommercial native salmon net pen facilities that involve minimal supplemental feeding and limited use of chemicals or antibiotics as provided in subsection G. of this section may be located in King County [marine]* waters if they are consistent with subsections S. and Y. of this section and are: 1. Native salmon net pens operated by tribes with treaty fishing rights; 2. For the limited penned cultivation of wild salmon stocks during a limited portion of their lifecycle to enhance restoration of native stocks; or 3. For rearing to adulthood in order to harvest eggs as part of a captive brood stock recovery program for endangered species.I. If uncertainty exists regarding potential impacts of a proposed aquaculture activity and for all experimental aquaculture activities, unless otherwise provided for, the department may require baseline and periodic operational monitoring by a county-approved consultant, at the applicant's expense, and shall continue until adequate information is available to determine the success of the project and the magnitude of any probable significant adverse environmental impacts. Permits for such activities shall include specific performance measures and provisions for adjustment or termination of the project at any time if monitoring indicates significant, adverse environmental impacts that cannot be adequately mitigated.J. Aquaculture developments approved on an experimental basis shall not exceed five acres in area, except land-based projects and anchorage for floating systems, and three years in duration. The department may issue a new permit to continue an experimental project as many times as it determines is necessary and appropriate.K. The department may require aquaculture operations to carry liability insurance in an amount commensurate with the risk of injury or damage to any person or property as a result of the project. Insurance requirements shall not be required to duplicate requirements of other agencies.L. If aquaculture activities are authorized to use public facilities, such as boat launches or docks, King County may require the applicant to pay a portion of the cost of maintenance and any required improvements commensurate with the use of those facilities.M. New aquatic species that are not previously cultivated in Washington state shall not be introduced into King County saltwaters or freshwaters without prior written approval of the Director of the Washington state Department of Fish and Wildlife and the Director of the Washington Department of Health. This prohibition does not apply to: Pacific, Olympia, Kumomoto, Belon or Virginica oysters; Manila, Butter, or Littleneck clams; or Geoduck clams.N. Unless otherwise provided in the shoreline permit issued by the department, repeated introduction of an approved organism after harvest in the same location shall require approval by the county only at the time the initial aquaculture use permit is issued. Introduction, for purposes of this section, shall mean the placing of any aquatic organism in any area within the waters of King County regardless of whether it is a native or resident organism within the county and regardless of whether it is being transferred from within or without the waters of King County.O. For aquaculture projects, over-water structures shall be allowed only if necessary for the immediate and regular operation of the facility. Over-water structures shall be limited to the, storage of necessary tools and apparatus in containers of not more than three feet in height, as measured from the surface of the raft or dock.P. Except for the sorting or culling of the cultured organism after harvest and the washing or removal of surface materials or organisms before or after harvest, no processing of any aquaculture product shall occur in or over the water unless specifically approved by permit. All other processing and processing facilities shall be located landward of the ordinary high water mark.Q. Aquaculture wastes shall be disposed of in a manner that will ensure strict compliance with all applicable governmental waste disposal standards, including, but not limited to, the Federal Clean Water Act, Section 401, and chapter 90.48 RCW, Water Pollution Control. No garbage, wastes or debris shall be allowed to accumulate at the site of any aquaculture operation.R. Unless approved in writing by the National Marine Fisheries Service or the U.S. Fish and Wildlife Service, predator control shall not involve the killing or harassment of birds or mammals. Approved controls include, but are not limited to, double netting for seals, overhead netting for birds and three-foot high fencing or netting for otters. The use of other nonlethal, nonabusive predator control measures shall be contingent upon receipt of written approval from the National Marine Fisheries Service or the U.S. Fish and Wildlife Service, as required.S. Finfish net pens and rafts shall meet the following criteria in addition to the other applicable regulations of this section: 1. Finfish net pens shall not be located in Quartermaster Harbor. For the purposes of this subsection, Quartermaster Harbor" means the area of Puget Sound north of a straight line drawn from the southwest tip of Maury Island, which is Piner Point, to the southeast tip of Vashon Island, which is Neill Point; 2. Finfish net pens shall meet, at a minimum, state approved administrative guidelines for the management of net pen cultures. In the event there is a conflict in requirements, the more restrictive requirement shall prevail; 3. Finfish net pens shall not occupy more than two surface acres of water area, excluding booming and anchoring requirements. Anchors that minimize disturbance to substrate, such as helical anchors, shall be employed. Such operations shall not use chemicals or antibiotics; 4. Aquaculture proposals that include new or added net pens or rafts shall not be located closer than one nautical mile to any other aquaculture facility that includes net pens or rafts. The department may authorize a lesser distance if the applicant demonstrates to the satisfaction of the department that the proposal will be consistent with the environmental and aesthetic policies and objectives of this chapter and the shoreline master program. The applicant shall demonstrate to the satisfaction of the department that the cumulative impacts of existing and proposed operations would not be contrary to the policies and regulations of the program; 5. Net cleaning activities shall be conducted on a frequent enough basis so as not to violate state water quality standards. When feasible, the cleaning of nets and other apparatus shall be accomplished by air drying, spray washing or hand washing; and 6. In the event of a significant fish kill at the site of a net pen facility, the finfish aquaculture operator shall submit a timely report to public health – Seattle & King County, environmental health division, and the department stating the cause of death and shall detail remedial actions to be implemented to prevent reoccurrence.T. All floating and submerged aquaculture structures and facilities in navigable waters shall be marked in accordance with United States Coast Guard requirements.U. The rights of treaty tribes to aquatic resources within their usual and accustomed areas shall be addressed through direct coordination between the applicant and the affected tribes through the permit review process.V. Aquaculture structures and equipment shall be of sound construction and shall be so maintained. Abandoned or unsafe structures and equipment shall be removed or repaired promptly by the owner. Where any structure might constitute a potential hazard to the public in the future, the department shall require the posting of a bond commensurate with the cost of removal or repair. The department may abate an abandoned or unsafe structure in accordance with K.C.C. Title 23.W. Aquaculture shall not be approved where it will adversely impact eelgrass and macroalgae.X. Commercial salmon net pens and nonnative marine finfish aquaculture are prohibited.Y. Finfish net pens shall be consistent with the applicable aquaculture regulations in this section and shall meet the following criteria and requirements: 1. Each finfish net pen application shall provide a current, peer-reviewed science review of environmental issues related to finfish net pen aquaculture; 2. The department shall only approve a finfish net pen application if the department determines the scientific review demonstrates: a. that the project construction and activities will achieve no net loss of ecological function in a manner that has no significant adverse short-term impact and no documented adverse long-term impact to applicable elements of the environment, including, but not limited to, habitat for native salmonids, water quality, eel grass beds, other aquaculture, other native species, the benthic community below the net pen or other environmental attributes; and b. that the finfish net pen does not involve significant risk of cumulative adverse effects, including, but not limited to, risk of interbreeding with wild salmon or reduction of genetic fitness of wild stocks, parasite or disease transmission or other adverse effects on native species or threatened or endangered species and their habitats; 3. The department's review shall: a. include an assessment of the risk to endangered species, non-endangered species, and other biota that could be affected by the finfish net pen; and b. evaluate and model water quality impacts utilizing current information, technology, and assessment models. The project proponent shall be financially responsible for this water quality assessment; 4. Finfish net pens shall be designed, constructed and maintained to prevent escapement of fish in all foreseeable circumstances, including, but not limited to, tide, wind and wave events of record, floating and submerged debris, and tidal action; 5. Finfish net pens shall not be located: a. within three hundred feet of an area containing eelgrass or a kelp bed; b. within one thousand five hundred feet of an ordinary high water mark; or c. in a designated Washington state Department of Natural Resources aquatic reserve; 6. A finfish net pen may not be used to mitigate the impact of a development proposal; and 7. For finfish net pens that are not noncommercial native salmon net pens, the conditional use permit for the net pen must be renewed every five years. An updated scientific review shall be conducted as part of the renewal and shall include a new risk assessment and evaluation of the impact of the operation of the finfish net pen during the previous five years.Z. Geoduck aquaculture shall be consistent with WAC 173-26-241(3)(b). (Ord. 19034 § 32, 2019: Ord. 17485 § 27, 2012: Ord. 16985 § 32, 2010).*Reviser's note: Added but not underlined in Ordinance 19034. See K.C.C. 1.24.075.21A.25.120 Public boat launching facilities.A. The traffic generated the facility must be safely and conveniently handled by the streets serving the proposed facility;B. The facility must provide adequate parking in accordance with K.C.C. chapter 21A.18;C. Live-aboards on a vessel are only allowed in a marina and only as follows: 1. They are for residential use only; 2. The marina shall provide shower and toilet facilities on land; 3. There shall be no sewage discharges to the water; 4. Live-aboards shall not exceed ten percent of the total slips in the marina; and 5. The vessels shall be owner-occupied;D. The marina must be sited to protect the rights of navigation;E. The marina must be equipped with pumpout facilities;F. The marina must have provisions available for cleanup of accidental spills of contaminants;G. Marinas and boat ramps must be located where their development will not interrupt littoral currents, at the ends of drift cells and away from erosional pocket beaches; H. Lighting shall be maintained to avoid creating shading for aquatic predator species and other impacts to upland wildlife;I. Vessels moored on waters of the state shall obtain any required lease or permission from the state; andJ. New covered or enclosed moorages are not allowed in the Maury Island aquatic reserve. (Ord. 16985 § 33, 2010).21A.25.130 Forest practices.A. Forest practices within shorelines of statewide significance shall meet the following conditions: 1. Only selective commercial timber harvest is allowed, except other timber harvesting methods may be permitted where the topography, soil conditions or silviculture practices necessary for forest regeneration render selective commercial timber harvests ecologically detrimental; 2. No more than thirty percent of the merchantable trees may be harvested in any ten year period of time; and 3. Clear cutting of timber that is necessary for the preparation of land for other uses authorized by the King County shoreline master program may be permitted so long as limited to the maximum extent practical.B. Forest practices in the Natural environment must be of low intensity and only for the purpose of enhancing forest health.C. Forest practices within shoreline environments must comply with the Forest Practices Rules in Title 222 WAC and the revised Forest Practices Board Manual except: 1. The small forest landowner forestry riparian easement program established in chapter 222-21 WAC does not apply within shorelines; and 2. Roads crossing wetlands and aquatic areas within shorelines shall not exceed fourteen feet in width for single lane roads and twenty-six feet in width for two-lane roads, plus any additional width needed for curves or safety conditions. (Ord. 16985 § 35, 2010: Ord. 13190 § 27, 1998: Ord. 11792 § 27, 1995: Ord. 9614 § 113, 1990: Ord. 3688 § 506, 1978. Formerly K.C.C. 25.20.060).21A.25.140 Public access.A. Except as otherwise provided in subsection B. of this section, public access shall be required for: 1. Attached residential developments; 2. New subdivisions of more than four lots; 3. Developments for water enjoyment, water related and non-water-dependent uses; 4. Publicly owned land, including, but not limited to, land owned by public agencies and public utilities; 5. Marinas; and 6. Publicly financed shoreline stabilization projects.B. Public access shall: 1. Connect to other public and private public access and recreation facilities on adjacent parcels to the maximum extent practical; 2. Be sited to ensure public safety is considered; and 3. Be open to the general public;C. Public access is not required if the applicant demonstrates to the satisfaction of the department that public access would be incompatible with the proposed use because of safety or security issues, would result in adverse impacts to the shoreline environment that cannot be mitigated or there are constitutional or other legal limitations that preclude requiring public access;D. Public pedestrian and bicycle pathways and recreation areas constructed as part of a private development proposal should enhance access and enjoyment of the shoreline and provide features in scale with the development, such as: 1. View points; 2. Places to congregate in proportion to the scale of the development; 3. Benches and picnic tables; 4. Pathways; and 5. Connections to other public and private public access and recreation facilities; andE. Private access from single detached residences to the shoreline shall: 1. Not exceed three feet in width; 2. Avoid removal of significant trees and other woody vegetation to the maximum extent practical; and 3. Avoid a location that is parallel to the shoreline to the maximum extent practical. (Ord. 16985 § 36, 2010).21A.25.150 Recreational development. Recreational development must meet the following standards:A. The recreational development must be permitted in the underlying zone;B. Recreational uses in the Natural environment must be water-oriented;C. Swimming areas shall be separated from boat launch areas and marinas, to the maximum extent practical;D. The development of underwater sites for sport diving shall not: 1. Take place at depths of greater than eighty feet; 2. Constitute a navigational hazard; and 3. Be located in areas where the normal waterborne traffic would constitute a hazard to those people who may use such a site;E. The construction of swimming facilities, docks, piers, moorages, buoys, floats and launching facilities below the ordinary high water mark shall be governed by the regulations relating to docks, piers, moorage, buoys, floats or launching facility construction in K.C.C. 21A.25.180;F. Public boat launching facilities or marinas shall be governed by K.C.C. 21A.25.120;G. Campgrounds in the Natural environment shall meet the following conditions:1. Campsites shall be located outside the shoreline jurisdiction if possible, and if not, be located outside of critical areas buffers; 2. Restrooms and parking shall be located outside the shoreline jurisdiction; and 3. Removal of vegetation shall be limited to the maximum extent practical;H. Public contact with unique and fragile areas shall be permitted where it is possible without destroying the natural character of the area;I. Water viewing, nature study, recording and viewing shall be accommodated by open space, platforms, benches or shelter, consistent with public safety and security;J. Public recreation shall be provided on county-owned lands consistent with this chapter unless the director determines public recreation is not compatible with other uses on the site or will create a public safety risk; andK. To the maximum extent practical, proposals for non water oriented active recreation facilities shall be located outside of the shoreline jurisdiction and shall not be permitted where the non water oriented active recreation facility would have an adverse impact on critical saltwater habitat. (Ord. 16985 § 38, 2010: Ord. 3688 § 415, 1978. Formerly K.C.C. 25.16.200).21A.25.160 Shoreline modification.A. The shoreline modification table in this section determines whether a specific shoreline modification is allowed within each of the shoreline environments. The shoreline environment is located on the vertical column and the specific use is located on the horizontal row of the table. The specific modifications are grouped by the shoreline modification categories in WAC 173-26-231. The table should be interpreted as follows: 1. If the cell is blank in the box at the intersection of the column and the row, the modification is prohibited in that shoreline environment; 2. If the letter "P" appears in the box at the intersection of the column and the row, the modification may be allowed within the shoreline environment; 3. If the letter "C" appears in the box at the intersection of the column and the row, the modification may be allowed within the shoreline environment subject to the shoreline conditional use review procedures specified in K.C.C. 21A.44.100; 4. If a number appears in the box at the intersection of the column and the row, the modification may be allowed subject to the appropriate review process indicated in this section and the specific development conditions indicated with the corresponding number immediately following the table, and only if the underlying zoning allows the modification. If more than one number appears at the intersection of the column and row, both numbers apply; 5. If more than one letter-number combination appears in the box at the intersection of the column and the row, the modification is allowed within that shoreline environment subject to different sets of limitations or conditions depending on the review process indicated by the letter, the specific development conditions indicated in the development condition with the corresponding number immediately following the table; 6. A shoreline modification may be allowed in the aquatic environment only if that shoreline modification is allowed in the adjacent shoreland environment; and 7. This section does not authorize a shoreline modification that is not allowed by the underlying zoning, but may add additional restrictions or conditions or prohibit specific modifications within the shoreline jurisdiction. All shoreline modifications in the shoreline jurisdiction must comply with all relevant county code provisions and with the King County shoreline master program.B. Shoreline modifications.High IntensityResidentialRuralConservancyResourceForestryNaturalAquaticShoreline stabilizationShoreline stabilization, not including flood protection facilitiesP1P1P1C1P1C1P1 C1Flood protection facilitiesP2P2P2P2P2P2P2Piers and docksDocks, piers, moorage, buoys, floats or launching facilitiesP3P3P3C3C3C3P3 C3FillFillingP4 C4P4 C4P4 C4P4 C4P4 C4C4C4P4 C4Breakwaters, jetties, groins and weirsBreakwaters, jetties, groins and weirsP5 C5P5 C5P5 C5P5 C5P5 C5P5 C5P5 C5P5 C5Dredging and dredge material disposalExcavation, dredging, dredge material disposalP6 C6P6 C6P6 C6P6 C6P6 C6C6C6P6 C6Shoreline habitat and natural systems enhancement projectsHabitat and natural systems enhancement projectsP7P7P7P7P7P7P7P7Vegetation managementRemoval of existing intact native vegetationP8P8P8P9P8P8P9P9C. Development conditions. 1. New shoreline stabilization, including bulkheads, must meet the standards in K.C.C. 21A.25.170; 2.a. Flood protection facilities must be consistent with the standards in K.C.C. chapter 21A.24, goals, objectives, guiding principles, and policies of the 2024 King County Flood Management Plan, and the Integrated Stream Protection Guidelines (Washington state departments of Fish and Wildlife, Ecology and Transportation, 2003). New structural flood hazard protection measures are allowed in the shoreline jurisdiction only when the applicant demonstrates by a scientific and engineering analysis that the structural measures are necessary to protect existing development, that nonstructural measures are not feasible and that the impact on ecological functions and priority species and habitats can be successfully mitigated so as to assure no net loss of shoreline ecological functions. New flood protection facilities designed as shoreline stabilization must meet the standards in K.C.C. 21A.25.170. b. Relocation, replacement or expansion of existing flood control facilities within the Natural environment are permitted, subject to the requirements of the King County Flood Plan and consistent with the Washington State Aquatic Guidelines Program's Integrated Streambank Protection Guidelines and bioengineering techniques used to the maximum extent practical. New facilities would only be permitted consistent with an approved watershed resources inventory area (WRIA) salmon recovery plan under chapter 77.85 RCW. 3. Docks, piers, moorage, buoys, floats or launching facilities must meet the standards in K.C.C. 21A.25.180; 4.a. Filling must meet the standards in K.C.C. 21A.25.190. b. A shoreline conditional use permit is required to: (1) Place fill waterward of the ordinary high water mark for any use except ecological restoration or for the maintenance and repair of flood protection facilities; and (2) Dispose of dredged material within shorelands or wetlands within a channel migration zone; c. Fill shall not placed in critical saltwater habitats except when all of the following conditions are met: (1) the public's need for the proposal is clearly demonstrated and the proposal is consistent with protection of the public trust, as embodied in RCW 90.58.020; (2) avoidance of impacts to critical saltwater habitats by an alternative alignment or location is not feasible or would result in unreasonable and disproportionate cost to accomplish the same general purpose; (3) the project including any required mitigation, will result in no net loss of ecological functions associated with critical saltwater habitat; and (4) the project is consistent with the state's interest in resource protection and species recovery. d. In a channel migration zone, any filling shall protect shoreline ecological functions, including channel migration. 5.a. Breakwaters, jetties, groins and weirs: (1) are only allowed where necessary to support water dependent uses, public access, approved shoreline stabilization or other public uses, as determined by the director; (2) are not allowed in the Maury Island Aquatic Reserve except as part of a habitat restoration project or as an alternative to construction of a shoreline stabilization structure; (3) shall not intrude into or over critical saltwater habitats except when all of the following conditions are met: (a) the public's need for the structure is clearly demonstrated and the proposal is consistent with protection of the public trust, as embodied in RCW 90.58.020; (b) avoidance of impacts to critical saltwater habitats by an alternative alignment or location is not feasible or would result in unreasonable and disproportionate cost to accomplish the same general purpose; (c) the project including any required mitigation, will result in no net loss of ecological functions associated with critical saltwater habitat; and (d) the project is consistent with the state's interest in resource protection and species recovery. b. Groins are only allowed as part of a restoration project sponsored or cosponsored by a public agency that has natural resource management as a primary function. c. A conditional shoreline use permit is required, except for structures installed to protect or restore shoreline ecological functions. 6. Excavation, dredging and filling must meet the standards in K.C.C. 21A.25.190. A shoreline conditional use permit is required to dispose of dredged material within shorelands or wetlands within a channel migration zone. 7.a. If the department determines the primary purpose is restoration of the natural character and ecological functions of the shoreline, a shoreline habitat and natural systems enhancement project may include shoreline modification of vegetation, removal of nonnative or invasive plants, shoreline stabilization, including the installation of large woody debris, dredging and filling. Mitigation actions identified through biological assessments required by the National Marine Fisheries Services and applied to flood hazard mitigation projects may include shoreline modifications of vegetation, removal of nonnative or invasive plants, shoreline stabilization, including the installation of large woody debris, dredging and filling. b. Within the Urban Growth Area, the county may grant relief from shoreline master program development standards and use regulations resulting from shoreline restoration projects consistent with criteria and procedures in WAC 173-27-215. 8. Within the critical area and critical area buffer, vegetation removal is subject to K.C.C. chapter 21A.24. 9. Except for forest practices conducted under K.C.C. 21A.25.130, existing native vegetation located outside of the critical area and critical area buffer shall be retained to the maximum extent practical. Within the critical area and critical area buffer, vegetation removal is subject to K.C.C. chapter 21A.24. (Ord. 19820 § 13, 2024: Ord. 19034 § 33, 2019: Ord. 18767 § 13, 2018: Ord. 17485 § 28, 2012: Ord. 16985 § 39, 2010).21A.25.170 Shoreline stabilization.A. Shoreline stabilization shall not be considered an outright use and shall be permitted only when the department determines that shoreline protection is necessary for the protection of existing legally established primary structures, new or existing non-water-dependent development, new or existing water-dependent development or projects restoring ecological functions or remediating hazardous substance discharges. Vegetation, berms, bioengineering techniques and other nonstructural alternatives that preserve the natural character of the shore shall be preferred over riprap, concrete revetments, bulkheads, breakwaters and other structural stabilization. Riprap using rock or other natural materials shall be preferred over concrete revetments, bulkheads, breakwaters and other structural stabilization. Lesser impacting measures should be used before more impacting measures.B. Structural shoreline stabilization may be permitted subject to the standards in this chapter and as follows: 1. The applicant provides a geotechnical analysis that demonstrates that erosion from waves or currents is imminently threatening or that, unless the structural shoreline stabilization is constructed, damage is expected to occur within three years; 2. The erosion is not caused by upland conditions; 3. The proposed structural shoreline protection will provide greater protection than feasible, nonstructural alternatives such as slope drainage systems, vegetative growth stabilization, gravel berms and beach nourishment; 4. The proposal is the minimum necessary to protect existing legally established primary structures, new or existing non-water-dependent development, new or existing water-dependent development or projects restoring ecological functions or remediating hazardous substance discharges; and 5. Adequate mitigation measures will be provided to maintain existing shoreline processes and critical fish and wildlife habitat and ensure no net loss or function of intertidal or riparian habitat.C. Shoreline stabilization to replace existing shoreline stabilization shall be placed landward of the existing shoreline stabilization, but may be placed waterward directly abutting the old structure only in cases where removal of the old structure would result in greater impact on ecological functions. In critical saltwater habitats, existing shoreline stabilization shall not be allowed to remain in place if the existing shoreline stabilization is resulting in the loss of ecological functions. Adequate mitigation measures that maintain existing shoreline processes and critical fish and wildlife habitat must be provided that ensures no net loss or function of intertidal or riparian habitat.D. The maximum height of the proposed shoreline stabilization shall be no more than one foot above the elevation of extreme high water on tidal waters, as determined by the National Ocean Survey published by the National Oceanic and Atmospheric Administration, or four feet in height on lakes.E. Shoreline stabilization is prohibited along feeder bluffs and critical saltwater habitat, unless a geotechnical report demonstrates an imminent danger to a legally established structure or public improvement. If allowed, shoreline stabilization along feeder bluffs and critical saltwater habitat must be designed to have the least impact on these resources and on sediment conveyance systems.F. Shoreline stabilization shall minimize the adverse impact on the property of others to the maximum extent practical.G. Shoreline stabilization shall not be used to create new lands.H. Shoreline stabilization shall not interfere with surface or subsurface drainage into the water body.I. Automobile bodies or other junk or waste material that may release undesirable material shall not be used for shoreline stabilization.J. Shoreline stabilization shall be designed so as not to constitute a hazard to navigation and to not substantially interfere with visual access to the water.K. Shoreline stabilization shall be designed so as not to create a need for shoreline stabilization elsewhere.L. Shoreline stabilization shall comply with the Integrated Stream Protection Guidelines (Washington state departments of Fish and Wildlife, Ecology and Transportation, 2003) and shall be designed to allow for appropriate public access to the shoreline.M. The department shall provide a notice to an applicant for new development or redevelopment located within the shoreline jurisdiction on Vashon and Maury Island that the development may be impacted by sea level rise and recommend that the applicant voluntarily consider setting the development back further than required by this title to allow for future sea level rise. (Ord. 16985 § 41, 2010: Ord. 5734 § 5, 1981: Ord. 3688 § 413, 1978. Formerly K.C.C. 25.16.180).21A.25.180 Dock, pier, moorage pile or buoy, float or launching facility. Any dock, pier, moorage pile or buoy, float or launching facility authorized by this chapter shall be subject to the following conditions:A. Docks, piers, moorage piles or buoys, floats or launching facilities are allowed only for water dependent uses or for public access and shall be limited to the minimize size necessary to support the use. New private boat launch ramps are not allowed;B. Any dock, pier, moorage pile or buoy, float or launching facility proposal on marine waters: 1. Must include an evaluation of the nearshore environment and the potential impact of the facility on that environment; and 2. Avoid impacts to critical saltwater habitats unless an alternative alignment or location is not feasible;C. In the High Intensity, Residential, Rural and Conservancy environments, the following standards apply: 1. Only one dock, pier, moorage pile or buoy, float or launching facility may be allowed for a single detached residential lot and only if the applicant demonstrates there is no feasible practical alternative; 2. For subdivisions or short subdivisions or for multiunit dwelling unit development proposals: a. Only one joint use dock, pier, float or launching facility is allowed; and b. One moorage pile or buoy if a dock, pier, float or launching facility is allowed or two moorage piles or buoys if a dock, pier, float or launching facility is not allowed; 3. Only one dock, pier, moorage pile or buoy, float or launching facility is allowed for each commercial or industrial use; and 4. Multiuser recreational boating facilities serving more than four single detached residences shall comply with K.C.C. 21A.25.120;D. In the Conservancy environment, a dock, pier, moorage pile or buoy, float or launching facility for a commercial or manufacturing use must be located at least two hundred fifty feet from another dock or pier;E. In the Resource and Forestry Shoreline environments, only one dock, pier, moorage pile or buoy, float or launching facility is permitted and only as an accessory use to a residential use or to support a resource or forestry use; F. In the Natural environment, a dock, pier, moorage pile or buoy, float or launching facility is prohibited;G. In freshwater lakes: 1. A new pier, dock or moorage pile for residential uses shall meet the following requirements:New Pier, Dock or Moorage Piles Dimensional and Design Standardsa.Maximum Area: surface coverage, including all attached float decking, ramps, ells and fingers(1)480 square feet for single dwelling unit;(2)700 square feet for joint-use facility used by 2 dwelling units;(3)1000 square feet for joint-use facility used by 3 or more dwelling units;(4)These area limitations shall include platform lifts; (5)150 square feet for float for a single dwelling unit; and(6)Where a pier cannot reasonably be constructed under the area limitation above to obtain a moorage depth of 10 feet measured below ordinary high water, an additional 4 square feet of area may be added for each additional foot of pier length needed to reach 10 feet of water depth at the landward end of the pier, provided that all other area dimensions, such as maximum width and length, have been minimized.b.Maximum Length for piers, docks, ells, fingers and attached floats(1)(A)On Lake Washington and Lake Sammamish, 150 ft, but piers or docks extending further waterward than adjacent piers or docks must demonstrate that they will not have an adverse impact on navigation; and (B)On all other freshwater lakes, the shorter of: 80 feet or the point where the water depth is 13 feet below ordinary high water (2)26 feet for ells; and(3)20 feet for fingers and float decking attached to a pierc.Maximum Width(1)4 feet for pier or dock walkway or ramp;(2)6 feet for ells;(3)2 feet for fingers;(4)6 feet for float decking attached to a pier, must contain a minimum of 2 feet of grating down the center of the entire float; and(5)For piers or docks with no ells or fingers, the most waterward 26-foot section of the walkway may be 6 feet wide.d.Height of piers and diving boards(1) Minimum of 1.5 feet above ordinary high water to bottom of pier stringers, except the floating section of a dock and float decking attached to a pier;(2)Maximum of 3 feet above deck surface for diving boards or similar features;(3)Maximum of 3 feet above deck for safety railing, which shall be an open framework.e.Minimum Water Depth for ells and float decking attached to a pier(1)Must be in water with depths of 10 feet or greater at the landward end of the float(2)Must be in water with depths of 9 feet or greater at the landward end of the ell or fingerf.Decking for piers, docks walkways, platform lifts, ells and fingers(1)If float tubs for docks preclude use of fully grated decking material, then a minimum of 2 feet of grating down the center of the entire float shall be provided (2)Piers, docks, and platform lifts must be fully grated or contain other materials that allow a minimum of fifty percent light transmittance through the materialg.Location of ells, fingers and deck platforms(1)Within 30 feet of the OHWM, only the pier walkway or ramp is allowed(2)No closer than 30 feet waterward of the OHWM, measured perpendicular to the OHWMh.Pilings and Moorage Piles(1)Pilings or moorage piles shall not be treated with pentachlorophenol, creosote, chromated copper arsenate (CCA) or comparably toxic compounds.(2)First set of pilings or moorage piles located no closer than 18 feet from OHWM(3)Moorage piles shall not be any farther waterward than the end of the pier or docki.MitigationPlantings or other mitigation as provided in subsection L. of this section. 2. On Lake Washington and Lake Sammamish, the department may approve the following modifications to a new pier proposal that deviates from the dimensional standards of subsection G.1. of this section if both the U.S. Army Corps of Engineers and Washington state Department of Fish and Wildlife have approved an alternate project design. In addition, the following requirements and all other applicable provisions in this chapter shall be met:Administrative Approval for Alternative Design of New Pier or Dock Requirementsa.State and Federal Agency ApprovalU.S. Army Corps of Engineers, and the Washington state Department of Fish and Wildlife have approved proposalb.Maximum AreaNo larger than authorized through state and federal approvalc.Maximum Width (1)Except as provided in c.ii. of this subsection, the pier and all components shall meet the standards noted in subsection G.1. of this section. (2)4 feet for portion of pier or dock located within 30 feet of the OHWM; and 6 feet for walkwaysd.Minimum Water DepthNo shallower than authorized through state and federal approval 3.a. A replacement of an existing pier or dock shall meet the following requirements:Replacement of Existing Pier or Dock Requirements(1)Replacement of entire existing pier or dock, including piles OR more than fifty percent of the pier-support piles and more than fifty percent of the decking or decking substructure (e.g. stringers)Must meet the dimensional decking and design standards for new piers as described in subsection G.1. of this section, except the department may approve an alternative design described in subsection G.3.b. of this section.(2)Mitigation(a)Existing skirting shall be removed and may not be replaced.(b)Existing in-water and overwater structures other than existing pier or dock located within 30 feet of the OHWM, except for existing or authorized shoreline stabilization measures, shall be removed. b. On Lake Washington and Lake Sammamish, the department may approve the following modifications to a pier replacement proposal that deviates from the dimensional standards of subsection G.1. of this section, if both the U.S. Army Corps of Engineers and Washington state Department of Fish and Wildlife have approved an alternate project design. With submittal of a building permit, the applicant shall provide documentation that the U.S. Army Corps of Engineers, and the Washington state Department of Fish and Wildlife have approved the alternative proposal design. In addition, the following requirements and all other applicable provisions in this chapter shall be met;Administrative Approval for Alternative Design of Replacement Pier or DockRequirements(1)State and Federal Agency ApprovalU.S. Army Corps of Engineers and the Washington state Department of Fish and Wildlife have approved proposal(2)Maximum AreaNo larger than existing pier or that allowed under subsection G.1. of this section, whichever is greater(3)Maximum Length26 feet for fingers and float decking attached to a pier. Otherwise, the pier and all components shall meet the standards noted in subsection G.1. of this section(4)Maximum Width (a) 4 feet for walkway or ramp located within 30 feet of the OHWM; otherwise, 6 feet for walkways(b) 8 feet for ells and float decking attached to a pier(c) For piers with no ells or fingers, the most waterward 26 feet section of the walkway may be 8 feet wide (d) Otherwise, the pier and all components shall meet the standards noted in subsection G.1. of this section(5)Minimum Water DepthNo shallower than authorized through state and federal approval 4. Proposals involving the addition to or enlargement of existing piers or docks must comply with the requirements in the following table. These provisions shall not be used in combination with the provisions for new or replacement piers in subsection G.1. or G.3. of this section.Addition to Existing Pier or Dock Requirementsa.Addition or enlargement(1)Must demonstrate that there are no alternatives with less impact on the shoreline; and (2)Must demonstrate that there is a need for the enlargement of an existing pier or dock and that there are no alternatives with less impact on the shoreline Examples of need include, but are not limited to safety concerns or inadequate depth of water b.Dimensional standards Enlarged portions must comply with the new pier or dock standards for length and width, height, water depth, location, decking and pilings and for materials as described in subsection G.1. of this section.c.Decking for piers, docks walkways, ells and fingers Must convert an area of decking within 30 feet of the OHWM to grated decking equivalent in size to the additional surface coverage. Grated or other materials must allow a minimum of fifty percent light transmittance through the materiald.Mitigation(1)Existing skirting shall be removed and may not be replaced(2)Existing in-water and overwater structures located within 30 feet of the OHWM, except for existing or authorized shoreline stabilization measures or pier or dock walkways or piers, shall be removed at a 1:1 ratio to the area of the addition 5.a. Repair proposals that replace only decking or decking substructure and less than fifty percent of the existing pier-support piles must comply with the following regulations: Minor Repair of Existing Pier or DockRequirements(1)Replacement pilings or moorage piles(a)Must use materials as described under subsection G.1.h(3) of this section(b)Must minimize the size of pilings or moorage piles and maximize the spacing between pilings to the extent allowed by site-specific engineering or design considerations(2)Replacement of 50 percent or more of the decking or 50 percent or more of decking substructureMust replace any solid decking surface of the pier or dock located within 30 feet of the OHWM with a grated surface material that allows a minimum of fifty percent light transmittance through the material b. Other repairs to existing legally established moorage facilities where the nature of the repair is not described in this subsection shall be considered minor repairs and are permitted, consistent with all other applicable codes and regulations. If cumulative repairs of an existing pier or dock would make a proposed repair exceed the threshold for a replacement pier established in subsection G.3. of this section, the repair proposal shall be reviewed under subsection G.1. of this section for a new pier or dock, except as described in subsection G.3.b. of this section for administrative approval of alternative design;H. Boatlifts, personal watercraft lifts, boatlift canopies and moorage piles may be permitted as an accessory to piers and docks, subject to the following regulations:Boatlift, Personal Watercraft Lift, Boat Canopy and Moorage Piles Requirements1.Locationa,Boat lifts shall be placed as far waterward of the OHWM as feasible and safe, but not more than sixty feet from OHWM b.Boat lifts are not permitted within the Maury Island Environmental Aquatic Reserve c.The bottom of a boatlift canopy shall be elevated above the boatlift to the maximum extent practical, the lowest edge of the canopy must be a least 4 feet above the ordinary high water, and the top of the canopy must not extend more than 7 feet above an associated pierd.Moorage piles shall not be closer than 30 feet from OHWM or any farther waterward than the end of the pier or dock2.Maximum Numbera.1 free-standing or deck-mounted boatlift per dwelling unitb.1 personal watercraft lift or 1 fully grated platform lift per dwelling unitc.1 boatlift canopy per dwelling unit, including joint use piers3.Canopy Materialsa.Must be made of translucent fabric materials.b.Must not be constructed of permanent structural material.4.Fill for Boatlifta.Maximum of 2 cubic yards of fill are permitted to anchor a boatlift, subject to the following requirements:b.May only be used if the substrate prevents the use of anchoring devices that can be embedded into the substratec.Must be cleand.Must consist of rock or precast concrete blockse.Must only be used to anchor the boatliftf.Minimum amount of fill is used to anchor the boatliftI. Moorage buoys shall meet the following conditions: 1. Buoys shall not impede navigation; 2. The use of buoys for moorage of recreational and commercial vessels is preferred over pilings or float structures; 3. Buoys shall be located and managed in a manner that minimizes impacts to eelgrass and other aquatic vegetation; 4. Preference should be given mid-line float or all-rope line systems that have the least impact on marine vegetation; 5. New buoys that would result in a closure of local shellfish beds for future harvest shall be prohibited; and 6. No more than four buoys per acre are allowed;J.1. A boat lift, dock, pier, moorage pile or buoy, float, launching facility or other overwater structure or device shall meet the following setback requirements: a. All piers, docks, boatlifts and moorage piles for detached dwelling unit use shall comply with the following location standards:New Pier, Dock, Boatlift and Moorage Pile or Buoy Minimum Setback Standards(1)Side property lines 15 feet(2)Another moorage structure not on the subject property, excluding adjacent moorage structure that does not comply with required side property line setback25 feet, except that this standard shall not apply to moorage piles(3)Outlet of an aquatic area, including piped streamsMaximum distance feasible while meeting other required setback standards established under this section(4)Public parkOutside of the urban growth area, 25 feet b. Joint-use structures may abut property lines when the property owners sharing the moorage facility have mutually agreed to the structure location in a contract recorded with the King County division of records and elections to run with the properties. A copy of the contract must accompany an application for a building permit or a shoreline permit. 2. An overwater structure may abut property lines for the common use of adjacent property owners K. On marine shorelines, a new, repaired, or replaced pier, dock or float for residential uses shall meet the following requirements:Pier, Dock or Float on Marine WatersDimensional and Design Standards1.Maximum Area: surface coverage, including all attached float decking and rampsa.480 square feet for single dwelling unit;b.700 square feet for joint-use facility used by 2 dwelling units;c.1000 square feet for joint-use facility used by 3 or more dwelling units;d.These area limitations shall include platform lifts; ande.240 square feet for float for a single dwelling unit.2.Maximum Widtha.4 feet for pier or dock for single dwelling unit;b.6 feet for pier or dock for joint use facility; andc.4 feet for ramp connecting to a pier or float3.Floatsa.For a single-use structure, the float width must not exceed 8 feet and the float length must not exceed 30 feet. Functional grating must be installed on at least 50% of the surface area of the float;b.For a joint-use structure, the float width must not exceed 8 feet and the float length must not exceed 60 feet. Functional grating must be installed on at least 50% of the surface area of the float;c.To the maximum extent practical, floats must be installed with the length in the north-south direction;d.If the float is removed seasonally, the floats shall be stored above mean high/higher water/ordinary high water line at a department approved location;e.Flotation for the float shall be fully enclosed and contained in a shell, such as polystyrene tubs not shrink wrapped or sprayed coatings, that prevents breakup or loss of the flotation material into the water and is not readily subject to damage by ultraviolet radiation or abrasion caused by rubbing against piling or waterborne debris;f.Flotation components shall be installed under the solid portions of the float, not under the grating; andg.If the float is positioned perpendicular to the ramp, a small float may be installed to accommodate the movement of the ramp due to tidal fluctuations. The dimensions of the small float cannot exceed 6 feet in width and 10 feet in length.4.Float stopsa.To suspend the float above the substrate, the preferred and least impacting option is to suspend the float above the substrate by installing float stops (stoppers) on piling anchoring new floats. The stops must be able to fully support the entire float during all tidal elevations;b.If float stops attached to pilings are not feasible (this must be explained in the application), then up to four 10 inch diameter stub pilings can be installed instead;c.Float feet attached to the float may be considered an option only under these circumstances: (1) in coarse substrate with 25% of the grains are at least 25 mm in size for a grain size sample taken from the upper one foot of substrate; and (2) for elevations of 3 feet below mean high high water and lower, if 25% of the grains are at least 4 mm in size for a grain size sample taken from the upper one foot of substrate;d.For repair or replacement of existing float feet if: (1) substrate contains mostly gravel; and (2) proposed replacement or repair includes other improvements of the environmental baseline, such as the removal of creosote-treated piling and increased amounts of grating; ande.Floats can be held in place with lines anchored with a helical screw or "duckbill" anchor, piling with stoppers or float support/stub pilings as follows: (1) For a single-use float, a maximum of 4 piling (not including stub piling) or helical screw or “duckbill” anchors can be installed to hold the float in place. (2) For a joint-use float, a maximum of 8 piling or helical screw or "duckbill" anchors can be installed to hold the float in place. (3) If anchors and anchor lines need to be used, the anchor lines shall not rest on the substrate at any time. (4) In rocky substrates where a helical screw or "duckbill" anchor cannot be used, if the applicant submits a rationale why these types of anchors cannot be used and the department concurs with this rationale, a department approved anchor of another type, such as a concrete block, may be permitted.5.Decking for piers, docks walkways, platform lifts, ells and fingersa.Grating must not be covered, on the surface or underneath, with any stored items, such as floats, canoes, kayaks, planter boxes, sheds, carpet, boards or furniture;b.Grating shall be kept clean of algae, mud or other debris that may impede light transmission;c,Piers, docks, and platform lifts must be fully grated or contain other materials that allow a minimum of fifty percent light transmittance through the material;d.Grating openings shall be oriented lengthwise in the east-west direction to the extent practicable and the structures themselves should be oriented to maximize natural light penetration;e.Overwater structures shall incorporate as much functional grating as possible. Grating needs to have a minimum of 60% open area; andf.The area of floating boat lifts to be moored at the overwater structure shall be included in the float grating calculations.6.Pier or dock configurationOnly straight line piers or docks are allowed. Ells, fingers or "T" shaped docks and piers are not allowed. 7.Pilings and Moorage Pilesa.Pilings or moorage piles shall not be treated with pentachlorophenol, creosote, chromated copper arsenate (CCA) or comparably toxic compounds;b.Replacement or proposed new piling can be steel, concrete, plastic or untreated or treated wood. Any piling subject to abrasion and subsequent deposition of material into the water shall incorporate design features to minimize contact between all of the different components of overwater structures during all tidal elevations;c.New piling associated with a new pier must be spaced at least 20 feet apart lengthwise along the structure, unless the length of structure itself is less than 20 feet. If the structure itself is less than 20 feet in length, piling can only be placed at the ends of the structure. Piles in forage fish spawning areas shall be spaced at least 40 feet apart;d.If the project includes the replacement of existing piling, they should be either partially cut with a new piling secured directly on top, fully extracted, or cut 2 feet below the mudline. If treated piling are fully extracted or cut, the holes or piles must be capped with clean, appropriate material. Hydraulic water jets cannot be used to remove piling;e.A maximum of two moorage piles may be installed to accommodate the moorage of boats exceeding the length of the floats; andf.Dolphins are not permitted.8.MitigationPlantings or other mitigation as provided in subsection L. of this section;L. New, expanded, replacement or repaired piers, docks, floats, boatlifts, boat canopies and moorage piles or buoys shall comply with the following: 1. Existing habitat features, such as large and small woody debris and substrate material, shall be retained and new or expanded moorage facilities placed to avoid disturbance of such features; 2. Invasive weeds, such as milfoil, may be removed as provided in K.C.C. chapter 21A.24; and 3. In order to mitigate the impacts of new or expanded moorage facilities, the applicant shall plant site-appropriate emergent vegetation and a buffer of vegetation a minimum of ten feet wide along the entire length of the lot immediately landward of ordinary high water mark. Planting shall consist of native shrubs and trees and, when possible, emergent vegetation. At least five native trees will be included in a planting plan containing one or more evergreen trees and two or more trees that like wet roots, such as willow species. Such planting shall be monitored for a period of five years consistent with a monitoring plan approved in accordance with K.C.C. chapter 21A.24. This subsection is not intended to prevent reasonable access through the shoreline critical area buffer to the shoreline, or to prevent beach use of the shoreline critical area;M. Except as otherwise provided for covered boat lifts under subsection H. of this section, covered docks or piers, covered moorages and covered floats are not permitted waterward of the ordinary high water mark; andN. No dwelling unit may be constructed on a dock or pier. A water related or water enjoyment use may be allowed on a dock, pier or other over-water structure only as part of a mixed-use development and only if accessory to and in support of a water-dependent use. (Ord. 18767 § 14, 2018: Ord. 16985 § 43, 2010: Ord. 15971 § 107, 2007: Ord. 12763 § 1, 1997: Ord. 3688 § 409(4), 1978. Formerly K.C.C. 25.16.120).21A.25.190 Excavation, dredging, dredge material disposal and filling. Excavation, dredging, dredge material disposal and filling may be permitted only as follows:A. Fill or excavation landward of the ordinary high water mark shall be subject to K.C.C. chapters 16.82 and 21A.24;B. Fill may be permitted below the ordinary high water mark only: 1. When necessary to support a water dependent use; 2. To provide for public access; 3. When necessary to mitigate conditions that endanger public safety, including flood risk reduction projects; 4. To allow for cleanup and disposal of contaminated sediments as part of an interagency environmental cleanup plan; 5. To allow for the disposal of dredged material considered suitable under, and conducted in accordance with, the dredged material management program of the Washington state Department of Natural Resources; 6. For expansion or alteration of transportation or utility facilities currently located on the shoreline and then only upon demonstration that alternatives to fill are not feasible; or 7. As part of mitigation actions, environmental restoration projects and habitat enhancement projects;C. Fill or excavations shall be permitted only when technical information demonstrates water circulation, littoral drift, aquatic life and water quality will not be substantially impaired and that the fill or excavation will not obstruct the flow of the ordinary high water, flood waters or cutoff or isolate hydraulic features from each other;D. Dredging and dredged material disposal below the ordinary high water mark shall be permitted only: 1. When necessary for the operation of a water dependent use; 2. When necessary to mitigate conditions that endanger public safety or fisheries resources; 3. As part of and necessary to roadside or agricultural ditch maintenance that is performed consistent with best management practices promulgated through administrative rules under the critical areas provisions of K.C.C. chapter 21A.24 and if: a. the maintenance does not involve any expansion of the ditch beyond its previously excavated size. This limitation shall not restrict the county's ability to require mitigation, under K.C.C. chapter 21A.24, or other applicable laws; b. the ditch was not constructed or created in violation of law; c. the maintenance is accomplished with the least amount of disturbance to the stream or ditch as possible; d. the maintenance occurs during the summer low flow period and is timed to avoid disturbance to the stream or ditch during periods critical to salmonids; and e. the maintenance complies with standards designed to protect salmonids and salmonid habitat, consistent with K.C.C. chapter 21A.24, though this subsection D.3.e. shall not be construed to permit the mining or quarrying of any substance below the ordinary high water mark; 4. For establishing, maintaining, expanding, relocating or reconfiguring navigation channels and basins when necessary to ensure safe and efficient accommodation of existing navigation uses when: a. significant ecological impacts are minimized; b. mitigation is provided; c. maintained to the existing authorized location, depth and width; 5. For restoration projects when; a. the site where the fill is placed is located waterward of the ordinary high water mark; and b. the project is associated with a habitat project under the Model Toxics Control Act or the Comprehensive Environmental Response, Compensation, and Liability Act; or c. any habitat enhancement or restoration project; and 6. For flood risk reduction projects conducted in accordance with Policy of the King County Flood Management Plan;E. Dredging is not allowed waterward of the ordinary high water mark for the primary purpose of obtaining fill material or creating a new marina;F. Disposal of dredged material shall be done only in approved deep water disposal sites or approved upland disposal sites and is not allowed within wetlands or channel migration zones;G. Stockpiling of dredged material in or under water is prohibited; andH. In order to insure that operations involving dredged material disposal and maintenance dredging are consistent with the King County shoreline master program as required by RCW 90.58.140(1), no dredging may commence in any shoreline environment without the responsible person having first obtained either a substantial development permit or a statement of exemption when required under K.C.C. 21A.25.290. A statement of exemption or shoreline permit is not required before emergency dredging needed to protect property from imminent damage by the elements, if statement of exemption or substantial development permit is subsequently obtained following the procedures in K.C.C. 16.82.065. (Ord. 19820 § 14, 2024: Ord. 16985 § 45, 2010: Ord. 16172 § 7, 2008: Ord. 13247 § 3, 1998: Ord. 5734 § 6, 1981: Ord. 3688 § 414, 1978. Formerly K.C.C. 25.16.190).21A.25.200 Channel migration zone - new development to avoid future shoreline stabilization. In the channel migration zone in the shoreline jurisdiction, to the maximum extent practical, new development shall be located and designed to avoid the need for future shoreline stabilization. (Ord. 16985 § 131, 2010).21A.25.210 Expansion of a dwelling unit or residential accessory structure.The expansion of a dwelling unit or residential accessory structure located in the shoreline jurisdiction, if allowed under K.C.C. 21A.24.045, is subject to the following:A. If the proposed expansion will result in a total cumulative expansion of the dwelling unit and accessory structures of more than one thousand square feet, a shoreline variance is required; andB. If the site has an approved rural stewardship plan under K.C.C. 21A.24.055, the expansion is not allowed. (Ord. 17485 § 29, 2012: Ord. 16985 § 46, 2010).21A.25.220 Shoreline dimensions and density.A. The shoreline dimensions table in subsections B. and C. of this section establishes the shoreline standards within each of the shoreline environments. The shoreline environment is located on the vertical column and the density and dimensions standard is located on the horizontal row of the table. The table should be interpreted as follows: 1. If the cell is blank in the box at the intersection of the column and the row, the standards are the same as for the underlying zoning. 2. If the cell has a number in the box at the intersection of the column and the row, that number is the density or dimension standard for that shoreline environment. 3. If the cell has a parenthetical number in the box at the intersection of the column and the row, that parenthetical number identifies specific conditions immediately following the table that are related to the density and dimension standard for that environment.B. The dimensions enumerated in this section apply within the shoreline jurisdiction. If there is a conflict between the dimension standards in this section and K.C.C. chapter 21A.12, the more restrictive shall apply.Shoreline dimensions.HIGHINTENSITYRESIDENTIALRURALCONSERVANCYRESOURCEFORESTRYNATURALAQUATICStandardsBase height35 feet (1)35 feet (1)35 feet (1)35 feet (1)35 feet (1)35 feet (1)30 feet (1)35 feet (1)Maximum density (units per acre)6 (4)6 (4)Minimum lot area5 acres (2)5 acres (2)10 acres80 acres80 acresMinimum lot width50 feet100 feet150 feet150 feet150 feet330 feetImpervious surface10% (3)C. Development conditions. 1. This height can be exceeded consistent with the base height for the zone only if the structure will not obstruct the view of a substantial number of residences on areas adjoining the shoreline or if overriding considerations of the public interest will be served, and only for: a. agricultural buildings; b. water dependent uses and water related uses; and c. regional light rail transit support structures, but no more than is reasonably necessary to address the engineering, operational, environmental issues at the location of the structure; 2. The minimum lot areas may be reduced as follows: a. to no less than 10,000 square feet or the minimum lot areas for the zone, whichever is greater, through lot averaging; and b. when public access is provided, to no less than 8,000 square feet, or the minimum lot area for the zone, whichever is greater, through cluster development, as provided in K.C.C. chapter 21A.14. 3. For lots created before the December 10, 2010, if achieving the ten percent maximum impervious surface limit is not feasible, the amount of impervious surface shall be limited to the maximum extent practical but not to exceed the amount of impervious surface allowed under K.C.C. 21A.12.030 and 21A.12.040. 4. Except for a mixed use development, the density of the underlying zoning or 6 units per acre, whichever is lower. A mixed use development may have the density of the underlying zone. (Ord. 17485 § 30, 2012: Ord. 16985 § 47, 2010).21A.25.230 Subdivisions.A. Any existing lot that does not comply with the density and dimensions standards of K.C.C. chapter 21A.12 or K.C.C. 21A.25.220 and that is located wholly or partially within the shoreline jurisdiction shall be subject to the following provisions: 1. If the adjoining property is not under the same ownership as such lot, then the lot shall be considered a separate building site; and 2. If the adjoining property is under the same ownership as such lot, then the lot shall not be considered a separate building site until the lot is combined with adjoining property under the same ownership in such a way as to comply with the density and dimensions standards of K.C.C. chapter 21A.12.B. Submerged land within the boundaries of any waterfront parcel shall not be used to compute lot area, lot dimensions, yards, recreation space or other similar required conditions of land subdivision or development, except, where specifically authorized by ordinance, such lands may be used in area computations as an incentive to encourage common open space waterfront areas.C. All newly created lots wholly or partially within the shoreline shall be of uniform size and dimension, whenever possible.D. Subdivision of more than four lots shall provide an improved and maintained pedestrian easement to the shoreline that is of sufficient width to ensure usable access for all residents. Public access to the shoreline shall be in conformance with the standards in K.C.C. 21A.25.140.E. Subdivisions should be designed to locate structures outside the shoreline jurisdiction whenever feasible. When lots are located within the shoreline jurisdiction, the size and shape of the lots should allow for the construction of residential units that do not require shoreline stabilization. (Ord. 16985 § 49, 2010: Ord. 11792 § 26, 1995: Ord.3688 § 410, 1978. Formerly K.C.C. 25.16.150).21A.25.240 Historic resources. Historic resources include historic buildings, sites, objects, districts and landscapes, prehistoric and historic archaeological resources and traditional cultural places. Development within shoreline environments shall protect historic resources as follows:A.1. Known historic resources are inventoried by the historic preservation program and are subject to the procedures in K.C.C. 20.62.150. As required by K.C.C. 20.62.150, the department shall inform the historic preservation officer regarding the impacts of development proposals on inventoried resources. Disturbance of known archaeological sites is also subject to state regulations, including chapters 27.44, 27.53 and 68.80 RCW. 2. If a known archaeological site or traditional cultural place is affected by a development proposal, the historic preservation officer shall inform and consult with the Washington state Department of Archaeology and Historic Preservation and any concerned Native American tribes. To the extent feasible, the historic preservation officer shall coordinate county and state required permitting and compliance procedures and requirements to avoid substantial duplication of effort by permit applicants. The department shall require a site inspection or evaluation by a professional archaeologist in coordination with any concerned Native American tribes. 3. In considering shoreline permits or shoreline exemptions with regard to known historic resources, the department may attach conditions to provide sufficient time for the Historic Preservation Officer to consult with the Washington State Department of Archaeology and Historic Preservation and any concerned Native American tribes, and to ensure that historic resources are properly protected, or for appropriate agencies to contact property owners regarding purchase or other long-term stewardship and protection arrangements. Provision for the protection and preservation of historic resources shall be incorporated in permits and exemptions to the maximum extent practical;B.1. Consistent with the definitions and requirements in chapters 27.44, 27.53 and 68.80 RCW, and with the intent of K.C.C. chapter 20.62, whenever potentially significant historic resources, or archaeological artifacts, are discovered in the process of development on shorelines, work on that portion of the development site shall be stopped immediately and the find reported as soon as possible to the department. 2. For inadvertent discoveries, the department shall notify the historic preservation officer. If an archaeological site or artifacts have been discovered, the department shall also notify the Washington state Department of Archaeology and Historic Preservation, any concerned Native American tribes and other appropriate agencies. The department shall require that a historic resource assessment be conducted immediately by a professional archaeologist, ethnographer or historic preservation professional, as applicable, in consultation with the historic preservation officer, to determine the significance of the discovery and the extent of damage that may have occurred to the resource. The historic resource assessment shall be distributed to the historic preservation officer, and, if an archaeological site, archaeological artifacts or a traditional cultural place have been discovered, the Washington state Department of Archaeology and Historic Preservation, and any concerned Native American tribes for a fifteen-day review period or, in the case of inadvertent discovery of human remains, a thirty-day review period to determine the significance of the discovery. If the historic resource has been determined not to be significant by the agencies or governments listed in this subsection B.2., or if those agencies or governments have failed to respond within the applicable review period following receipt of the historic resource assessment, the stopped work may resume; and 3. Upon receipt of a positive determination of a resource's significance, or if available information suggests that a negative determination is erroneous, the department or the historic preservation officer may require that a historic resource management plan be prepared by a qualified professional archaeologist or other appropriate professional if such action is reasonable and necessary to implement related program objectives and is consistent with the intent of King County policies and codes protecting historic resources;C.1. If a private or publicly owned historic resource is identified, public access shall be encouraged as appropriate for purposes of public education, but only if: a. the type or level of public access is consistent with the long term protection of both historic resource values and shoreline ecological functions; and b. an access management plan is developed in accordance with development site- and resource-specific conditions in consultation with the historic preservation officer and, if an archaeological site, archaeological artifacts or a traditional cultural place have been discovered, the Washington state Department of Archaeology and Historic Preservation, any concerned Native American tribes or other agencies, as appropriate, to address physical protection of the resource, hours of operation, interpretive or directional signage, lighting, pedestrian access or traffic and parking, as appropriate. 2. For archaeological sites and traditional cultural places, the historic preservation program, the Washington state Department of Archaeology and Historic Preservation, any concerned Native tribes or other agencies, as appropriate, shall approve public access measures before provision of public access to a site. (Ord. 16985 § 50, 2010).21A.25.250 Parking facilities. Parking facilities, except parking facilities associated with single detached dwelling units, shall meet the following standards:A. Parking areas serving a water-related, water-enjoyment or a non-water-oriented use must be located beneath or upland of the development that the parking area serves, except for utility facilities;B. The design of parking facilities must use low-impact designs, such as porous concrete and vegetated swales;C. Lighting shall be the minimum necessary and shall be shielded and directed away from the water and critical areas and critical area buffers; andD. In the Natural environment, parking areas shall be located at least two hundred feet from the ordinary high water mark. (Ord. 16985 § 51, 2010).21A.25.260 New utility facilities and repair and replacement of existing utility facilities. New utility facilities and repair and replacement of existing utility facilities may be permitted subject to the general requirements of this chapter, as follows:A. To the maximum extent practical, new utility and transmission facilities shall: 1. Avoid disturbance of unique and fragile areas; 2. Avoid disturbance of wildlife spawning, nesting and rearing areas; 3. Overhead utility facilities shall not be permitted in public parks, monuments, scenic recreation or historic areas; 4. Avoid changing groundwater patterns and hyporheic flows that support streams and wetlands; 5. Not be located within the Natural shoreline unless the utility is low-intensity; and 6. Avoid locating new utility and transmission facilities in tidelands or in or adjacent to the Maury Island aquatic reserve;B. New utility distribution and transmission facilities shall be designed to: 1. Be located outside the shoreline jurisdiction where feasible; 2. Be located within existing rights of way and utility corridors where feasible; 3. Minimize visual impact; 4. Harmonize with or enhance the surroundings; 5. Not create a need for shoreline protection; and 6. To the maximum extent practical, use natural screening;C. To the maximum extent practical the construction, repair, replacement and maintenance of utility facilities shall: 1. Maximize the preservation of natural beauty and the conservation of resources; 2. Minimize scarring of the landscape; 3. Minimize siltation and erosion; 4. Protect trees, shrubs, grasses, natural features and topsoil from drainage; and 5. Avoid disruption of critical aquatic and wildlife stages;D. Rehabilitation of areas disturbed by the construction, repair, replacement or maintenance of utility facilities shall: 1. Be accomplished as rapidly as possible to minimize soil erosion and to maintain plant and wildlife habitats; and 2. Use plantings compatible with the native vegetation;E. Solid waste transfer stations shall only be permitted within the High Intensity shoreline environment; andF. Utility production and processing facilities, such as power plants and sewage treatment plants, are not allowed within the shoreline jurisdiction. (Ord. 16985 § 53, 2010: Ord. 3688 § 411, 1978. Formerly K.C.C. 25.16.160).21A.25.270 Signs. Signs may be permitted subject to K.C.C. chapter 21A.20, but only as follows:A. Signs waterward of the ordinary high water mark shall be permitted only to the extent necessary for the operation of a permitted overwater development. No such a sign shall be larger than five square feet;B. In the Rural environment, signs may not exceed fifty square feet;C. In the Resource, Natural and Conservancy environments, signs are not allowed except for: 1. Signs of not more than twenty-five square feet within public parks or trails; and 2. Signs permitted under K.C.C. chapter 21A.20 for residential uses;D. Signs to protect public safety or prevent trespass may be allowed and should be limited in size and number to the maximum extent practical. (Ord. 16985 § 55, 2010: Ord. 3688 § 408, 1978. Formerly K.C.C. 25.16.080).21A.25.280 Transportation facilities.A. Transportation facilities, including, but not limited to, streets, alleys, highways, railroads and regional light rail transit may be located in all shoreline environments.B. Within street or alley rights-of-way, uses shall be limited to street purposes as defined by law.C. Within railroad and regional light rail transit rights-of-way, allowed uses shall be limited to: tracks, signals or other operating devices; movement of rolling stock; utility lines and equipment; and facilities accessory to and used directly for the delivery and distribution of services to abutting property.D. New transportation facilities shall, to the maximum extent practical: 1. Be located outside of the shoreline jurisdiction; 2. Avoid disturbance of unique and fragile areas; 3. Avoid disturbance of wildlife spawning, nesting and rearing areas; 4. Avoid changing groundwater patterns and hyporheic flows that support streams and wetlands; 5. Not create a need for shoreline protection; and 6. Use natural screening. (Ord. 16985 § 56, 2010).21A.25.290 Development limitations - mitigation - substantial development - record of review - conditions of approval - programmatic statement of exemption - exception to statement of exemption.A. Development within the shoreline jurisdiction, including preferred uses and uses that are exempt from permit requirements, shall be undertaken only if that development is consistent with the policies of RCW 90.58.020, chapter 173-26 WAC and the King County shoreline master program and will not result in a net loss of shoreline ecological functions or in a significant adverse impact to shoreline uses, resources and values, such as navigation, recreation and public access. The proponent of a shoreline development shall employ measures to mitigate adverse impacts on shoreline functions and processes following the sequencing requirements of K.C.C. 21A.25.080.B. A substantial development permit shall be required for all proposed uses and modifications within the shoreline jurisdiction unless the proposal is specifically exempt from the definition of substantial development in RCW 90.58.030 and WAC 173-27-040 or is exempted by RCW 90.58.140, WAC 173-27-044 or WAC 173-27-045. If a proposal is exempt from the definition of substantial development, a written statement of exemption is required for any proposed uses and modifications if: 1. WAC 173-27-050 applies; or 2. The proposed use or modification will occur waterward of the ordinary high water mark except for the maintenance of agricultural drainage that is not used by salmonids or as otherwise provided in subsection F. of this section.C. Whether or not a written statement of exemption is required, all permits issued for development activities within the shoreline jurisdiction shall include a record of review indicating compliance with the shoreline master program and regulations.D. As necessary to ensure consistency of the project with the shoreline master program and this chapter, the department may attach conditions of approval to a substantial development permit or a statement of exemption or to the approval of a development proposal that does not require either.E. The department may issue a programmatic statement of exemption as follows: 1. For an activity for which a statement of exemption is required, the activity shall: a. be repetitive and part of a maintenance program or other similar program; b. have the same or similar identifiable impacts, as determined by the department, each time the activity is repeated at all sites covered by the programmatic statement of exemption; and c. be suitable to having standard conditions that will apply to any and all sites; 2. The department shall uniformly apply conditions to each activity authorized under the programmatic statement of exemption at all locations covered by the statement of exemption. The department may require that the applicant develop and propose the uniformly applicable conditions as part of the statement of exemption application and may approve, modify or reject any of the applicant's proposed conditions. The department shall not issue a programmatic statement of exemption until applicable conditions are developed and approved; 3. Activities authorized under a programmatic statement of exemption shall be subject to inspection by the department. The applicant may be required to notify the department each time work subject to the programmatic statement of exemption is undertaken for the department to schedule inspections. In addition, the department may require the applicant to submit periodic status reports. The frequency, method and contents of the notifications and reports shall be specified as conditions in the programmatic statement of exemption; 4. The department may require revisions, impose new conditions or otherwise modify the programmatic statement of exemption or withdraw the programmatic statement of exemption and require that the applicant apply for a standard statement of exemption, if the department determines that: a. the programmatic statement of exemption or activities authorized under the statement of exemption no longer comply with law; b. the programmatic statement of exemption does not provide adequate regulation of the activity; c. the programmatic statement of exemption conditions or the manner in which the conditions are implemented are not adequate to protect against the impacts resulting from the activity; or d. a site requires site-specific regulation; and 5. If an activity covered by a programmatic statement of exemption also requires other county, state and federal approvals, to the extent feasible, the department shall attempt to incorporate conditions that comply with those other approvals into the programmatic statement of exemption.F. A statement of exemption is not required for maintenance of agricultural drainage or agricultural waterways used by salmonids if: 1. The maintenance project is conducted in compliance with a hydraulic project approval issued by the Washington state Department of Fish and Wildlife pursuant to chapter 77.55 RCW; 2. The maintenance project complies with the King County agricultural drainage assistance program as agreed to by the Washington state Department of Fish and Wildlife, the department of local services, permitting division, and the department of natural resources and parks, and as reviewed by the Washington state Department of Ecology; 3. The person performing the agricultural drainage maintenance and the land owner has attended training provided by King County on the King County agricultural drainage assistance program and the best management practices required under that program; 4. The maintenance project complies with the requirements of K.C.C. chapter 16.82; and 5. The project is not subject to federal permitting related to the U.S. Army Corps of Engineers Section 10 or Section 404 permits. (Ord. 19034 § 34, 2019: Ord. 18791 § 176, 2018: Ord. 18767 § 15, 2018: Ord. 17539 § 57, 2013: Ord. 17420 § 106, 2012: Ord. 16985 § 58, 2010: Ord. 3688 § 801, 1978. Formerly K.C.C. 25.32.010).21A.25.300 Permits prerequisite to other permits. In the case of development subject to the permit requirements of this chapter, applicants may need to obtain other permits and comply with other nonshoreline King County regulations. King County shall not issue any other permit for such development until such time as approval has been granted under this chapter. Any development subsequently authorized by King County shall be subject to the same terms and conditions that apply to the development authorized under this chapter. (Ord. 18767 § 16, 2018: Ord. 16985 § 60, 2010: Ord. 3688 § 802, 1978. Formerly K.C.C. 25.32.020).21A.25.310 Application review for expansion or replacement of a nonconforming use or development. The review of applications for the expansion, modification, reestablishment or replacement of a nonconforming use or development shall be in accordance with K.C.C. chapter 21A.32. (Ord. 18767 § 17, 2018: Ord. 16985 § 62, 2010: Ord. 12196 § 59, 1996: Ord. 11792 § 36, 1995: Ord. 5734 § 16, 1981: Ord. 3688 § 806, 1978. Formerly K.C.C. 25.32.060).21A.25.320 Appeals.A. Appeals from the final decision of the county with regard to shoreline management shall be governed solely by RCW 90.58.180.B. The effective date of King County's decision shall be the date of filing with the Department of Ecology as defined in RCW 90.58.140.C. When a hearing and decision has occurred under K.C.C. 25.32.080, as recodified by Ordinance 16985*, and the examiner's recommendation with regard to disposition of a proposed development under K.C.C. Titles 20 and 21A requires King County council action, the final decision of the county shall be effective on the date of filing as defined in RCW 90.58.140 for the purposes of appeal as provided in RCW 90.50.140. However, development may not occur until the King County council has taken final action on the examiner's recommendation required by K.C.C. Titles 20 and 21A. (Ord. 16985 § 64, 2010: Ord. 12196 § 62, 1996: Ord. 3688 § 810, 1978. Formerly K.C.C. 25.32.100).*Reviser’s note: K.C.C. 25.32.080 was repealed by Ordinance 16985, Section 137.21A.26DEVELOPMENT STANDARDS - COMMUNICATION FACILITIESSections:21A.26.010Purpose.21A.26.020Exemptions.21A.26.030Applicability.21A.26.050Setback requirements.21A.26.060Landscaping requirements.21A.26.070Color and lighting standards.21A.26.080Fencing and NIER warning signs.21A.26.090Interference.21A.26.100NIER exposure standards.21A.26.110NIER measurements and calculations.21A.26.120Measurements and monitoring.21A.26.130Shock and burn standard.21A.26.140Modifications.21A.26.150Consolidation.21A.26.160Supplemental application requirements.21A.26.170Notification requirements.21A.26.180NIER compliance criteria.21A.26.190NIER enforcement.21A.26.210State regulation.21A.26.010 Purpose. The purpose of this chapter is to establish guidelines for the siting of towers and antennas. The goals of this chapter are to:A. Encourage the location of towers in nonresidential areas and minimize the total number of towers throughout the community; B. Strongly encourage the joint use of new and existing tower sites;C. Encourage users of towers and antennas to locate them, to the extent possible, in areas where the adverse impact on the community is minimal;D. Encourage users of towers and antennas to configure them in a way that minimizes the adverse visual impact of the towers and antennas; E. Enhance the ability of the providers of telecommunications services to provide such services to the community quickly, effectively and efficiently; andF. Limiting exposures to NIER consistent with Federal Communication Commission statutes. (Ord. 13129 § 12, 1998: Ord. 10870 § 490, 1993).21A.26.020 Exemptions. The following are exempt from the provisions of this chapter and shall be permitted in all zones:A. Industrial processing equipment and scientific or medical equipment using frequencies regulated by the Federal Communications Commission (FCC);B. Machines and equipment that are designed and marketed as consumer products, such as microwave ovens and remote control toys;C. The storage, shipment or display for sale of transmission equipment;D. Radar systems for military and civilian communication and navigation;E. Hand-held, mobile, marine and portable radio transmitters and/or receivers;F. Two-way radio utilized for temporary or emergency services communications;G. Licensed amateur (Ham) radio stations and citizen band stations;H. Earth station downlink using satellite dish antennas with a diameter of less than 12 feet provided that stations in excess of one dish antennas are subject to conditional use permits;I. Receive-only satellite dish antennas as an accessory use; andJ. Two-way radio antennas, point-to-point microwave dishes, and personal wireless service antennas that are not located on a transmission structure (lattice towers and monopoles); andK. Any maintenance, reconstruction, repair or replacement of a conforming or nonconforming communication facility, transmission equipment, transmission structure or transmitter building; provided, that the transmission equipment does not result in noncompliance with K.C.C. 21A.26.100 and 21A.26.130.L. In the event a building permit is required for any emergency maintenance, reconstruction, repair or replacement, filing of the building permit application shall not be required until 30 days after the completion of such emergency activities. In the event a building permit is required for nonemergency maintenance, reconstruction, repair or replacement, filing of the building permit application shall be required prior to the commencement of such nonemergency activities. (Ord. 17191 § 42, 2011: Ord. 10870 § 491, 1993).21A.26.030 Applicability. The standards and process requirements of this chapter supersede all other review process, setback or landscaping requirements of this title. All communication facilities that are not exempt under K.C.C. 21A.26.020 shall comply with this chapter as follows:A. New communications facilities, with the exception of consolidations, shall comply with K.C.C 21A.26.020 through 21A.26.130 and K.C.C. 21A.26.160 through 21A.26.190;B. Modified communications facilities, with the exception of consolidations, shall comply with standards as provided in K.C.C. 21A.26.020, K.C.C. 21A.26.060 through 21A.26.140, and 21A.26.160 through 21A.26.190;C. Consolidations shall comply with standards as provided in K.C.C. 21A.26.020, K.C.C. 21A.26.060 through 21A.26.130, and K.C.C. 21A.26.150 through 21A.26.190; andD. New, modified or consolidated minor communication facilities shall comply with the standards of this chapter and K.C.C. chapter 21A.27. In the case of a conflict between this chapter and K.C.C. chapter 21A.27, the provisions of this chapter shall apply. (Ord. 17191 § 43, 2011: Ord. 17029 § 3, 2011 (Expired 12/31/2012): Ord. 13129 § 23, 1998: Ord. 10870 § 492, 1993).21A.26.050 Setback requirements. Except as outlined for modifications and consolidations pursuant to K.C.C. 21A.26.140 and 21A.26.150 or when setbacks are increased to ensure compliance with NIER exposure limits, communication facilities shall comply with the following setbacks:A. Transmission structures, other than those for minor communication facilities, that do not exceed the height limit of the zone in which they are located shall be set back from the property line as required for other structures by the zone in which such transmission structure is located;B. Transmission structures, other than those for minor communication facilities, that exceed the height limit of the zone in which they are located shall be set back from property lines either a minimum of fifty feet or one foot for every foot in height, whichever results in the greater setback, except: 1. Transmission structures, other than those for minor communication facilities located in the A, F, NB, CB, RB, O or I zones shall be set back from the property line as required by the zone in which they are located; and 2. Transmission structures for minor communication facilities shall be set back from the property line as provided in K.C.C. 21A.27.030;C. When two or more communication facilities share a common boundary, the setback from such boundary shall comply with the requirements of the zone in which the facilities are located, unless easements are provided: 1. On the adjoining sites that limit development to communication facilities; 2. Of sufficient depth to provide the setbacks required in subsections A and B; and 3. That provide for King County as a third party signatory to the agreement; andD. Transmitter buildings shall be subject to the setback requirements of the zone in which they are located. (Ord. 17191 § 44, 2011: Ord. 13129 § 24, 1998: Ord. 11621 § 82, 1994: Ord. 10870 § 494, 1993).21A.26.060 Landscaping requirements. A communication facility site shall provide landscaping as follows:A. When the facility is located in: 1. The NB, CB, RB, O or I zone, the base of any transmission structure or transmitter building shall be landscaped with eight feet of Type II landscaping as defined by K.C.C. 21A.16.040B, if there is no existing landscaping consistent with K.C.C. chapter 21A.16 along the lot line abutting R, UR, or RA zoned properties. 2. The A, F or M zone, the base of the transmission structure or transmitter building shall be landscaped with ten feet of Type III landscaping (groundcover may be excluded) as defined by K.C.C. 21A.16.040C, if the base of such transmission structure or transmitter building is within three hundred feet of any lot line abutting R, UR, or RA zoned properties. 3. The R, UR or RA zone, the base of any transmission structure or transmitter building shall be landscaped with ten feet of Type I landscaping as defined by K.C.C. 21A.16.040A.B. When a security fence is used to prevent access onto a transmission structure or transmitter building, any landscaping required pursuant to K.C.C. 21A.26.060A shall be placed outward of such security fence.C. When a security fence is used: 1. In the NB, CB, RB, O or I zone, wood slats shall be woven into the security fence if made of chain-link material. 2. In the R, UR or RA zone, climbing evergreen shrubs or vines capable of growing on the fence shall supplement any landscaping required pursuant to K.C.C. 21A.26.060A.D. Landscaping shall be planted according to accepted practice in good soil and maintained in good condition at all times. Landscaping shall be planted as a yard improvement at or before the time of completion of the first structure or within a reasonable time thereafter, considering weather and planting conditions.E. Existing vegetation may be used and/or supplemented with additional vegetation to comply with the requirements of K.C.C. 21A.26.060A.F. The director may waive or modify the provisions for landscaping at the base of the transmission support structure and equipment buildings when: 1. Existing structures on the site or the screening effects of existing vegetation on the site or along the site perimeter would preclude the ability to view the base of the tower or equipment building, or 2. The required landscaping is accessible to grazing animals and the animals would be better protected by placement of landscape materials within any proposed fencing or by the use of alternative landscaping vegetation that would not be toxic to the animals. (Ord. 13129 § 15, 1998: Ord. 10870 § 495, 1993).21A.26.070 Color and lighting standards. Except as specifically required by the Federal Aviation Administration ("FAA") or the FCC, transmission structures shall:A. Use colors such as grey, blue or green which reduce their visual impacts; provided, wooden poles do not have to be painted; andB. Not be illuminated, except transmitter buildings may use lighting for security reasons which is compatible with the surrounding neighborhood. (Ord. 10870 § 496, 1993).21A.26.080 Fencing and NIER warning signs. Communication facility sites shall be:A. Fenced in a manner which prevents access by the public to transmission structures and/or areas of the site where NIER or shock/burn levels are exceeded. This may be modified if natural features, such as an adjoining waterway, or a topographic feature preclude access;B. Signed to warn the public of areas of the site where: 1. NIER standards are exceeded; and 2. Potential risks for shocks or burns are present. (Ord. 10870 § 497, 1993).21A.26.090 Interference. Permit applications for communication facilities shall include:A. A statement describing the nature and extent of interference which may be caused by the proposed communication facility and the applicant's responsibilities under FCC rules and regulations;B. Unless the department determines that there will be no noticeable interference from the proposed communication facility, notification of expected interference shall be provided as specified in K.C.C. 21A.26.170; andC. General information concerning the causes of interference and steps which can be taken to reduce or eliminate it. (Ord. 10870 § 498, 1993).21A.26.100 NIER exposure standards. To prevent whole-body energy absorption of .08 W/Kg or more, a communication facility, by itself or in combination with others, shall not expose the public to NIER that exceeds the electric or magnetic field strength, or the power density, for the frequency ranges and durations described as follows:NIER Exposure Standards (1) (6)FrequencyMean squaredMean squaredEquivalent(2)electricmagneticplane-wavefield strength(3)field strength(4)power density(5)0.1 to 380,0000.520,0003 to 304,000 x (180/f2)0.025 x (180/f2)180,000/f230 to 3008000.005200300 to 15004,000 x (f/1500)0.025 x (f/1500)f/1.51500 to 300,0004,0000.0251000(1) All standards refer to root mean squared measurements averaged over a six minute period;(2) Frequency or f is measured in megahertz (MHz);(3) Electric field strength is expressed in volts squared per meter squared (V2/m2);(4) Magnetic field strength is expressed in amperes squared per meter squared (A2/m2); and(5) Power density is expressed in microwatts per centimeter squared (uW/cm2).(6) Peak NIER levels shall not exceed the following equivalent plane-wave power densities:a. Twenty times the average values in the frequencies below 300 MHz;b. 4,000 uW/cm2 in the frequencies between 300 Mhz to 6,000 MHz;c. (f/1.5)uW/cm2 in the frequencies 6,000 MHz to 30,000 MHz; andd. 20,000 uW/cm2 in the frequencies above 30 GHz. (Ord. 10870 § 499, 1993).21A.26.110 NIER measurements and calculations. NIER levels shall be measured and calculated as follows:A. When measuring NIER for compliance with K.C.C. 21A.26.100: 1. Measuring equipment used shall be generally recognized by the Environmental Protection Agency (EPA), National Council on Radiation Protection and Measurement (NCRPM), American National Standards Institute (ANSI), or National Bureau of Standards (NBS) as suitable for measuring NIER at frequencies and power levels of the proposed and existing sources of NIER; 2. Measurement equipment shall be calibrated as recommended by the manufacturer in accordance with methods used by the NBS and ANSI, whichever has the most current standard; 3. The effect of contributing individual sources of NIER within the frequency range of a broadband measuring instrument may be specified by separate measurement of these sources using a narrowband measuring instrument; 4. NIER measurements shall be taken when and where NIER levels are expected to be highest due to operating or environmental conditions; 5. NIER measurements shall be taken along the perimeter of the communication facility site and other areas on-site or off-site where the health department deems necessary to take measurements; and 6. NIER measurements shall be taken following spatial averaging procedures generally recognized and used by experts in the field of RF measurement or other procedures recognized by the FCC, EPA, NCRPM, ANSI, NBS;B. NIER calculations shall be consistent with the FCC, Office of Science and Technology (OST) bulletin 65 or other engineering practices recognized by the EPA, NCRPM, ANSI, NBS or similarly qualified organization; andC. Measurements and calculations shall be certified by a licensed professional engineer and shall be accompanied by an explanation of the protocol, methods, equipment, and assumptions used. (Ord. 10870 § 500, 1993).21A.26.120 Measurements and monitoring.A. The department of public health shall measure or contract for measurement of NIER levels as necessary to insure that the NIER standard is not being exceeded.B. If the NIER level of an existing major communication facility has not been measured within 3 years of June 28, 1993, such facility shall be measured within 120 days from June 28, 1993. All major communication facilities shall be measured every third year thereafter. The measurements shall be submitted to the department of public health for review within 60 days of measurement. The department shall be reimbursed for its review of the measurements pursuant to this section.C. New major communication facilities shall be measured within 120 days from the commencement of the operation and every third year thereafter. The department shall be reimbursed for its review of the measurements pursuant to this section.D. The department of public health shall have the authority to assess fees for the cost of plan review. The fee shall be based upon the time required by staff, including overhead cost, for plan review. (Ord. 10870 § 501, 1993).21A.26.130 Shock and burn standard. The communication facility shall not emit radiation such that the public will be exposed to shock and burn in excess of the standards contained in ANSI C-95.1 or subsequent amendments thereto recognized by ANSI. (Ord. 10870 § 502, 1993).21A.26.140 Modifications.A. Cumulative modifications of conforming or nonconforming communication facilities, transmission structures or transmission equipment that do not increase the overall height of the transmission structure or transmission equipment by more than thirty percent shall be allowed subject to the following: 1. A nonconformance with respect to the transmission structure shall not be created or increased, except as otherwise provided above as to height; 2. Existing perimeter vegetation or landscaping shall not be reduced; 3. The modification brings the facility, structure or equipment into compliance with K.C.C. 21A.26.100 and 21A.26.130. The applicant shall provide King County a detailed certification of compliance with these provisions that has been prepared by a licensed professional engineer; and 4. For minor communication facilities, the allowances for increased height established by K.C.C. chapter 21A.27 shall be complied with.B. Except for consolidations allowed by K.C.C. 21A.26.150, modifications which increase the overall height of the transmission structure or transmission equipment by more than thirty percent shall be subject to the following: 1. Applications for such transmission structures shall be reviewed in accordance with the applicable process specified in this chapter; and 2. Such transmission structures shall comply with K.C.C. 21A.26.020, K.C.C. 21A.26.060 through 21A.26.140, K.C.C. 21A.26.160 through 21A.26.190 and, for minor communication facilities, with K.C.C. chapter 21A.27. (Ord. 17841 § 45, 2014: Ord. 17191 § 45, 2011: Ord. 13129 § 25, 1998: Ord. 10870 § 503, 1993).21A.26.150 Consolidation. Consolidation of two or more existing transmission structures may be permitted subject to the following:A. If the consolidated transmission structure cannot meet the requirements of K.C.C. 21A.26.050, it shall be located on the portion of the parcel on which it is situated which, giving consideration to the following, provide the optimum practical setback from adjacent properties: 1. Topography and dimensions of the site, 2. (in the case of a consolidation) to any existing structures to be retained, and 3. (in the case of a guyed transmission tower) to guy anchor placement necessary to assure structural integrity of the consolidated transmission tower.Consolidated transmission structures shall be set back from abutting residential property a minimum of ten percent of the height of the consolidated transmission structure, but in all cases no less than 100 feet;B. If a consolidation involves the removal of transmission structures from two or more different sites and if a consolidated transmission structure is to be erected on one of those sites, it shall be erected on the site which provides for the greatest compliance with the standards of this chapter;C. All existing transmission equipment on the site of a communication facility which does not comply with the provisions of this chapter shall be relocated to the consolidated transmission structure before the relocation of transmission equipment from a non-exempt off-site, conforming communication facility is permitted;D. The consolidation shall eliminate NIER and electrical current levels attributable to the consolidating transmission equipment which exceed the limits of K.C.C. 21A.26.100 and 21A.26.130;E. Any transmission structure to be removed as part of a consolidation shall be removed within 12 months of relocation of the transmitting equipment;F. Consolidation shall result in a net reduction in the number of transmission structures; andG. Consolidated facilities shall require a conditional use permit. (Ord. 10870 § 504, 1993).21A.26.160 Supplemental application requirements.A. In addition to any required site plan, a permit application for a communication facility shall also include: 1. A site plan that shows existing and proposed transmission structures; guy wire anchors; warning signs; fencing and access restrictions; 2. A report by a licensed professional engineer demonstrating compliance with applicable structural standards of K.C.C. Title 16, and describing the general structural capacity of any proposed transmission structure(s), including: a. The number and type of antennas that can be accommodated; and b. The basis for the calculation of capacity; 3. A report by a state licensed professional engineer that includes the following: a. A description of any proposed transmission tower(s) or structure(s), including height above grade, materials, color and lighting; and b. Information related to interference required by K.C.C. 21A.26.090.B. Where a permit for a non-exempt communication facility is required, the application shall also include the following information: 1. The name and address of the operator(s) of proposed and existing antennas on the site; 2. The height of any proposed antennas; 3. Manufacture, type, and model of such antennas; 4. Frequency, modulation and class or service; 5. Transmission and maximum effective radiated power; 6. Direction of maximum lobes and associated radiation; 7. The calculated NIER levels attributable to the proposed antennas at points along the property line and other areas off-site which are higher than the property line points, as well as calculated power density (NIER levels) in areas that are expected to be unfenced on-site; 8. For a major communication facility, if there is another major communication facility within one mile of the site of the proposed facility, the level of NIER at the points identified in subsection B.7. as measured within thirty days prior to application; and 9. For a minor communication facility, if there is an existing major communication facility within one-half mile of the site of the proposed facility, the level of NIER at the points identified in subsection B.7. as measured within thirty days prior to the application. (Ord. 17191 § 46, 2011: Ord. 10870 § 505, 1993).21A.26.170 Notification requirements. Notification of a permit application shall be given to adjacent property owners within a 500 foot radius and the local community council. The area within which mailed notice is required shall be expanded to include at least 20 different owners in rural or lightly inhabited areas or in other appropriate cases to the extent the department determines is necessary. The standards of published notice and posting of property required by K.C.C. 21A.42 shall be pursuant to K.C.C. 21A.40. (Ord. 10870 § 506, 1993).21A.26.180 NIER compliance criteria. The department of public health shall consider the following criteria in determining compliance with K.C.C. 21A.26.100:A. The number and location of points at which levels have been determined to exceed NIER standards;B. The duration of exposure to NIER levels above the standard;C. The extent by which the levels measured at such points exceed the standards established by this chapter; andD. The relative contribution of individual sources in a multiple source environment. (Ord. 10870 § 507, 1993).21A.26.190 NIER enforcement.A. The department of public health shall be responsible for the enforcement of the provisions of K.C.C. 21A.26.100 in accordance with K.C.C. 23. The department director shall allow no more than 10 days to elapse from the date of a violation before corrective action is commenced. If this deadline cannot be met, the director shall issue a stop work order.B. If the approved NIER standard is exceeded in an area where there are multiple users and transmission equipment, all users shall share in the NIER the reduction will adequately protect the proposed development and the sensitive area; reductions, scaled proportionally to their current discharges. (Ord. 10870 § 508, 1993).21A.26.210 State regulation.A. If state regulations establish a NIER exposure standard which is more restrictive than the county standard, the state standard shall automatically become effective.B. If such state standards are intended to preempt local enforcement with respect to specific sections of this chapter, said sections shall automatically be deemed ineffective.C. Application of the provisions of this chapter shall be subject to any rule, regulation, order or decision of any state or federal court or government agency with which such communication facility is obligated to comply. (Ord. 10870 § 510, 1993).21A.27DEVELOPMENT STANDARDS - MINOR COMMUNICATION FACILITIES21A.27.010Preapplication community meetings.21A.27.020Review process.21A.27.030Development standards for transmission support structures.21A.27.040Visual compatibility standards. 21A.27.050Visual impact - additional standards to reduce degree21A.27.060Time limits and establishment period.21A.27.070Cessation of use.21A.27.080Colocation.21A.27.090Modifications.21A.27.100Antennas.21A.27.110Location within street, utility and railroad rights-of-way.21A.27.120Public parks and open spaces owned by King County.21A.27.130Criteria for determining technical feasibility.21A.27.140Applicability to vested applications.21A.27.150Potential annexation areas.21A.27.160Technical evaluation.21A.27.010 Preapplication community meetings. When a new transmission support structure is proposed, a community meeting shall be convened by the applicant prior to submittal of an application.A. At least two weeks in advance, notice of the meeting shall be provided as follows: 1. Published in the local paper and mailed to the department, and 2. Mailed notice shall be provided to all property owners within five hundred feet or at least twenty of the nearest property owners, whichever is greater, as required by K.C.C. 21A.26.170 of any potential sites, identified by the applicant for possible development, to be discussed at the community meeting. When the proposed transmission support structure exceeds a height of one hundred twenty feet, the mailed notice shall be provided to all property owners within one thousand feet. The mailed notice shall at a minimum contain a brief description and purpose of the project, the estimated height, approximate location noted on an assessor map with address and parcel number, photo or sketch of proposed facility, a statement that alternative sites proposed by citizens can be presented at the meeting that will be considered by the applicant, a contact name and telephone number to obtain additional information and other information deemed necessary by King County. Because the purpose of the community meeting is to promote early discussion, applicants are encouraged to note any changes to the conceptual information presented in the mailed notice when they submit an application.B. At the community meeting at which at least one employee of the department of local services, permitting division, assigned by the permitting division manager or designee, shall be in attendance, the applicant shall provide information relative to existing transmission support structures and other nonresidential structures, such as water towers and electrical transmission lines, within one-quarter mile of potential sites, and shall discuss reasons why those existing structures are unfeasible. Furthermore, any alternative sites within one-quarter mile, identified by community members and provided to the applicant in writing at least five days in advance of the meeting, shall be evaluated by the applicant to the extent possible given the timeframe, and discussed at the meeting. A listing of the sites, identified in writing and provided to the applicant at or before the community meetings, shall be submitted to the department with the proposed application. Applicants shall also provide a list of meeting attendees and those receiving mailed notice and a record of the published meeting notice at the time of application submittal. (Ord. 18791 § 177, 2018: Ord. 17420 § 107, 2012: Ord. 17416 § 17, 2012: Ord. 13129 § 2, 1998. Formerly K.C.C. 21A.26.300).21A.27.020 Review process. Minor communication facilities shall be reviewed as follows:MINOR COMMUNICATION FACILITIES - REVIEW PROCESSZone District(s)AntennaTransmission Support StructureI, RB, CBNB, OPPC1F, MPPC1UR, RA, APP2 C1 and 2R1 - R48PPC1P - Permitted UseC - Conditional Use1 If the proposal exceeds the development standards of this chapter contained in K.C.C. 21A.27.030 for transmission support structures, the proposal shall be reviewed through this process.2 The proposed transmission support structure shall not be located on any RA or A zoned site for which the development rights have been encumbered by the farmlands preservation program.(Ord. 13129 § 3, 1998. Formerly K.C.C. 21A.26.310).21A.27.030 Development standards for transmission support structures. A new transmission support structure exceeding the standards of this section are subject to the conditional use permit process as outlined in K.C.C. 21A.27.020. These provisions do not apply to transmission support structures that are being modified or replaced pursuant to the provisions of K.C.C. 21A.27.090 or replace an existing transmission support structure.MINOR COMMUNICATION FACILITIES - DEVELOPMENT STANDARDSZone District(s)Height and Location Of TowerSetbacks 1I140 feet high50 feet (or one foot setback for every one foot in height) from any UR, RA, A, or R1 - R48 zone property, whichever provides the greatest setbackRB, CB120 feet highSAME AS ABOVENB, O, UR, RA, A, R1 - R4860 feet highSAME AS ABOVEF, M140 feet high SAME AS ABOVE1Setbacks may be modified to achieve additional screening, see K.C.C. 21A.27.040 or as provided in K.C.C. 21A.26.050.(Ord. 17841 § 46, 2014: Ord. 13129 § 4, 1998. Formerly K.C.C. 21A.26.320).21A.27.040 Visual compatibility standards. With consideration to engineering and structural requirements, and the coverage patterns the provider is seeking to achieve, minor communication facilities shall be subject to the following visual compatibility standards in addition to K.C.C. 21A.44.040.A. Antenna should, to the extent practicable, reflect the visual characteristics of the structure to which it is attached. This should be achieved through the use of colors and materials, as appropriate. When located on structures such as buildings or water towers, the placement of the antenna on the structure should reflect the following order of priority in order to minimize visual impact: 1. A location as close as possible to the center of the structure, and 2. long the outer edges or side-mounted, provided that in this instance, additional means such as screens should be considered and may be required by the department on a case-by-case basis, and 3. When located on the outer edge or side-mounted, be placed on the portion of the structure less likely to be seen from adjacent lands containing, in descending order of priority: existing residences, public parks and open spaces, and public roadways.B. To the extent that there is no conflict with the color and lighting requirements of the Federal Communication Commission and the Federal Aviation Administration for aircraft safety purposes, transmission support structures shall be designed to blend with existing surroundings to the extent feasible. This should be achieved through the use of compatible colors and materials, and alternative site placement to allow the use of topography, existing vegetation or other structures to screen the proposed transmission support structure from adjacent lands containing, in descending order of priority: existing residences, public parks and open spaces, and public roadways.C. The setback provisions of K.C.C. 21A.27.030 may be waived by the department or the examiner, in order to achieve greater levels of screening than that which would be available by using the stated setback, during the course of the review process described in K.C.C. 21A.27.020. In waiving the requirement, the department or examiner shall consider the protection of adjacent lands on the basis of the priorities stated in subsections A. and B. of this section. (Ord. 13129 § 5, 1998. Formerly K.C.C. 21A.26.330).21A.27.050 Visual impact - additional standards to reduce degree. The department shall also consider the following criteria and give substantial consideration to on-site location and setback flexibility authorized in K.C.C. 21A.27.040.C. when reviewing applications for new free-standing towers and determining appropriate levels of mitigation:A. Whether existing trees and vegetation can be preserved in such a manner that would most effectively screen the proposed tower from residences on adjacent properties;B Whether there are any natural land-forms, such as hills or other topographic breaks, that can be utilized to screen the tower from adjacent residences;C. Whether the applicant has utilized a tower design that reduces the silhouette of the portion of the tower extending above the height of surrounding trees; andD. Whether the factors of subsections B. and C. can be addressed and the height of the proposed tower be reduced and still provide the level of coverage proposed by the applicant. (Ord. 13129 § 17, 1998. Formerly K.C.C. 21A.26.340).21A.27.060 Time limits and establishment period. The building permit shall become null and void if construction of the transmission support structure has not begun within one year after the effective date of permit approval or if antennas are not installed within one hundred eighty days after construction of the transmission support structure. Extensions shall be allowed only in accordance with the criteria specified for building permit extensions in K.C.C. 16.02.290. (Ord. 19485 § 207, 2022: Ord. 13129 § 6, 1998. Formerly K.C.C. 21A.26.350).21A.27.070 Minor communication facilities - cessation of use. Antenna shall be removed from transmission support structures within one hundred eighty days after the antenna is no longer operational. Transmission support structures for wireless communication facilities shall be removed within one year of the date the last antenna is removed. (Ord. 13129 § 7, 1998. Formerly K.C.C. 21A.26.360).21A.27.080 Colocation.A. Upon application for a conditional use permit or a building permit for a new free-standing tower, whichever is required first, the applicant shall provide a map showing all existing transmission support structures or other suitable nonresidential structures located within one-quarter mile of the proposed structure with consideration given to engineering and structural requirements. No new transmission support structure shall be permitted if an existing structure suitable for attachment of an antenna or collocation [colocation] is located within one-quarter mile, unless the applicant demonstrates that the existing structure or a new structure complying with K.C.C. 21A.27.090: 1. would be physically or technologically unfeasible pursuant to K.C.C. 21A.27.130, or 2. is not made available for sale or lease by the owner, or 3. is not made available at a market rate cost, or 4. would result in conflicts with Federal Aviation Administration height limitations.B. The burden of proof shall be on the applicant to show that a suitable existing, modified or replacement structure for mounting of antenna or collocation [colocation] cannot be reasonably or economically used in accordance with these criteria.C. Prior to the receipt of a building permit to construct a new tower, the applicant shall file a letter agreeing to allow collocation [colocation] on the tower with the department. The agreement shall commit the applicant to provide, either at a market rate cost or at another cost basis agreeable to the affected parties, the opportunity to collocate [colocation] the antenna of other service providers on the applicant’s proposed tower to the extent that such collocation [colocation] is technically feasible for the affected parties.D. All new or modified transmission support structures shall be constructed in a manner that would provide sufficient structural strength to allow the collocation [colocation] of additional antenna from other service providers. (Ord. 14045 § 50, 2001: Ord. 13129 § 8, 1998. Formerly K.C.C. 21A.26.370).21A.27.090 Modifications.A. Antenna modifications consistent with K.C.C. 21A.27.100 are permitted outright. Antenna modifications consistent with K.C.C. 21A.27.100 that are proposed for a transmission support structure that was approved by a conditional use permit are permitted outright, notwithstanding conditions in the conditional use permit that limit the number of antennae allowed on the transmission support structure.B.1. Except as otherwise provided in subsection B.2. of this section, modifications to transmission support structures are permitted outright, if there is no increase in the height of the transmission support structure. 2. A modification to increase the height of a transmission support structure is permitted outright if the increase in height is: a. necessary to accommodate the actual collocation of the antenna of other service providers, or to accommodate the current providers antenna required to use new technology, such as digital transmissions; b. limited to no more than forty feet above the height of the existing transmission support structure; or c. the transmission support structure is located in the rural area zone or a residential zone, the proposed height exceeds sixty feet and the applicant demonstrates the proposed height is required to meet the proposed area of coverage. 3. If modification to increase the height of a transmission support structure is proposed in the rural area zone or a residential zone: a. notice and a comment period shall be provided consistent with K.C.C. 20.20.060; b. If the need for additional height is challenged within the comment period specified, a technical evaluation under K.C.C. 21A.27.160 shall be conducted; and c. The department may approve, require additional mitigation, or deny the proposed height increase on the basis of this technical evaluation. (Ord. 17841 § 47, 2014: Ord. 17539 § 58, 2013: Ord. 14045 § 51, 2001: Ord. 13129 § 9, 1998. Formerly K.C.C.21A.26.380).21A.27.100 Antennas. Antennas meeting the standards of this section are permitted outright. An antenna shall not extend more than six feet horizontally from any structure to which it is attached. Furthermore, an antenna shall not extend vertically above the uppermost portion of the structure to which it is mounted or attached, as follows: A. Not more than twenty feet on a nonresidential structure, andB. Not more than fifteen feet on a residential structure. (Ord. 13129 § 10, 1998. Formerly K.C.C. 21A.26.390).21A.27.110 Location within street, utility and railroad rights-of-way.A. The mounting of antenna upon existing structures, such as light and power poles, located within publicly or privately maintained street, utility and railroad right-of-ways is permitted outright. If an existing structure within a street, utility, or railroad rights-of-ways cannot accommodate an antenna due to structural deficiency or does not have the height required to provide adequate signal coverage, the structure may be replaced with a new structure that will serve the original purpose and will not exceed the original height by forty feet. However, minor communication facilities within street, utility and railroad right-of-way that propose the construction of a separate structure used solely for antenna shall be subject to the zoning provisions applicable to the property abutting the portion of right-of-way where the structure is proposed except that the setbacks specified in the zoning code shall not apply. Setbacks shall be those specified in the road design standards. In cases where the abutting property on either side of the right-of-way has different zoning, the more restrictive zoning provisions shall apply.B. The placement of antenna on existing or replacement structures within street, utility or railroad rights-of-way is the preferred alternative in residential neighborhoods and the Rural Areas and the feasibility of such placement shall be considered by the county whenever evaluating a proposal for a new transmission support structure, except for a new structure that is proposed to collocate antenna for two or more separate service providers. (Ord. 14045 § 52, 2001: Ord. 13129 § 11, 1998. Formerly K.C.C. 21A.26.400).21A.27.120 Public parks and open spaces owned by King County. Within public parks and open spaces owned by King County, the placement of antennas on existing structures, such as power poles, light poles for streets and parking lots, light standards for recreational fields and communication towers, is the preferred option. If an existing structure within a county-owned park or open space cannot accommodate an antenna due to structural deficiency, or does not have the height required to provide adequate signal coverage, the structure may be replaced with a new structure provided that the new structure will serve the original purpose and not exceed the original height by forty feet. Any height increase in excess of forty feet will require a conditional use permit.The construction of a new free-standing tower within public parks and open spaces owned by King County shall be subject to a conditional use permit when the height of the proposed tower exceeds sixty feet. (Ord. 14045 § 53, 2001: Ord. 13129 § 14, 1998. Formerly K.C.C. 21A.26.410).21A.27.130 Criteria for determining technical feasibility. When an applicant is required to demonstrate that an existing, modified or replacement structure is not technically feasible for collocation, the evidence submitted to corroborate that finding may consist of any of the following:A. No existing structures are located within the geographic area required to meet the applicant’s proposed area of coverage.B. Existing structures are not of sufficient structural strength to support the applicant’s proposed antenna and related equipment and the cost of modification or replacement of an existing structure to allow collocation would equal or exceed that of the construction of the new structure.C. Existing structures or structures modified consistent with K.C.C. 21A.27.090 would not be of sufficient height required to meet the applicant’s proposed area of coverage or allow microwave connection to other sites operated by the applicant.D. The applicant’s proposed antenna would cause interference between the proposed and existing antenna, and that even the additional height permitted for collocations pursuant to K.C.C. 21A.27.090 would not ensure enough separation to avoid such interference. (Ord. 14045 § 54, 2001: Ord. 13129 § 16, 1998. Formerly K.C.C. 21A.26.420).21A.27.140 Applicability to vested applications. The standards of Ordinance 13129 shall not apply to vested applications for conditional use permits and building permits for transmission support structures. Furthermore, the standards, except for the antenna mounting provisions of K.C.C. 21A.27.100, shall not apply to new building permits required to construct a transmission support structure that been authorized through a prior-vested or prior-approved conditional use or special use permit. (Ord. 13129 § 18, 1998. Formerly K.C.C. 21A.26.430).21A.27.150 Standards within city potential annexation areas. Within the approved potential annexation areas of a city, the agreed upon permitting jurisdiction shall apply the provisions of the applicable city as provided for by an interlocal agreement that has been entered into between the city and the county. The city standards would be applied when adopted in an ordinance by King County. (Ord. 13129 § 21, 1998. Formerly K.C.C. 21A.26.440).21A.27.160 Technical evaluation. The department of local services, permitting division, shall retain the services of a registered professional electrical engineer accredited by the state of Washington who holds a Federal Communications General Radio telephone Operator License. The engineer will provide technical evaluation of permit applications for minor communications facilities. The department is authorized to charge the applicant for these services. The specifications for an RFP to retain a consulting engineer shall specify at least the qualifications noted above, the capacity to provide a three week turnaround on data review, a request for a proposed fixed fee for services and shall state a preference for a qualified professional with a balance of experience in both the private and public sectors. Such a review shall be performed in a timely manner, be limited to the data necessary to establish findings pursuant to K.C.C. 21A.27.130.C. and 21A.27.130.D, and avoid any conflicts with the department’s duty to review permit applications within one hundred twenty days of acceptance pursuant to RCW 36.70B.090. This review shall be performed when requested by affected residents pursuant to K.C.C. 21A.27.090. (Ord. 18791 § 178, 2018: Ord. 17420 § 108, 2012: Ord. 13129 § 22, 1998. Formerly K.C.C. 21A.26.450).21A.28DEVELOPMENT STANDARDS - ADEQUACY OF PUBLIC FACILITIES AND SERVICESSections:21A.28.010Purpose.21A.28.020General requirements.21A.28.030Adequate sewage disposal.21A.28.040Adequate water supply.21A.28.050Surface water management.21A.28.060Adequate roads.21A.28.120Adequate vehicular access.21A.28.130Adequate fire protection.21A.28.140School concurrency - Applicability and relationship to fees.21A.28.150Findings, recommendations, and decisions regarding school capacities.21A.28.152Submission of district capital facilities plan and data.21A.28.154School technical review committee.21A.28.156Annual council certification and review.21A.28.160School concurrency standard.21A.28.180Credit for improvements.21A.28.010 Purpose. The purpose of this chapter is to ensure that public facilities and services necessary to support development are adequate or will be provided in a timely manner consistent with the Public Facilities and Services planning goal of the Washington State Growth Management Act of 1990 by:A. Specifying the on-site and off-site facilities and services that must be in place or otherwise assured of timely provision prior to development;B. Allocating the cost of those facilities and services fairly; andC. Providing a general framework for relating development standards and other requirements of this code to: 1. Adopted service level standards for public facilities and services; 2. Procedural requirements for phasing development projects to ensure that services are provided as development occurs; and 3. The review of development permit applications. (Ord. 10870 § 511, 1993).21A.28.020 General requirements.A. All new development proposals including any use, activity or structure allowed by K.C.C. chapter 21A.08 that requires King County approval shall be adequately served by the following facilities and services prior to the time of occupancy, recording or other land use approval, as further specified in this chapter: 1. sewage disposal; 2. water supply; 3. surface water management; 4. roads and access; 5. fire protection service; and 6. schools.B. All new development proposals for building permits, plats, short plats, urban planned developments, fully contained communities and binding site plans, that will be served by a sewer or water district, shall include a certificate of water availability and a certificate of sewer availability to demonstrate compliance with this chapter and other provisions of the King County Code, the King County Comprehensive Plan and the Growth Management Act.C. Regardless of the number of sequential permits required, the provisions of this chapter shall be applied only once to any single development proposal. If changes and modifications result in impacts not considered when the proposal was first approved, the county shall consider the revised proposal as a new development proposal. (Ord. 13694 § 91, 1999: Ord. 11621 § 83, 1994: Ord. 10870 § 512, 1993).21A.28.030 Adequate sewage disposal. All new development shall be served by an adequate public or private sewage disposal system, including both collection and treatment facilities as follows:A. A public sewage disposal system is adequate for a development proposal provided that: 1. For the issuance of a building permit, preliminary plat or short plat approval or other land use approval, the site of the proposed development is or can be served by an existing disposal system consistent with K.C.C. Title 13, and the disposal system has been approved by the department as being consistent with applicable state and local design and operating guidelines; 2. For the issuance of a certificate of occupancy for a building or change of use permit, the approved public sewage disposal system as set forth in subsection A.1. of this section is installed to serve each building or lot; 3. For recording a final plat, final short plat or binding site plan, the approved public sewage disposal system set forth in subsection A.1. of this section shall be installed to serve each lot respectively; or a bond or similar security shall be deposited with King County for the future installation of an adequate sewage disposal system. The bond may be assigned to a utility to assure the construction of the facilities within two years of recording; and 4. For a zone reclassification or urban planned development permit, the timing of installation of required sewerage improvements shall be contained in the approving ordinance as specified in K.C.C. 20.22.250; andB. A private individual sewage system is adequate, if an on-site sewage disposal system for each individual building or lot is installed to meet the requirements and standards of the department of public health as to lot size, soils and system design prior to issuance of a certificate of occupancy for a building or change of use permit. (Ord. 18230 § 129, 2016: Ord. 13625 § 20, 1999: Ord. 11621 § 84, 1994: Ord. 10870 § 513, 1993).21A.28.040 Adequate water supply. All new development shall be served by an adequate public or private water supply system as follows:A. A public water system is adequate for a development proposal only if: 1. For the issuance of a building permit, preliminary plat approval or other land use approval, the applicant demonstrates that the existing water supply system available to serve the site: a. complies with the applicable planning, operating and design requirements of: (1) chapters WAC 246-290 and 246-291; (2) K.C.C. chapters 14.42 and 14.44 and K.C.C. Title 17; (3) coordinated water system plans; (4) K.C.C. Titles 12 and 13 and other applicable rules of the King County board of health; (5) applicable rules of the Washington state Board of Health, Department of Health, Utilities and Transportation Commission and Department of Ecology; (6) applicable provisions of King County groundwater management plans and watershed plans; (7) applicable provisions of the King County Comprehensive Plan and development regulations; and (8) any limitation or condition imposed by the county-approved comprehensive plan of the water purveyor; b. The proposed improvements to an existing water system have been reviewed by the department and determined to comply with the design standards and conditions specified in subsection A.1.a. of this section; and c. A proposed new water supply system has been reviewed by the department and determined to comply with the design standards and conditions specified in subsection A.1.a. of this section; 2. Before issuance of a certificate of occupancy for a building or change of use permit, the approved public water system and any system improvements in subsection A.1. of this section are installed to serve each building or lot respectively; 3. For recording a final plat, final short plat or binding site plan, either the approved public water supply system or system improvements in subsection A.1. of this section are installed to serve each lot or a bond or similar security shall be deposited with King County and may be assigned to a purveyor to assure the construction of required water facilities in Group A systems as defined by board of health regulations, within two years of recording; and 4. For a zone reclassification or urban planned development permit, the timing of installation of required water system improvements is included in the approving ordinance as specified in K.C.C. 20.22.250.B. An on-site individual water system is adequate and the plat or short plat may receive preliminary and final approval, and a building or change of use permit may be issued as provided in K.C.C. 13.24.138 and 13.24.140. (Ord. 18230 § 130, 2016: Ord. 15032 § 36, 2004: Ord. 10870 § 514, 1993).21A.28.050 Surface water management. All new development shall be served by an adequate surface water management system as follows:A. The proposed system is adequate if the development proposal site is served by a surface water management system approved by the department as being consistent with the design, operating and procedural requirements of the King County Surface Water Design Manual and K.C.C. Title 9;B. For a subdivision, zone reclassification or urban planned development, the phased installation of required surface water management improvements shall be stated in the approving ordinance as specified in K.C.C. 20.22.250. Such phasing may require that a bond or similar security be deposited with King County; andC. A request for an adjustment of the requirements of the Surface Water Design Manual and K.C.C. Title 9 shall be reviewed in accordance with K.C.C. 9.04.050 and does not require a variance from this title unless relief is requested from a building height, setback, landscaping or other development standard in K.C.C. chapters 21A.12, 21A.14, 21A.16, 21A.18, 21A.20, 21A.22, 21A.24, 21A.26, 21A.28 and 21A.30. (Ord. 18230 § 131, 2016: Ord. 15051 § 212, 2004: Ord. 10870 § 515, 1993).21A.28.060 Adequate roads.A. All new development shall be served by adequate roads. Roads are adequate if the development's traffic impacts on surrounding public roads are acceptable under the level-of-service standards and the compliance procedures established in K.C.C. Title 14.B. The renewal of permits or the issuance of a new permit for existing uses constitutes a new development proposal only if it will generate additional traffic above that currently generated by the use.C. A variance request from the road cross-section or construction standards established by K.C.C. Title 14, Roads and Bridges, shall be reviewed as set forth in K.C.C. 14.42.060 and does not require a variance from this Title unless relief is requested from a building height, setback, landscaping or other development standard set forth in K.C.C. 21A.12 through K.C.C. 21A.30. (Ord. 11621 § 85, 1994: Ord. 10870 § 516, 1993).21A.28.120 Adequate vehicular access. All new development shall be served by adequate vehicular access as follows:A. The property upon which the development proposed is to be located has direct access to: 1. A public or private street that meets county road standards or is formally declared acceptable by the county road engineer; or 2. The property has access to such a street over a private driveway approved by the county;B. The proposed circulation system of a proposed subdivision, short subdivision or binding site plan shall intersect with existing and anticipated streets abutting the site at safe and convenient locations, as determined by the department and the county road engineer. Proposals for subdivisions or binding site plans resulting in thirty or more lots and a single vehicular entry point should consider provisions for secondary emergency vehicle access; andC. Every lot upon which one or more buildings is proposed to be erected or traffic generating use is proposed to be established, shall establish safe access as follows: 1. Safe passage from the street right-of-way to building entrances for transit patrons and other pedestrians, in accordance with the design standards set forth in K.C.C. chapter 21A.18; 2. Direct access from the street right-of-way, fire lane or a parking space to any part of the property as needed to provide public services in accordance with adopted standards (e.g. fire protection, emergency medical service, mail delivery or trash collection); and 3. Direct access from the street right-of-way, driveway, alley or other means of ingress/egress approved by King County, to all required off-street parking spaces on the premises. (Ord. 19146 § 72, 2020: Ord. 10870 § 522, 1993).21A.28.130 Adequate fire protection. All new development shall be served by adequate fire protection as follows:A. The site of the development proposed is served by a water supply system that provides at least minimum fire flow and a road system or fire lane system that provides life safety and rescue access, and other fire protection requirements for buildings as required by K.C.C. Titles 16 and 17;B. For a zone reclassification or urban planned development, the timing of installation of required fire protection improvements shall be stated in the approving ordinance as specified in K.C.C. 20.22.250, secured with a bond or similar security, and deposited with King County; andC. A variance request from the requirements established by K.C.C. Title 17, Fire Code, shall be reviewed in accordance with K.C.C. 17.08.090 or chapter 1 of the currently adopted edition of the International Fire Code and does not require a variance from this title unless relief is requested from a building height, setback, landscaping or other development standard in K.C.C. chapters 21A.12 through 21A.30. (Ord. 19485 § 208, 2022: Ord. 18230 § 131, 2016: Ord. 17837 § 90, 2014: Ord. 10870 § 523, 1993).21A.28.140 School concurrency - Applicability and relationship to fees.A. The school concurrency standard set out in Section 21A.28.160 shall apply to applications for preliminary plat or Urban Planned Development (UPD) approval, mobile home parks, requests for multifamily zoning, and building permits for multifamily housing projects which have not been previously evaluated for compliance with the concurrency standard.B. The county's finding of concurrency shall be made at the time of preliminary plat or UPD approval, at the time that a request to actualize potential multifamily zoning is approved, at the time a mobile home park site plan is approved, or prior to building permit issuance for multifamily housing projects which have not been previously established for compliance with the concurrency standard. Once such a finding has been made, the development shall be considered as vested for purposes of the concurrency determination.C. Excluded from the application of the concurrency standard are: 1. building permits for individual single family dwellings; 2. any form of housing exclusively for senior citizens, including nursing homes and retirement centers; 3. shelters for temporary placement, relocation facilities and transitional housing facilities.; 4. Replacement, reconstruction or remodeling of existing dwelling units; 5. Short subdivisions; 6. Building permits for residential units in preliminary planned unit developments which were under consideration by King County on January 22, 1991; 7. Building permits for residential units in recorded planned unit developments approved pursuant to K.C.C. Title 21 that have not yet expired per K.C.C. 21.56.060; 8. Building permits applied for by December 31, 1993, related to rezone applications to actualize potential zoning which were under consideration by King County on January 22, 1991; 9. Building permits applied for by December 31, 1993, related to residential development proposals for site plan review to fulfill P-Suffix requirements of multifamily zoning which were under consideration by King County on January 22, 1991; and 10. Any residential building permit for any development proposal for which a concurrency determination has already been made pursuant to the terms of K.C.C. Title 21A.D. All of the development activities which are excluded from the application of the concurrency standard are subject to school impact fees imposed pursuant to Title 27.E. The assessment and payment of impact fees are governed by and shall be subject to the provisions in K.C.C. Title 27 addressing school impact fees.F. A certification of concurrency for a school district shall not preclude the county from collecting impact fees for the district. Impact fees may be assessed and collected as long as the fees are used to fund capital and system improvements needed to serve the new development, and as long as the use of such fees is consistent with the requirements of Chapter 82.02 RCW and this chapter. Pursuant to Chapter 82.02 RCW, impact fees may also be used to recoup capital and system improvement costs previously incurred by a school district to the extent that new growth and development will be served by the previously constructed improvements or incurred costs. (Ord. 11621 § 87, 1994: 11157 § 25, 1993: Ord. 10870 § 524, 1993).21A.28.150 Findings, recommendations, and decisions regarding school capacities.A. In making a threshold determination pursuant to SEPA, the director and/or the hearing examiner, in the course of reviewing proposals for residential development including applications for plats or UPD's, mobile home parks, or multi-family zoning, and multifamily building permits, shall consider the school district's capital facilities plan as adopted by the council.B. Documentation which the district is required to submit pursuant to section 21A.28.152 or Title 20. shall be incorporated into the record in every case without requiring the district to offer such plans and data into the record. The school district is also authorized to present testimony and documents demonstrating a lack of concurrency in the district and the inability of the district to accommodate the students to be generated by a specific development.C. Based upon a finding that the impacts generated by the plat, the UPD, mobile home park or the multi-family development were generally not anticipated at the time of the last council review and approval of a school district capital plan and were not included in the district's long-range forecast, the director may require or recommend phasing or provision of the needed facilities and/or sites as appropriate to address the deficiency or deny or condition approval, consistent with the provisions of this chapter, the State Subdivision Act, and the State Environmental Policy Act.D. Determinations of the examiner or director regarding concurrency can be appealed only pursuant to the provisions for appeal of the development permit process for which the determination has been made. Where no other administrative appeal process is available, an appeal may be taken to the hearing examiner using the appeal procedures for variances. Any errors in the formula identified as a result of an appeal should be referred to the council for possible modifications.E. Where the council has not adopted an impact fee ordinance for a particular school district, the language of this section shall not affect the authority or duties of the examiner or the director pursuant to the State Environmental Policy Act or the State Subdivision Act. (Ord. 11621 § 88, 1994: 11157 § 26, 1993: Ord. 10870 § 525, 1993).21A.28.152 Submission of district capital facilities plan and data.A. On an annual basis, each school district shall submit the following materials to the School Technical Review Committee created pursuant to section 21A.28.154: 1. The district's capital facilities plan adopted by the school board which is consistent with the Growth Management Act. 2. The district's enrollment projections over the next six (6) years, its current enrollment and the district's enrollment projections and actual enrollment from the previous year. 3. The district's standard of service. 4. An inventory and evaluation of district facilities which address the district's standard of service. 5. The district's overall capacity over the next six (6) years, which shall be a function of the district's standard of service as measured by the number of students which can be housed in district facilities.B. To the extent that the district's standard of service reveals a deficiency in its current facilities, the district's capital facilities plan must demonstrate a plan for achieving the standard of service, and must identify the sources of funding for building or acquiring the necessary facilities to meet the standard of service.C. Facilities to meet future demand shall be designed to meet the adopted standards of service. If sufficient funding is not projected to be available to fully fund a capital plan which meets the standard of service, the district's capital plan should document the reason for the funding gap.D. If an impact fee ordinance has been adopted on behalf of a school district, the district shall also submit an annual report to the School Technical Review Committee showing the capital improvements which were financed in whole or in part by the impact fees. (Ord. 11621 § 89, 1994).21A.28.154 School technical review committee.A. There is hereby created a school technical review committee within King County. The committee shall consist of three county staff persons, one each from the department of local services, the office of performance, strategy and budget and the county council.B. The committee shall be charged with reviewing each school district's capital facilities plan, enrollment projections, standard of service, the district's overall capacity for the next six years to ensure consistency with the Growth Management Act, King County Comprehensive Plan and adopted community plans, and the district's calculation and rationale for proposed impact fees.C. Notice of the time and place of the committee meeting where the district's documents will be considered shall be provided to the district.D. At the meeting where the committee will review or act upon the district's documents, the district shall have the right to attend or to be represented, and shall be permitted to present testimony to the committee. Meetings shall also be open to the public.E. In its review, the committee shall consider the following factors: 1. Whether the district's forecasting system for enrollment projections has been demonstrated to be reliable and reasonable. 2. The historic levels of funding and voter support for bond issues in the district; 3. The inability of the district to obtain the anticipated state funding or to receive voter approval for district bond issues; 4. An emergency or emergencies in the district which required the closing of a school facility or facilities resulting in a sudden and unanticipated decline in districtwide capacity; and 5. The standards of service set by school districts in similar types of communities. While community differences will be permitted, the standard established by the district should be reasonably consistent with the standards set by other school districts in communities of similar socioeconomic profile; and 6. The standards identified by the state concerning the ratios of certificated instructional staff to students.F. In the event that the district's standard of service reveals a deficiency in its current facilities, the committee shall review the district's capital facilities plan to determine whether the district has identified all sources of funding necessary to achieve the standard of service.G. The district in developing the financing plan component of the capital facilities plan shall plan on a six-year horizon and shall demonstrate its best efforts by taking the following steps: 1. Establish a six-year financing plan, and propose the necessary bond issues and levies required by and consistent with that plan and as approved by the school board and consistent with RCW 28A.53.020, 84.52.052 and 84.52.056, as amended; and 2. Apply to the state for funding, and comply with the state requirement for eligibility to the best of the district's ability.H. The committee is authorized to request the school district to review and to resubmit its capital facilities plan, or to establish a different standard of service, or to review its capacity for accommodating new students, under the following circumstances: 1. The standard of service established by the district is not reasonable in light of the factors set forth in subsection E. of this section. 2. The committee finds that the district's standard of service cannot reasonably be achieved in light of the secured financial commitments and the historic levels of support in the district; or 3. Any other basis that is consistent with this section.I. If a school district fails to submit its capital facilities plan for review by the committee, King County shall assume the district has adequate capacity to accommodate growth for the following six years.J. The committee shall submit copies of its recommendation of concurrency for each school district to the director, to the hearing examiner and to the district.K. The committee shall recommend to the council a Comprehensive Plan amendment adopting the district's capital facilities plan as part of the Comprehensive Plan, for any plan which the committee concludes accurately reflects the district's facilities status.L. In the event that after reviewing the district's capital facilities plan and other documents, the committee is unable to recommend certifying concurrency in a school district, the committee shall submit a statement to the council, the director and the hearing examiner stating that the committee is unable to recommend certifying concurrency in a specific school district. The committee shall recommend to the executive that the executive propose to the council, amendments to the land use element of the King County Comprehensive Plan or amendments to the development regulations implementing the plan to more closely conform county land use plans and school facilities plans, including but not limited to requiring mandatory phasing of plats, UPDs or multifamily development located within the district's boundary. The necessary draft amendments shall accompany such recommendations. (Ord. 19200 § 5, 2020: Ord. 18791 § 179, 2018: Ord. 18683 § 56, 2018: Ord. 18635 § 32, 2017: Ord. 17420 § 109, 2012: Ord. 16267 § 62, 2008: Ord. 11621 § 90, 1994).21A.28.156 Annual council certification and review.A. On at least an annual basis, the King County council shall certify the district's plans. The review may occur in conjunction with any update of the Facilities and Services chapter of the King County Comprehensive Plan proposed by the school technical review committee.B. The council shall review and consider any proposal or proposals submitted by the committee for amending the land use policies of the King County Comprehensive Plan, or the development regulations implementing the plan, including but not limited to requiring mandatory phasing of plats, UPDs or multifamily development when the committee is unable to recommend a certification of concurrency in a specific school district. Any proposed amendments to the comprehensive plan or development regulations shall be subject to the public hearing and other procedural requirements set out in K.C.C. Title 20 or 21A, as applicable.C. The council may require the committee to submit proposed amendments or may itself initiate amendments to the land use policies of the King County Comprehensive Plan, or amendments to the development regulations implementing the plan. (Ord. 18635 § 33, 2017: Ord. 11621 § 91, 1994).21A.28.160 School concurrency standard.A. Schools shall be considered to have been provided concurrently with the development which will impact the schools if: 1. The permanent and interim improvements necessary to serve the development are planned to be in place at the time the impacts of development are expected to occur; or 2. The necessary financial commitments are in place to assure the completion of the needed improvements to meet the district's standard of service within 3 years of the time that the impacts of development are expected to occur. Necessary improvements are those facilities identified by the district in its capital facilities plan as reviewed and adopted by King County.B. Any combination of the following shall constitute the "necessary financial commitments" for the purposes of subsection A. 1. The district has received voter approval of and/or has bonding authority; 2. The district has received approval for federal, state, or other funds; 3. The district has received a secured commitment from a developer that the developer will construct the needed permanent school facility, and the school district has found such facility to be acceptable and consistent with its capital facilities plan; and/or 4. The district has other assured funding, including but not limited to school impact fees which have been paid.C. Compliance with this concurrency requirement of this section shall be sufficient to satisfy the provisions of RCW 58.17.060 and RCW 58.17.110. (Ord. 10870 § 526, 1993).21A.28.180 Credit for improvements. Whenever a development is granted approval subject to a condition that the development proponent actually provide a school facility acceptable to the district, the development proponent shall be entitled to a credit for the actual cost of providing the facility, against the fee that would be chargeable under the formula provided by K.C.C. Title 27. The cost of construction shall be estimated at the time of approval, but must be documented and the documentation confirmed after the construction is completed to assure that an accurate credit amount is provided. If construction costs are less than the calculated fee amount, the difference remaining shall be chargeable as a school impact fee. (Ord. 10870 § 528, 1993).21A.30DEVELOPMENT STANDARDS - ANIMALS, HOME OCCUPATION, HOME INDUSTRYSections:21A.30.010Purpose.21A.30.020Animal regulations - small animals.21A.30.030Animal regulations - livestock - purpose.21A.30.040Animal regulations -- livestock - densities.21A.30.045Animal regulations — livestock management components of farm management plans.21A.30.060Animal regulations - livestock - management standards.21A.30.062Animal regulations - livestock - building requirements.21A.30.064Animal regulations - livestock - livestock regulation implementation and monitoring - agriculture commission livestock committee.21A.30.066Animal regulations - livestock - education and enforcement.21A.30.067Livestock management - information.21A.30.068Livestock management - waste disposal.21A.30.075Livestock interdisciplinary teams.21A.30.080Home occupation in the R and UR zones.21A.30.085Home occupations in the A, F and RA zones.21A.30.090Home industry.21A.30.010 Purpose. The purpose of this chapter is to enhance and preserve the compatibility between neighboring properties by regulating the scope and intensity of accessory uses or activities. (Ord. 10870 § 529, 1993).21A.30.020 Animal regulations - small animals. The raising, keeping, breeding or boarding of small animals are subject to K.C.C. chapter 11.04, King County Board of Health Code chapter 8.03 and the following requirements:A.1. Small animals that are kept as household pets in a dwelling unit in aquariums, terrariums, cages or similar containers shall not be limited in number, except as otherwise provided in King County Board of Health Code chapter 8.03 or K.C.C. Title 11. 2. Except as otherwise allowed for a facility licensed under King County Board of Health Code chapter 8.03 or K.C.C. chapter 11.04, other small animals, excluding altered cats, kept as household pets in a dwelling unit shall be limited to five. 3. Altered cats kept as household pets in a dwelling unit shall not be limited in numbers.B.1. Except as otherwise provided in subsection E. of this section, the number of small animals kept outside a dwelling unit shall be limited as follows: a. on sites of less than twenty thousand square feet, three per dwelling unit; b. on sites of between twenty thousand and thirty-five thousand square feet, five per dwelling unit; and c. on sites greater than thirty-five thousand square feet, one additional small animal per dwelling unit for each one-half acre of site area over thirty-five thousand square feet up to a maximum of twenty. 2. Unaltered animals kept outdoors must be kept on a leash or in a confined area, except as otherwise allowed under K.C.C. chapter 11.04 for a hobby kennel, hobby cattery or under King County Board of Health Code chapter 8.03 for a commercial kennel or commercial cattery.C. Unless otherwise allowed for a facility licensed under King County Board of Health Code chapter 8.03 or K.C.C. chapter 11.04, the total number of unaltered adult cats and dogs per dwelling unit shall not exceed three.D. Small animals considered to be household pets shall be treated as other small animals under subsection E. of this section when they are kept for breeding, boarding or training.E. Small animals kept outside the dwelling unit for breeding, boarding or training as an accessory use of a resident the dwelling unit are allowed, subject to the following limitations: 1. Birds shall be kept in an aviary or loft that meets the following standards: a. The aviary or loft shall provide one-half square foot for each parakeet, canary or similarly sized birds, one square foot for each pigeon, small parrot or similarly sized bird and two square feet for each large parrot, macaw or similarly sized bird; b. Aviaries or lofts shall not exceed two thousand square feet, provided this limit shall not apply in rural, forestry or agricultural zones; and c. The aviary is set back at least ten feet from any property line, and twenty feet from any dwelling unit. 2. Small animals other than birds shall be kept according to the following standards: a. The minimum site area shall be one-half acre if more than three small animals are being kept; b. All animals shall be confined within a building, pen, aviary or similar structure; c. Any covered structure used to house or contain such animals shall maintain a distance of not less than ten feet to any property line, except structures used to house mink and fox shall be a distance of not less than one hundred fifty feet. d. Poultry, chicken, squab, and rabbits are limited to a maximum of one animal per one square foot of structure used to house such animals, up to a maximum of two thousand square feet. This maximum structure size limit shall not apply in rural area, forestry, or agricultural zones; e. Hamsters, nutria and chinchilla are limited to a maximum of one animal per square foot of structure used to house such animals, up to a maximum of two thousand square feet;. This maximum structure size limit shall not apply in rural, forestry or agricultural zones f. Mink and fox are permitted only on sites having a minimum area of five acres. g. Beekeeping is limited as follows: (1) Beehives are limited to fifty on sites less than five acres; (2) The number of beehives shall not be limited on sites of five acres or greater; (3) Colonies shall be maintained in movable-frame hives at all times; (4) Adequate space shall be provided in each hive to prevent overcrowding and swarming; (5) Colonies shall be requeened following any swarming or aggressive behavior; (6) All colonies shall be registered with the county extension agent before April 1 of each year, on a state registration form acceptable to the county; and (7) Abandoned colonies, diseased bees, or bees living in trees, buildings, or any other space except in movable-frame hives shall constitute a public nuisance, and shall be abated as set forth in K.C.C. chapter 21A.50; 3. Hobby kennels and hobby catteries are subject to the following requirements: a. For hobby kennels located on resource rural area or residential zoned sites: (1) The minimum site area shall be five acres; and (2) Structures housing animals and outdoor animal runs shall be a minimum distance of one hundred feet from property lines abutting the resource, rural area or residential zones; b. For hobby kennels located on nonresidential zoned sites, run areas shall be completely surrounded by an eight foot solid wall or fence, and be subject to the requirements in K.C.C. 11.04.060; and c. Hobby catteries shall be on sites of thirty-five thousand square feet or more, and buildings used to house cats shall be a minimum distance of fifty feet from property lines abutting the rural area zone or residential zones.F. Commercial kennels and commercial catteries are subject to the following requirements: 1. For commercial kennels located on resource, rural area, or residential zoned sites: a. The minimum site area shall be five acres; and b. Structures housing animals and outdoor animal runs shall be a minimum distance of one hundred feet from property lines abutting the resource, rural area or residential zones; 2. For commercial kennels located on nonresidential zoned sites, run areas shall be completely surrounded by an eight foot solid wall or fence, and be subject to the requirements in King County Board of Health Code chapter 8.03; and 3. Commercial catteries shall be on sites of thirty-five thousand square feet or more, and buildings used to house cats shall be a minimum distance of fifty feet from property lines abutting the rural area or residential zones. (Ord. 17841 § 48, 2014: Ord. 17539 § 59, 2013: Ord. 14429 § 5, 2002: Ord. 11157 § 27, 1993: Ord. 10870 § 530, 1993).21A.30.030 Animal regulations - livestock - purpose. The primary purpose of sections 21A.30.040 - .075 is to support the raising and keeping of livestock in the county in a manner that minimizes the adverse impacts of livestock on the environment particularly with regard to their impacts on water quality and salmonid fisheries habitat in King County watersheds. Maintaining and enhancing the viability of fisheries, livestock-raising and farming are essential to the long-term economic vitality, recreation opportunities and quality of life in rural and resource lands of King County. The following sections establish regulations which set livestock densities and require implementation of best management practices for minimizing non-point pollution from livestock in a manner that recognizes the need for integrated resource management within King County watersheds. They are intended to be consistent with livestock welfare; however, these concerns are more appropriately addressed through K.C.C. 11.04. (Ord. 11168 § 1, 1993).21A.30.040 Animal regulations — livestock — densities. The raising, keeping, breeding or fee boarding of livestock are subject to K.C.C. chapter 11.04, Animal Control Regulations, and the following requirements:A. The minimum lot size on which large livestock may be kept shall be 20,000 square feet, provided that the amount of site area available for use by the livestock may be less than 20,000 square feet and provided further that the portion of the total lot area used for confinement or grazing meets the requirements of this section.B.1. The maximum number of livestock shall be as follows: a. Commercial dairy farms shall meet the requirements of chapter 90.64 RCW or a livestock management component of a farm management plan adopted in accordance with K.C.C. 21A.30.045; b. Six resident animal units per gross acre in stables, barns and other livestock operations with covered confinement areas, if no more than three animal units per gross acre are allowed to use uncovered grazing or confinement areas on a full time basis, and the standards in K.C.C. 21A.30.060 are met or a livestock management component of a farm management plan is implemented and maintained in accordance with K.C.C. 21A.30.045. Higher densities may be allowed subject to the conditional use permit process to confirm compliance with the management standards. The conditional use permit process is not required for existing operations that operate with higher densities, in accordance with K.C.C. 21A.30.060 or a livestock management component of a farm management plan is implemented for those operations; c. Three animal units per gross acre of vegetated site area, if the standards in K.C.C. 21A.30.060 are met or livestock management component of a farm management plan is implemented and maintained in accordance with K.C.C. 21A.30.045; and d. One animal unit per two acres of vegetated area, not to exceed a total of five animal units, if the standards for storage and handling of manure in K.C.C. 21A.30.060.D. are met. 2. For purposes of this section, an animal unit consists of one adult horse or bovine, two ponies, five small livestock or equivalent thereof excluding sucklings. Miniature horses and feeder calves up to one year of age are considered small livestock. (Ord. 15051 § 213, 2004: Ord. 11168 § 2, 1993: Ord. 11157 § 28, 1993: Ord. 10870 § 532, 1993).21A.30.045 Animal regulations — livestock management components of farm management plans.A. To achieve the maximum density allowances using a livestock management component of a farm management plan, the plan must meet the following criteria: 1. The plan is developed as part of a program authorized or approved by King County. Certified Washington state Department of Ecology nutrient management plans that are consistent with all of the criteria of this section may substitute for a livestock management component of a farm management plan for commercial dairy farms. Commercial dairy farms that do not have approved nutrient management plans must meet the requirements of K.C.C 21A.30.060; 2. The plan includes site-specific management measures for minimizing nonpoint pollution from agricultural activities and for managing wetland and aquatic areas including, but not limited to: a. livestock watering; b. grazing and pasture management; c. confinement area management; d. manure management; and e. exclusion of animals from aquatic areas and their buffers and wetlands and their buffers with the exception of grazed wet meadows. 3. The plan is implemented within a timeframe established in the plan and maintained so that nonpoint pollution attributable to livestock-keeping is minimized; and 4. A monitoring plan may be required as part of the livestock management component of a farm management plan to demonstrate that there is no significant impact to water quality and salmonid fisheries habitat. Monitoring results shall be available to the King County agriculture program.B. The livestock management component of a farm management plan shall, at a minimum: 1. Generally seek to achieve a twenty-five-foot buffer of diverse, mature vegetation between grazing areas and the ordinary high water mark of all type S and F aquatic areas and the wetland edge of any category I, II or III wetland with the exception of grazed wet meadows, using buffer averaging where necessary to accommodate existing structures. The livestock management component of a farm management plans may vary the width of the buffer of an aquatic area or wetland, and the time and duration of animal exclusion throughout the year, according to guidelines agreed upon by King County and the King Conservation District. The guidelines may support a different buffer width based on both the nature of the farm operation and the function and sensitivity of the aquatic area or wetland. The plan must include best management practices that avoid having manure accumulate in or within ten feet of type N or O waters. Forested lands being cleared for grazing areas shall comply with the critical area buffers in K.C.C. chapter 21A.24; 2. Assure that drainage ditches on the site do not channel animal waste to aquatic areas and wetlands; 3. Achieve an additional twenty-foot buffer downslope of any confinement areas within two hundred feet of type S and F waters. This requirement may be waived for existing confinement areas on lots of two and one-half acres or less in size if: a. a minimum buffer of twenty-five feet of diverse, mature vegetation is achieved; b. manure within the confinement area is removed daily during the winter season from October 15 to April 15, and stored in accordance with K.C.C. 21A.30.060.D.; and c. additional best management practices, as recommended by the King Conservation District, are implemented and maintained; and 4. Include a schedule for implementation.C. Any deviation from the manure management standards must be addressed in a livestock management component of a farm management plan.D. A copy of the final plans shall be submitted to the department of natural resources and parks within sixty days of completion.E. The farm management plan approved by the department of natural resources and parks may be appealed to the hearing examiner in accordance with K.C.C. 20.22.040 and 20.22.080. Appeals may be filed only by the property owner or four members of the King County agriculture commission. Any farm management plan not appealed shall constitute prima facie evidence of compliance with the regulatory provisions of K.C.C. 9.12.035. (Ord. 18230 § 133, 2016: Ord. 15051 § 214, 2004: Ord. 14199 § 235, 2001: Ord. 11168 § 3, 1993).21A.30.060 Animal regulations — livestock management standards. Property owners with farms containing either large livestock at densities greater than one animal unit per two acres, or small livestock at densities greater than five animals per acre, or both, are not required to follow an livestock management plan if the owners adhere to the management standards in subsections A. through G. of this section. This section applies only if farm practices do not result in violation of any federal, state or local water quality standards.A. To minimize livestock access to aquatic areas, property owners shall utilize the following livestock watering options: 1. The preferred option, which is a domestic water supply, stock watering pond, roof runoff collection system, or approved pumped supply from the aquatic areas so that livestock are not required to enter aquatic areas for their water supply. 2. Livestock access to type S and F waters, including their buffers shall be limited to crossing and watering points that have been addressed by a crossing or watering point plan designed to Natural Resource Conservation Services or King Conservation District specifications that prevent free access along the length of the aquatic areas. a. Fencing shall be used as necessary to prevent livestock access to type S and F waters. b. Bridges may be used, in accordance with K.C.C. chapter 21A.24, in lieu of crossings. Piers and abutments shall not be placed within the ordinary high water mark or top-of-bank, whichever is greater. Bridges shall be designed to allow free flow of flood waters and shall not diminish flood carrying capacity. These bridges may be placed without a county building permit, but the permit waiver shall not constitute any assumption of liability by the county with regard to such bridge or its placement. The waiver of county building permit requirements does not constitute a waiver from other required agency permits.B. Existing grazing areas not addressed by K.C.C. chapter 21A.24 shall maintain a vegetative buffer of fifty feet from the wetland edge of a category I, II or III wetland, except those wetlands meeting the definition of grazed wet meadows, or the ordinary high water mark of a type S or F water. 2. Forested lands being cleared for grazing areas shall comply with critical area buffers in K.C.C. chapter 21A.24. 3. The grazing area buffer may be reduced to twenty-five feet where a twenty-five-foot buffer of diverse, mature vegetation already exists. This buffer reduction may not be used when forested lands are being cleared for grazing areas. 4. Fencing shall be used to establish and maintain the buffer unless the buffer is otherwise impenetrable to livestock. 5. Fencing installed in accordance with the 1990 Sensitive Area Ordinance before February 14, 1994, at setbacks other than those specified in subsection B.1. and 2. of this section shall be deemed to constitute compliance with those requirements. 6. Grazing areas within two hundred feet of a type S or F water or category I, II or III wetland shall not be plowed during the rainy season from October 1 through April 30. 7. Grazing areas may extend to the property line, provided that type S or F waters and category I, II and III wetlands adjacent to the property line are buffered in accordance with subsection B.1., 2. or 3. of this section.C.1. In addition to the buffers in subsection B.1. and 2. of this section, confinement areas located within two hundred feet of any type S or F waters or category I, II or III, wetlands with the exception of grazed wet meadows shall: a. have a twenty-foot-wide vegetative filter strip downhill from the confinement area, consisting of heavy grasses or other ground cover with high stem density and that may also include tree cover; b. not be located in the buffer of any type S or F water or any wetland buffer required by the critical areas ordinance in effect at the time the confinement area is built, or within fifty feet of the wetland edge of any category I, II or III wetland or the ordinary high water mark of any type S or F water. Fencing shall be used to establish and maintain the buffer except where existing natural vegetation is sufficient to exclude livestock from the buffer. Existing confinement areas that do not meet these requirements shall be modified as necessary to provide the buffers specified in this section within five years of January 1, 2005, though the footprint of existing buildings need not be so modified; and c. have roof drains of any buildings in the confinement area diverted away from the confinement area. 2. Confinement areas may extend to the property line, if aquatic areas and wetlands adjacent to the property line are buffered in accordance with K.C.C. this subsection C. of this section.D.1. Manure storage areas shall be managed as follows: a. Surface flows and roof runoff shall be diverted away from manure storage areas; b. All manure stockpiled within two hundred feet uphill of any the ordinary high water mark of a type S or F water or the edge of a category I, II or III wetland shall either be covered in a manner that excludes precipitation and allows free flow of air to minimize fire danger or be placed in an uncovered concrete bunker or manure lagoon or held for pickup in a dumpster, vehicle or other facility designed to prevent leachate from reaching any aquatic area or wetland. Concrete bunkers shall be monitored quarterly for the first two years after installation, then annually unless problems were identified in the first two years, in which case quarterly monitoring shall continue and appropriate adjustments shall be made; c. Manure shall not be stored in any aquatic area buffer or wetland buffer, with the exception of grazed or tilled wet meadows unless there is no other alternative on the property. Manure shall be stored in a location that avoids having runoff from the manure enter aquatic areas or wetlands. Manure piles shall not be closer than one hundred feet uphill from: (1) any wetland edge excluding grazed or tilled wet meadows; (2) the ordinary high water mark of any aquatic area; or (3) any ditch to which the topography would generally direct runoff from the manure; and d. The location may be reduced to no closer than fifty feet if the manure pile is part of an active compost system that is located on an impervious surface to prevent contact with the soil and includes a leachate containment system. 2. Manure shall be spread on fields only during the growing season, and not on saturated or frozen fields.E. For purposes of this section, "buffer maintenance" means allowing vegetation in the buffer that provides shade for the aquatic area or acts as a filter for storm water entering the aquatic area, other than noxious weeds, to grow to its mature height, though grasses in the buffer may be mowed but not grazed. Grading in the buffer is allowed only for establishment of watering and crossing points, or for other activities permitted in accordance with K.C.C. chapter 21A.24, with the appropriate permits.F. Properties that have existing fencing already installed at distances other than those specified in these standards, and for which livestock management farm plans have been developed based on the existing fencing locations, shall be deemed to be in compliance with the fencing requirements of these standards. Properties with or without a livestock management component of a farm management plan that complied with the fencing requirements in effect before January 1, 2005, shall have five years from January 1, 2005, to meet the fencing requirements for aquatic areas that were exempt from fencing under ordinances in effect before January 1, 2005.G. Buffer areas shall not be subject to public access, use or dedication by reason of the establishment of such buffers. (Ord. 15051 § 215, 2004: Ord. 12786 § 4, 1997: Ord. 11168 § 4, 1993: Ord. 10870 § 534, 1993).21A.30.062 Animal regulations - livestock - building requirements.A. In the rural area and residential zones, fee boarding of livestock other than in a legally established stable shall only be as an accessory use to a resident on the subject property. B. A barn or stable may contain a caretaker's accessory living quarters under the following conditions: 1. Only one accessory living quarter per primary detached dwelling unit, except in the F zone, where accessory living quarters are not permitted; 2. The accessory living quarter shall not exceed five hundred square feet, and 3. The structure must be constructed in conformance with the State Building Code; and C. A barn or stable may contain a caretaker’s accessory dwelling unit as allowed pursuant to this provisions of this Title relating to accessory dwelling units. (Ord. 17539 § 60, 2013: Ord. 14045 § 55, 2001: Ord. 12786 § 5, 1997: Ord. 11168 § 5, 1993).21A.30.064 Animal regulations - livestock - livestock regulation implementation and monitoring - agriculture commission livestock committee.A. In order to evaluate the effectiveness of county livestock regulations, the King County agriculture commission shall appoint an Agriculture Commission Livestock Committee to evaluate emerging livestock husbandry issues to recommend appropriate policies, regulations and support programs.B. The King County agriculture commission shall: 1. Evaluate the effectiveness of farm management plans and management standards, including but not limited to the need for implementation assistance funding, education and monitoring, as provided for in this section; 2. Review the recommendations of the livestock committee and the livestock interdisciplinary team when formulating proposals to ensure that goals of this legislation are being met; 3. Provide a link between government experts and the livestock owners who must implement this legislation; 4. Certify the use of experts to prepare farm management plans, if a property owner chooses not to work with the King Conservation District; and 5. Provide recommendations and guidance as necessary to the King County agriculture commission on livestock issues in regards to duties assigned to the Agriculture Commission.C. The livestock committee may make recommendations to the King County agriculture commission regarding the need for additional funding mechanisms to support implementation of livestock management practices, and livestock waste management solutions.D. King County shall utilize as high a percentage of any funds available as possible to provide cost-sharing assistance to farmers in implementation of farm management plans (per K.C.C. 21A.30.050). Assistance to farmers should be allocated to encourage early implementation, by providing greater support to farmers who participate in the first years of the program, and less support in the out years. If follow-up monitoring or a complaint indicates that enforcement procedures are required, and it is determined that farm management plans have not been implemented, funding will be withdrawn and repayment required.E. Monitoring is a critical element in the evaluation of the effectiveness of farm management practices in minimizing non-point pollution in streams and wetlands. As such, the department of natural resources and parks shall develop and implement a management practice monitoring strategy to identify emerging trends and implementation issues.F. King County shall utilize a percentage of any funds raised by one of the mechanisms developed pursuant to this section to monitor farm management plans and management standards, to provide information regarding the efficacy of the management measures being implemented. This information shall be used to demonstrate the value of such plans to other farmers, and shall be reported to the King County agriculture commission, for use in development of improved standards for the livestock density legislation. (Ord. 14199 § 236, 2001: Ord. 11168 § 6-8, 1993).21A.30.066 Animal regulations - livestock - education and enforcement.A. Enforcement of these livestock standards shall initially emphasize achieving compliance with the standards as the primary objective, rather than the collection of fines or penalties. Fines or penalties are appropriate when a property owner or livestock operator has been advised of necessary corrective actions, and has not made those corrections. Where violations of the standards do occur, and such violations are directly linked to identified hazards or the discharge of prohibited contaminants, as enumerated in K.C.C. 9.12.025, code enforcement must emphasize immediate correction of the practices resulting in the hazard or prohibited discharge.B. Both the property owner and any renter or lessee of the property, hereinafter referred to "livestock operator," shall be held responsible for compliance with these standards.C. Establishment and adherence to a farm management plan as allowed by K.C.C. 21A.30.050 or the management standards provided by K.C.C. 21A.30.060 shall be prima facie proof of compliance with the regulatory provisions of K.C.C. 9.12.035.D. The department of local services, permitting division, shall be responsible for enforcement of the standards set out in this chapter. The surface water management division shall be responsible for enforcement of water quality violations pursuant to K.C.C. chapter 9.12 for prohibited discharges and hazards. If a specific standard identified in this chapter is not being adhered to, the operator and owner shall be given notice of non-compliance. The notice shall specify what actions must be taken to bring the property into compliance. The operator and owner shall be given forty-five days in which to adhere to the management standards of K.C.C. 21A.30.060, or establish a farm management plan pursuant to K.C.C. 21A.30.050 as the owner and/or livestock operator may elect for the purpose of compliance. Should the owner and/or livestock operator fail to bring the property into compliance with the standards, the county, after notice, may commence abatement proceedings and impose civil fines thirty days thereafter, to the extent necessary for compliance. Thereafter, upon exhaustion of any appeals, failure of the operator and owner to comply with any continuing order to abate, the operator and owner shall be subject to civil and criminal penalties, and other procedures, as set forth in this title and K.C.C. Title 23. (Ord. 18791 § 180, 2018: Ord. 17420 § 110, 2012: Ord. 11168 § 9, 1993).21A.30.067 Livestock management - Information. Within 180 days of adoption of Ordinance 11168, King County shall publish and distribute information packets to all affected property owners, describing the ordinance in detail. In particular, the information packets shall outline what will be expected of King County residents who maintain livestock, including timelines, funding sources, and phone numbers and addresses of resource agencies. (Ord. 11168 § 10, 1993).21A.30.068 Livestock management - waste disposal. Within 180 days of adoption of Ordinance 11168, the solid waste division shall develop a pilot program to investigate potential markets for livestock waste from both commercial and non-commercial operations including, but not limited to, as a replacement to chemical fertilizers in King County parks (flowerbeds and fields); for use in commercial silviculture and nursery operations; for use on private property (similar to Woodland Park Zoo's "Zoodoo" program); and for use in publicly or privately operated composting stations. (Ord. 11168 § 11, 1993). 21A.30.075 Livestock interdisciplinary team. In order to ensure that livestock standards and management plans are customized as much as possible to the stream conditions in each of the various streams, the King County agriculture commission will, in cooperation with the Washington State Department of Fisheries and the Muckleshoot Indian Tribe, the Snoqualmie Indian Tribe, and other affected Indian tribes, establish a livestock interdisciplinary team consisting of three members, with expertise in fisheries, water quality and animal husbandry, to make specific recommendations to the Conservation District and livestock owners adjacent to the streams with regard to buffer needs throughout the parts of each stream which have livestock operations adjoining such streams. The team shall take into account the recommendations of the adopted Basin Plans and WRIA recommendations, and shall work with the department of natural resources and parks to develop the recommendations. The findings of the interdisciplinary team shall be reported to the King County agriculture commission, which shall assist in the dissemination of the recommendations to owners in the basin. The team shall work initially on those stream systems in which specific problems have been identified and are believed to be livestock related: (Ord. 14199 § 237, 2001: Ord. 11168 § 14, 1993).21A.30.080 Home occupation in the R and UR zones. In the R, UR, NB, CB and RB zones, residents of a dwelling unit may conduct one or more home occupations as accessory activities, only if:A. The total floor area of the dwelling unit devoted to all home occupations shall not exceed twenty percent of the floor area of the dwelling unit.B. Areas within garages and storage buildings shall not be considered part of the dwelling unit and may be used for activities associated with the home occupation;C. All the activities of the home occupation or occupations shall be conducted indoors, except for those related to growing or storing of plants used by the home occupation or occupations;D. A home occupation or occupations is not limited in the number of employees that remain off-site. No more than one nonresident employee shall be permitted to work on-site for the home occupation or occupations;E. The following uses, by the nature of their operation or investment, tend to increase beyond the limits permitted for home occupations. Therefore, the following shall not be permitted as home occupations: 1. Automobile, truck and heavy equipment repair; 2. Auto body work or painting; 3. Parking and storage of heavy equipment; 4. Storage of building materials for use on other properties; 5. Hotels, motels or organizational lodging; 6. Dry cleaning; 7. Towing services; 8. Trucking, storage or self service, except for parking or storage of one commercial vehicle used in home occupation; 9. Veterinary clinic; 10. Recreational marijuana processor, recreational marijuana producer or recreational marijuana retailer; and 11. Winery, brewery, distillery facility I, II and III, and remote tasting room, except that home occupation adult beverage businesses operating under an active Washington state Liquor and Cannabis Board production license issued for their current location before December 31, 2019, and where King County did not object to the location during the Washington state Liquor and Cannabis Board license application process, shall be considered legally nonconforming and allowed to remain in their current location subject to K.C.C. 21A.32.020 through 21A.32.075 if the use is in compliance with this section as of December 31, 2019. Such nonconforming businesses shall remain subject to all other requirements of this section and other applicable state and local regulations. The resident operator of a nonconforming winery, brewery or distillery home occupation shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74;F. In addition to required parking for the dwelling unit, on-site parking is provided as follows: 1. One stall for each nonresident employed by the home occupations; and 2. One stall for patrons when services are rendered on-site;G. Sales are limited to: 1. Mail order sales; 2. Telephone, Internet or other electronic commerce sales with off-site delivery; and 3. Items accessory to a service provided to patrons who receive services on the premises;H. On-site services to patrons are arranged by appointment;I. The home occupation or occupations use or store a vehicle for pickup of materials used by the home occupation or occupations or the distribution of products from the site, only if: 1. No more than one such a vehicle is allowed; and 2. The vehicle is not stored within any required setback areas of the lot or on adjacent streets; and 3. The vehicle does not exceed an equivalent licensed gross vehicle weight of one ton;J. The home occupation or occupations do not: 1. Use electrical or mechanical equipment that results in a change to the occupancy type of the structure or structures used for the home occupation or occupations; or 2. Cause visual or audible interference in radio or television receivers, or electronic equipment located off-premises or fluctuations in line voltage off-premises;K. There shall be no exterior evidence of a home occupation, other than growing or storing of plants under subsection C. of this section or a permitted sign, that would cause the premises to differ from its residential character. Exterior evidence includes, but is not limited to, lighting, the generation or emission of noise, fumes or vibrations as determined by using normal senses from any lot line or on average increase vehicular traffic by more than four additional vehicles at any given time;L. Customer visits and deliveries shall be limited to the hours of 8:00 a.m. to 7:00 p.m. on weekdays, and 9:00 a.m. to 5:00 p.m. on weekends; andM. Uses not allowed as home occupations may be allowed as a home industry under K.C.C. 21A.30.090. (Ord. 19030 § 21, 2019: Ord. 17710 § 10, 2013: Ord. 17191 § 47, 2011: Ord. 15606 § 19, 2006: Ord. 15032 § 37, 2004: Ord. 11621 § 93, 1994: Ord. 10870 § 536, 1993).21A.30.085 Home occupations in the A, F and RA zones. In the A, F and RA zones, residents of a dwelling unit may conduct one or more home occupations as accessory activities, under the following provisions:A. The total floor area of the dwelling unit devoted to all home occupations shall not exceed twenty percent of the dwelling unit.B. Areas within garages and storage buildings shall not be considered part of the dwelling unit and may be used for activities associated with the home occupation;C. Total outdoor area of all home occupations shall be permitted as follows: 1. For any lot less than one acre: Four hundred forty square feet; and 2. For lots one acre or greater: One percent of the area of the lot, up to a maximum of five thousand square feet.D. Outdoor storage areas and parking areas related to home occupations shall be: 1. No less than twenty-five feet from any property line; and 2. Screened along the portions of such areas that can be seen from an adjacent parcel or roadway by the: a. planting of Type II landscape buffering; or b. use of existing vegetation that meets or can be augmented with additional plantings to meet the intent of Type II landscaping;E. A home occupation or occupations is not limited in the number of employees that remain off-site. Regardless of the number of home occupations, the number of nonresident employees is limited to no more than three who work on-site at the same time and no more than three who report to the site but primarily provide services off-site;F. In addition to required parking for the dwelling unit, on-site parking is provided as follows: 1. One stall for each nonresident employed on-site; and 2. One stall for patrons when services are rendered on-site;G. Sales are limited to: 1. Mail order sales; 2. Telephone, Internet or other electronic commerce sales with off-site delivery; 3. Items accessory to a service provided to patrons who receive services on the premises; 4. Items grown, produced or fabricated on-site; and 5. On sites five acres or larger, items that support agriculture, equestrian or forestry uses except for the following: a. motor vehicles and parts (North American Industrial Classification System ("NAICS" Code 441); b. electronics and appliances (NAICS Code 443); and c. building material and garden equipments and supplies (NAICS Code 444);H. The home occupation or occupations do not: 1. Use electrical or mechanical equipment that results in a change to the occupancy type of the structure or structures used for the home occupation or occupations; 2. Cause visual or audible interference in radio or television receivers, or electronic equipment located off-premises or fluctuations in line voltage off-premises; or 3. Increase average vehicular traffic by more than four additional vehicles at any given time;I. Customer visits and deliveries shall be limited to the hours of 8:00 a.m. to 7:00 p.m. on weekdays, and 9:00 a.m. to 5:00 p.m. on weekends;J. The following uses, by the nature of their operation or investment, tend to increase beyond the limits permitted for home occupations. Therefore, the following shall not be permitted as home occupations: 1. Hotels, motels or organizational lodging; 2. Dry cleaning; 3. Automotive towing services, automotive wrecking services and tow-in parking lots; 4. Recreational marijuana processor, recreational marijuana producer or recreational marijuana retailer; and 5. Winery, brewery, distillery facility I, II and III, and remote tasting rooms, except that home occupation adult beverage businesses operating under an active Washington state Liquor and Cannabis Board production license issued for their current location before December 31, 2019, and where King County did not object to the location during the Washington state Liquor and Cannabis Board license application process, shall be considered legally nonconforming and allowed to remain in their current location subject to K.C.C. 21A.32.020 through 21A.32.075 if the use is in compliance with this section as of December 31, 2019. Such nonconforming businesses shall remain subject to all other requirements of this section and all applicable state and local regulations. The resident operator of a nonconforming home occupation winery, brewery or distillery shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74;K. Uses not allowed as home occupation may be allowed as a home industry under K.C.C. chapter 21A.30; andL. The home occupation or occupations may use or store vehicles, as follows: 1. The total number of vehicles for all home occupations shall be: a. for any lot five acres or less: two; b. for lots greater than five acres: three; and c. for lots greater than ten acres: four; 2. The vehicles are not stored within any required setback areas of the lot or on adjacent streets; and 3. The parking area for the vehicles shall not be considered part of the outdoor storage area provided for in subsection C. of this section. (Ord. 19030 § 22, 2019: Ord. 17710 § 11, 2013: Ord. 17539 § 61, 2013: Ord. 17191 § 48, 2011: Ord. 16323 § 2, 2008: Ord. 15606 § 20, 2006).21A.30.090 Home industry. A resident may establish a home industry as an accessory activity, as follows:A. The site area is one acre or greater;B. The area of the dwelling unit used for the home industry does not exceed fifty percent of the floor area of the dwelling unit.C. Areas within attached garages and storage buildings shall not be considered part of the dwelling unit for purposes of calculating allowable home industry area but may be used for storage of goods associated with the home industry;D. No more than six nonresidents who work on-site at the time;E. In addition to required parking for the dwelling unit, on-site parking is provided as follows: 1. One stall for each nonresident employee of the home industry; and 2. One stall for customer parking;F. Additional customer parking shall be calculated for areas devoted to the home industry at the rate of one stall per: 1. One thousand square feet of building floor area; and 2. Two thousand square feet of outdoor work or storage area;G. Sales are limited to items produced on-site, except for items collected, traded and occasionally sold by hobbyists, such as coins, stamps, and antiques;H. Ten feet of Type I landscaping are provided around portions of parking and outside storage areas that are otherwise visible from adjacent properties or public rights-of-way;I. The department ensures compatibility of the home industry by: 1. Limiting the type and size of equipment used by the home industry to those that are compatible with the surrounding neighborhood; 2. Providing for setbacks or screening as needed to protect adjacent residential properties; 3. Specifying hours of operation; 4. Determining acceptable levels of outdoor lighting; and 5. Requiring sound level tests for activities determined to produce sound levels that may be in excess of those in K.C.C. chapter 12.88;J. Recreational marijuana processors, recreational marijuana producers and recreational marijuana retailers shall not be allowed as home industry; andK. Winery, brewery, distillery facility I, II and III, and remote tasting room shall not be allowed as home industry, except that home industry adult beverage businesses that have, in accordance with K.C.C. 20.20.070, a vested conditional use permit application before December 31, 2019, shall be considered legally nonconforming and allowed to remain in their current location subject to K.C.C. 21A.32.020 through 21A.32.075. Such nonconforming businesses remain subject to all other requirements of this section and all applicable state and local regulations. The resident operator of a nonconforming winery, brewery or distillery home industry shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74. (Ord. 19030 § 23, 2019: Ord. 17710 § 12, 2013: Ord. 17191 § 49, 2011: Ord. 15606 § 21, 2006: Ord. 10870 § 537, 1993).21A.32GENERAL PROVISIONS - NONCONFORMANCE, TEMPORARY USES, AND RE-USE OF FACILITIESSections:21A.32.010Purpose.21A.32.020Nonconformance – applicability - exceptions.21A.32.025Nonconformance use, structure or improvement - continuation - forfeiture - no reestablishment.21A.32.040Nonconformance - abatement of illegal use, structure or development.21A.32.045Nonconformance - reestablishment of discontinued nonconforming use, or damaged or destroyed nonconforming structure or site improvement.21A.32.055Nonconformance - modifications to nonconforming use, structure or site improvement.21A.32.065Nonconformance - expansions of nonconforming uses, structures, or site improvements.21A.32.075Nonconformance - required findings.21A.32.085Nonconformance - residences.21A.32.100Temporary use permits - uses requiring permits.21A.32.110Temporary use permits - exemptions to permit requirement.21A.32.120Temporary use permits - duration and frequency.21A.32.130Temporary use permits - parking.21A.32.140Temporary use permits - traffic control.21A.32.145Homeless encampments - prohibited. (Effective January 1, 2025, and thereafter.)21A.32.150Temporary construction buildings.21A.32.160Temporary construction residence.21A.32.170Temporary mobile home for medical hardship.21A.32.180Temporary real estate offices.21A.32.190Temporary school facilities.21A.32.200Re-use of facilities - general standards.21A.32.210Re-use of facilities - reestablishment of closed public school facilities.21A.32.220Re-use of facilities - standards for conversion of historic buildings.21A.32.230Public nuisance - prohibited activities.21A.32.250Recreational marijuana production and processing facilities – odor management plan.21A.32.010 Purpose. The purposes of this chapter are to:A. Establish the legal status of a nonconformance by creating provisions through which a nonconformance may be maintained, altered, reconstructed, expanded or terminated;B. Provide for the temporary establishment of uses that are not otherwise permitted in a zone and to regulate such uses by their scope and period of use; andC. Encourage the adaptive re-use of existing public facilities which will continue to serve the community, and to ensure public review of redevelopment plans by allowing: 1. Temporary re-use of closed public school facilities retained in school district ownership, and the reconversion of a temporary re-use back to a school use; 2. Permanent re-use of surplus nonresidential facilities (e.g. schools, fire stations, government facilities) not retained in school district ownership; or 3. Permanent re-use of historic structures listed on the National Register or designated as county landmarks. (Ord. 10870 § 538, 1993).21A.32.020 Nonconformance – applicability - exceptions.A. This chapter shall apply to all nonconformances, except: 1. Nonconforming operations regulated by K.C.C. chapter 21A.22; and 2. Fossil fuel facilities regulated by K.C.C. 21A.08.100.B. This chapter does not supersede or relieve a property owner from compliance with local, state and federal regulations and laws that apply to the property structures and uses thereon. (Ord. 19146 § 73, 2020: Ord. 17837 § 91, 2014: Ord. 10870 § 539, 1993).21A.32.025 Nonconformance use, structure or improvement - continuation - forfeiture - no reestablishment. A nonconforming use, structure or improvement may be continued in a manner consistent with this chapter. However, nonconformance status is forfeited if the nonconforming use, structure or improvement is discontinued beyond the provisions of K.C.C. 21A.32.045. Once nonconformance status is forfeited, the nonconforming use, structure or improvement shall not be reestablished. (Ord. 17841 § 49, 2014: Ord. 13130 § 2, 1998).21A.32.040 Nonconformance - abatement of illegal use, structure or development. Any use, structure or other site improvement not established in compliance with use and development standards in effect at the time of establishment shall be deemed illegal and shall be discontinued or terminated and subject to removal pursuant to the provisions of K.C.C. Title 23. (Ord. 10870 § 541, 1993).21A.32.045 Nonconformance - reestablishment of discontinued nonconforming use, or damaged or destroyed nonconforming structure or site improvement. A nonconforming use that has been discontinued or a nonconforming structure or site improvement that has been damaged or destroyed, may be reestablished or reconstructed if:A. The nonconforming use, structure or site improvement that previously existed is not expanded;B. A new nonconformance is not created;C.1. The use has not been discontinued for more than twelve months before its reestablishment, or the nonconforming structure or site improvement is reconstructed in accordance with a complete permit application submitted to the department within twelve months of the occurrence of damage or destruction; or 2. If the use has been discontinued for more than twelve months, the applicant provides documentation that demonstrates to the satisfaction of the department that there was no intent to abandon the use. Documentation may include, but is not limited to, requests for approvals necessary to reestablish the use or structure submitted to appropriate county, state and federal agencies within twelve months after the use was discontinued. A statement from the property owner that merely states that there is no intent to abandon is not sufficient documentation without a showing of additional actions taken by the property owner to reestablish the use or structure; andD. A nonconforming use, structure or site improvement located within the shoreline jurisdiction that is damaged or destroyed more than fifty percent of its fair market value at present or at the time of its destruction may be reconstructed only insofar as it is consistent with existing regulations. (Ord. 16985 § 111, 2010: Ord. 16594 § 5, 2009: Ord. 13130 § 3, 1998).21A.32.055 Nonconformance - modifications to nonconforming use, structure or site improvement. Modifications to a nonconforming use, structure or site improvement may be reviewed and approved by the department pursuant to the code compliance review process of K.C.C. 21A.42.030 provided that:A. The modification does not expand any existing nonconformance; andB. The modification does not create a new type of nonconformance. (Ord. 15606 § 22, 2006: Ord. 13130 § 4, 1998).21A.32.065 Nonconformance - expansions of nonconforming uses, structures, or site improvements. A nonconforming use, structure, or site improvement may be expanded as follows:A. The department may review and approve, pursuant to the code compliance process of K.C.C. 21A.42.030, an expansion of a nonconformance only if: 1. The expansion conforms to all other provisions of this title, except that the extent of the project-wide nonconformance in each of the following may be increased up to ten percent: a. building square footage, b. impervious surface, c. parking, or d. building height; and 2. No subsequent expansion of the same nonconformance shall be approved under this subsection if the cumulative amount of such expansion exceeds the percentage prescribed in subsection A.1;B. A special use permit shall be required for expansions of a nonconformance within a development authorized by an existing special use or unclassified use permit if the expansions are not consistent with subsection A. of this section;C. A conditional use permit shall be required for expansions of a nonconformance: 1. Within a development authorized by an existing planned unit development approval; or 2. Not consistent with the provisions of subsections A. and B. of this section; andD. No expansion shall be approved that would allow for urban growth outside the urban growth area, in conflict with King County Comprehensive Plan rural and natural resource policies and constitute impermissible urban growth outside an urban growth area. (Ord. 15606 § 23, 2006: Ord. 13130 § 5, 1998).21A.32.075 Nonconformance - required findings. Modifications or expansions approved by the department shall be based on written findings that the proposed:Modification or expansion of a nonconformance located within a development governed by an existing conditional use permit, special use permit, unclassified use permit, or planned unit development shall provide the same level of protection for and compatibility with adjacent land uses as the original land use permit approval. (Ord. 13130 § 6, 1998).21A.32.085 Nonconformance - residences. Any residence nonconforming relative to use may be expanded, after review and approval through the code compliance process in K.C.C. chapter 21A.42, subject to all other applicable codes besides those set forth in this chapter for nonconformances. (Ord. 17841 § 50, 2014: Ord. 13130 § 12, 1998).21A.32.100 Temporary use permits - uses requiring permits. Except as provided by K.C.C. 21A.32.110, a temporary use permit shall be required for any of the following:A. A use not otherwise permitted in the zone that can be made compatible for a period of up to sixty days a year;B. The expansion of an established use that : 1. Is otherwise allowed in the zone; 2. Is not inconsistent with the original land use approval; 3. Exceeds the scope of the original land use approval; and 4. Can be made compatible with the zone for a period of up to sixty days a year; orC. Events at a winery, brewery, distillery facility or remote tasting room that include one or more of the following activities: 1. Exceeds the permitted building occupancy; 2. Utilizes portable toilets; 3. Utilizes parking that exceeds the maximum number of spaces allowed by this title on-site or utilizes off-site parking; 4. Utilizes temporary stages; 5. Utilizes temporary tents or canopies that require a permit; 6. Requires traffic control for public rights-of-way; or 7. Extends beyond allowed hours of operation. (Ord. 19030 § 24, 2019: Ord. 17841 § 51, 2014: Ord. 10870 § 547, 1993).21A.32.110 Temporary use permits - exemptions to permit requirement.A. The following uses shall be exempt from requirements for a temporary use permit when located in the RB, CB, NB, O or I zones for the time period specified below: 1. Uses not to exceed a total of thirty days each calendar year: a. Christmas tree lots; and b. Produce stands. 2. Uses not to exceed a total of fourteen days each calendar year: a. Amusement rides, carnivals or circuses; b. Community festivals; and c. Parking lot sales.B. Any use not exceeding a cumulative total of two days each calendar year shall be exempt from requirements for a temporary use permit.C. Any community event held in a park and not exceeding a period of seven days shall be exempt from requirements for a temporary use permit.D. Christmas tree sales not exceeding a total of thirty days each calendar year when located on Rural Area (RA) zoned property with legally established non-residential uses shall be exempt from requirements for a temporary use permit.E.1. Events at a winery, brewery, distillery facility II or III shall not require a temporary use permit if: a. The business is operating under an active Washington state Liquor and Cannabis Board production license issued for their current location before December 31, 2019, and where King County did not object to the location during the Washington state Liquor and Cannabis Board license application process; b. The parcel is at least eight acres in size; c. The structures used for the event maintain a setback of at least one hundred fifty feet from interior property lines; d. The parcel is located in the RA zone; e. The parcel has access directly from and to a principal arterial or state highway; f. The event does not use amplified sound outdoors before 12:00 p.m. or after 8:00 p.m. 2. Events that meet the provisions in this subsection E. shall not be subject to the provisions of K.C.C. 21A.32.120, as long as the events occur no more frequently than an annual average of eight days per month. (Ord. 19276 § 12, 2021: Ord. 19030 § 25, 2019: Ord. 12893 § 1, 1997: Ord. 10870 § 548, 1993).21A.32.120 Temporary use permits - duration and frequency. Except as otherwise provided in this chapter or in K.C.C. chapter 21A.45, temporary use permits shall be limited in duration and frequency as follows:A. The temporary use permit shall be effective for one year from the date of issuance and may be renewed annually as provided in subsection D. of this section;B.1. The temporary use shall not exceed a total of sixty days in any three-hundred-sixty-five-day period. This subsection B.1. applies only to the days that the event or events actually take place. 2. For a winery, brewery, distillery facility II and III in the A zone, the temporary use shall not exceed a total of two events per month and all event parking must be accommodated on-site or managed through a parking management plan approved by the director. This subsection B.2. applies only to the days that the event or events actually take place. 3. For a winery, brewery, distillery facility II and III in the RA zone, the temporary use shall not exceed a total of twenty-four days in any three-hundred-sixty-five-day period and all event parking must be accommodated on-site or managed through a parking management plan approved by the director. This subsection B.3. applies only to the days that the event or events actually take place. 4. For a winery, brewery, distillery facility II in the A or RA zones, in addition to all other relevant facts, the department shall consider building occupancy and parking limitations during permit review, and shall condition the number of guests allowed for a temporary use based on those limitations. The department shall not authorize attendance of more than one hundred fifty guests. 5. For a winery, brewery, distillery facility III in the A or RA zones, in addition to all other relevant facts, the department shall consider building occupancy and parking limitations during permit review, and shall condition the number of guests allowed for a temporary use based on those limitations. The department shall not authorize attendance of more than two hundred fifty guests. 6. Events for any winery, brewery, distillery facility I in the RA zone, any nonconforming winery, brewery, distillery facility home occupation, or any nonconforming winery, brewery, distillery facility home industry shall be limited to two per year, and limited to a maximum of fifty guests. If the event complies with this subsection B.6., a temporary use permit is not required for a special event for a winery, brewery, distillery facility I in the RA zone, a nonconforming home occupation winery, brewery, distillery facility or a nonconforming home industry winery, brewery, distillery facility. 7. For a winery, brewery, distillery facility II and III in the RA zone, events exempted under K.C.C 21A.32.110.E. from the requirement to obtain a temporary use permit shall not be subject to the provisions of this section;C. The temporary use permit shall specify a date upon which the use shall be terminated and removed; andD. A temporary use permit may be renewed annually for up to a total of five consecutive years as follows: 1. The applicant shall make a written request and pay the applicable permit extension fees for renewal of the temporary use permit at least seventy days before the end of the permit period; 2. The department must determine that the temporary use is being conducted in compliance with the conditions of the temporary use permit; 3. The department must determine that site conditions have not changed since the original temporary permit was issued; and 4. At least forty-five days before the end of the permit period, the department shall notify property owners within five hundred feet of the property boundaries that a temporary use permit extension has been requested and contact information to request additional information or to provide comments on the proposed extension. (Ord. 19030 § 26, 2019: Ord. 17841 § 52, 2014: Ord. 17191 § 50, 2011: Ord. 16950 § 27, 2010: Ord. 15170 § 4, 2005: Ord. 14781 § 3, 2003: Ord. 10870 § 549, 1993).21A.32.130 Temporary use permits - parking. Parking and access for proposed temporary uses shall be approved by the county. (Ord. 10870 § 550, 1993).21A.32.140 Temporary use permits - traffic control. The applicant for a proposed temporary use shall provide any parking/traffic control attendants as specified by the King County department of public safety. (Ord. 10870 § 551, 1993).21A.32.145 Homeless encampments - prohibited. (Effective January 1, 2025, and thereafter). A homeless encampment is a prohibited use and shall not be approved through a temporary use permit. If the King County Ten Year Plan to End Homelessness has not been fully implemented and there is still a need for homeless encampments, the county council may through legislative action extend K.C.C. chapter 21A.45 and Ordinance 15170, Section 16. (Ord. 15170 § 18, 2005).21A.32.150 Temporary construction buildings. Temporary structures for storage of tools and equipment, or for supervisory offices may be permitted for construction projects, provided that such structures are:A. Allowed only during periods of active construction; andB. Removed within 30 days of project completion or cessation of work. (Ord. 10870 § 552, 1993).21A.32.160 Temporary construction residence.A. A mobile home may be permitted on a lot as a temporary dwelling for the property owner, provided a building permit for a permanent dwelling on the site has been obtained.B. The temporary mobile home permit shall be effective for a period of 12 months. The permit may be extended for one additional period of 12 months if the permanent dwelling is constructed with a finished exterior by the end of the initial approval period.C. The mobile home shall be removed within 90 days of: 1. The expiration of the temporary mobile home permit; or 2. The issuance of a certificate of occupancy for the permanent residence, whichever occurs first. (Ord. 10870 § 553, 1993).21A.32.170 Temporary mobile home for medical hardship.A. A mobile home may be permitted as a temporary dwelling on the same lot as a permanent dwelling, provided: 1. The mobile home together with the permanent residence shall meet the setback, height, building footprint, and lot coverage provisions of the applicable zone; and 2. The applicant submits with the permit application a notarized affidavit that contains the following: a. Certification that the temporary dwelling is necessary to provide daily care, as defined in K.C.C. 21A.06; b. Certification that the primary provider of such daily care will reside on-site; c. Certification that the applicant understands the temporary nature of the permit, subject to the limitations outlined in subsections B and C of this section; d. Certification that the physician's signature is both current and valid; and e. Certification signed by a physician that a resident of the subject property requires daily care, as defined in K.C.C. 21A.06.B. Temporary mobile home permits for medical hardships shall be effective for 12 months. Extensions of the temporary mobile home permit may be approved in 12-month increments subject to demonstration of continuing medical hardship in accordance with the procedures and standards set forth in subsection A of this section.C. The mobile home shall be removed within 90 days of: 1. The expiration of the temporary mobile home permit; or 2. The cessation of provision of daily care. (Ord. 12523 § 4, 1996: Ord. 10870 § 554, 1993).21A.32.180 Temporary real estate offices. One temporary real estate office may be located on any new residential development, provided that activities are limited to the initial sale or rental of property or units within the development. The office use shall be discontinued within one year of recording of a short subdivision or issuance of a final certificate of occupancy for an apartment development, and within two years of the recording of a formal subdivision. (Ord. 13095 § 1, 1998: Ord. 10870 § 555, 1993).21A.32.190 Temporary school facilities. Temporary school structures may be permitted during construction of new school facilities or during remodeling of existing facilities, provided that such structures are:A. Allowed only during periods of active construction or remodeling;B. Do not expand the student capacity beyond the capacity under construction or remodeling; andC. Removed within 30 days of project completion or cessation of work. (Ord. 10870 § 556, 1993).21A.32.200 Re-use of facilities - general standards. The interim or permanent re-use of surplus nonresidential facilities in the rural area and residential zones shall require that no more than fifty percent of the original floor area be demolished for either permanent or interim re-use of facilities. (Ord. 17539 § 62: 2013: Ord. 11621 § 94, 1994: Ord. 10870 § 557, 1993).21A.32.210 Re-use of facilities - reestablishment of closed public school facilities. The re-establishment or reconversion of an interim nonschool use of school facilities back to school uses shall require a site plan and the issuance of a change of use permit pursuant to K.C.C. 16.04. (Ord. 10870 § 558, 1993).21A.32.220 Re-use of facilities - standards for conversion of historic buildings. In order to insure that significant features of the property are protected pursuant to K.C.C. 20.62, the following standards shall apply to conversion of historic buildings:A. Gross floor area of building additions or new buildings required for the conversion shall not exceed 20 percent of the gross floor area of the historic building, unless allowed by the zone;B. Conversions to apartments shall not exceed one dwelling unit for each 3,600 square feet of lot area, unless allowed by the zone; andC. Any construction required for the conversion shall require certification of appropriateness from the King County Landmark Commission. (Ord. 10870 § 559, 1993).21A.32.230 Public nuisance - prohibited activities. It is unlawful for any person to keep, maintain or deposit on any property in the county a public nuisance including, but not limited to, the following:A. Open storage of rubbish or junk including, but not limited to, refuse, garbage, scrap metal or lumber, concrete, asphalt, tin cans, tires and piles of earth, not including compost bins.B. Combustible material likely to become easily ignited or debris resulting from any fire and which constitutes a fire hazard, as defined in the International Fire Code as adopted under K.C.C. 17.04.010.C. Abandoned vehicles, wrecked, dismantled or inoperative vehicles or remnant parts thereof except as provided in K.C.C. 23.10.040. (Ord. 17837 § 92, 2014: Ord. 12024 § 12, 1995).21A.32.250 Recreational marijuana production and processing facilities - odor management plan. For those recreational marijuana production and processing facilities requiring a conditional use permit under this title, as part of the permit review process, the department may require the applicant to submit an odor management plan for any areas of indoor processing or ventilation of any structure used to produce or process marijuana. The purpose of such plan is to minimize odors and fumes from chemicals or products used in or resulting from either production or processing, or both, of marijuana. (Ord. 17841 § 53, 2014: Ord. 17710 § 14, 2013).21A.34GENERAL PROVISIONS - RESIDENTIAL DENSITY INCENTIVESSection:21A.34.010Purpose.21A.34.020Permitted locations of residential density incentives.21A.34.030Maximum densities permitted through residential density incentive review.21A.34.040Public benefits and density incentives.21A.34.050Rules for calculating total permitted dwelling units.21A.34.060Review process.21A.34.070Minor adjustments in final site plans.21A.34.080Applicability of development standards.21A.34.010 Purpose. The purpose of this chapter is to provide density incentives to developers of residential lands in urban areas and rural activity centers, in exchange for public benefits to help achieve Comprehensive Plan goals of affordable housing, open space protection, historic preservation and energy conservation, by:A. Defining in quantified terms the public benefits that can be used to earn density incentives;B. Providing rules and formulae for computing density incentives earned by each benefit;C. Providing a method to realize the development potential of sites containing unique features of size, topography, environmental features or shape; andD. Providing a review process to allow evaluation of proposed density increases and the public benefits offered to earn them, and to give the public opportunities to review and comment. (Ord. 10870 § 560, 1993).21A.34.020 Permitted locations of residential density incentives.A. Residential density incentives (RDI) shall be used only on sites served by public sewers and only in the following zones:1. In R-4 through R-48 zones; and2. In NB, CB, RB and O zones when part of a mixed-use development.B. RDI shall not be applied within the Skyway-West Hill or North Highline community service area subarea geographies. (Ord. 19555 § 14, 2022: Ord. 10870 § 561, 1993).21A.34.030 Maximum densities permitted through residential density incentive review.A. Except as otherwise provided in subsection B. of this section, the maximum density permitted through residential density incentive (“RDI”) review shall be one-hundred fifty percent of the base density of the underlying zone of the development site.B. The maximum density permitted through RDI review shall be two hundred percent of the base density of the underlying zone of the development site for the following RDI proposals: 1. For proposals where one hundred percent of the units are affordable units; or 2. For cottage housing proposals. (Ord. 15245 § 9, 2005: Ord. 10870 § 562, 1993).21A.34.040 Public benefits and density incentives.A. The public benefits eligible to earn increased densities, and the maximum incentive to be earned by each benefit, are in subsection F of this section. The density incentive is expressed as additional bonus dwelling unit, or fractions of dwelling units, earned per amount of public benefit provided.B. Bonus dwelling units may be earned through any combination of the listed public benefits.C. The guidelines for affordable housing bonuses including the establishment of rental levels, housing prices and asset limitations, will be updated and adopted annually by the council in the consolidated housing and community development plan.D. Bonus dwelling units may also be earned and transferred to the project site through the transfer of development rights (TDR) program established in K.C.C. chapter 21A.37, by providing any of the open space, park site or historic preservation public benefits set forth in subsection F.2. or 3. of this section on sites other than that of the RDI development.E. Residential development in R-4 through R-48 zones with property specific development standards requiring any public benefit enumerated in this chapter, shall be eligible to earn bonus dwelling units in accordance with subsection F of this section if the public benefits provided exceed the basic development standards of this title. If a development is located in a special overlay district, bonus units may be earned if the development provides public benefits exceeding corresponding standards of the special district.F. The following are the public benefits eligible to earn density incentives through RDI review:BENEFITDENSITY INCENTIVE1. AFFORDABLE HOUSINGa. Benefit units consisting of rental housing permanently priced to serve nonsenior citizen low-income households (that is no greater than 30 percent of gross income for households at or below 50 percent of King County median income, adjusted for household size). A covenant on the site that specifies the income level being served, rent levels and requirements for reporting to King County shall be recorded at final approval.1.5 bonus units per benefit unit, up to a maximum of 30 low-income units per five acres of site area; projects on sites of less than five acres shall be limited to 30 low-income units.b. Benefit units consisting of rental housing designed and permanently priced to serve low-income senior citizens (that is no greater than 30 percent of gross income for 1- or 2-person households, 1 member of which is 62 years of age or older, with incomes at or below 50 percent of King County median income, adjusted for household size). A covenant on the site that specifies the income level being served, rent levels and requirements for reporting to King County shall be recorded at final approval.1.5 bonus units per benefit unit, up to a maximum of 60 low-income units per five acres of site area; projects on sites of less than five acres shall be limited to 60 low-income units.c. Benefit units consisting of senior citizen assisted housing units 600 square feet or less.1 bonus unit per benefit unitd. Benefit units consisting of moderate income housing reserved for income- and asset-qualified home buyers (total household income at or below 80 percent of King County median, adjusted for household size). Benefit units shall be limited to owner-occupied housing with prices restricted based on typical underwriting ratios and other lending standards, and with no restriction placed on resale. Final approval conditions shall specify requirements for reporting to King County on both buyer eligibility and housing prices.0.75 bonus unit per benefit unit.e. Benefit units consisting of moderate income housing reserved for income and asset-qualified home buyers (total household income at or below 80 percent of King County median, adjusted for household size). Benefit units shall be limited to owner-occupied housing with prices restricted based on typical underwriting ratios and other lending standards, and with a 15 year restriction binding prices and eligibility on resale to qualified moderate income purchasers. Final approval conditions shall specify requirements for reporting to King County on both buyer eligibility and housing prices.1 bonus unit per benefit unit.f. Benefit units consisting of moderate income housing reserved for income- and asset-qualified home buyers (total household income at or below 80 percent of King County median, adjusted for household size). Benefit units shall be limited to owner-occupied housing, with prices restricted to same income group, based on current underwriting ratios and other lending standards for 30 years from date of first sale. A covenant on the site that specifies the income level and other aspects of buyer eligibility, price levels and requirements for reporting to King County shall be recorded at final approval.1.5 bonus units per benefit unit.g. Projects in which 100 percent of the units are reserved for moderate income - and asset-qualified buyers (total household income at or below 80 percent of the King County median, adjusted for household size). All units shall be limited to owner-occupied housing with prices restricted based on current underwriting ratios and other lending standards, and with prices restricted to same income group, for 15 years from date of first sale. Final approval conditions shall specify requirements for reporting to King County on both buyer eligibility and housing prices.200 percent of the base density of the underlying zone. Limited to parcels 5 acres or less in size and located in the R-4 through R-8 zones. Housing types in the R-4 or R-6 zones shall be limited to structures containing four or less units, except for townhouses. Such RDI proposals shall not be eligible to utilize other RDI bonus density incentives listed in this section.h. Benefit units consisting of mobile home park space or pad reserved for the relocation of an insignia or noninsignia mobile home, that has been or will be displaced due to closure of a mobile home park located in incorporated or unincorporated King County.1.0 bonus unit per benefit unit.2. OPEN SPACE, TRAILS AND PARKSa. Dedication of park site or trail right-of-way meeting King County location and size standards for neighborhood, community or regional park, or trail, and accepted by the parks division.0.5 bonus unit per acre of park area or quarter-mile of trail exceeding the minimum requirement of K.C.C. 21A.14 for on-site recreation space or trail corridors, computed on the number of dwelling units permitted by the site's base density.b. Improvement of dedicated park site to King County standards for developed parks.0.75 bonus unit per acre of park improvement. If the applicant is dedicating the site of the improvements, the bonus units earned by improvements shall be added to the bonus units earned by the dedication.c. Improvement of dedicated trail segment to King County standards.1.8 bonus units per quarter mile of trail constructed to county standard for pedestrian trails; or 2.5 bonus units per quarter mile of constructed to county standard for multipurpose trails (pedestrian/ bicycle/equestrian).Shorter segments shall be awarded bonus units on a pro rata basis. If the applicant is dedicating the site of the improvements, the bonus units earned by improvements shall be added to the bonus units earned by the dedication.d. Dedication of open space, meeting King County acquisition standards to the county or a qualified public or private organization such as a nature conservancy.0.5 bonus unit per acre of open space.3. HISTORIC PRESERVATIONa. Dedication of a site containing an historic landmark in accordance with K.C.C. chapter 20.62, to King County or a qualifying nonprofit organization capable of restoring and/or maintaining the premises to standards set by the King County landmarks commission.0.5 bonus unit per acre of historic site.b. Restoration of a site or structure designated as an historic landmark in accordance with K.C.C. chapter 20.62 to a specific architectural or site plan approved by the King County landmarks commission.0.5 bonus unit per acre of site or one thousand square feet of floor area of building restored.4. ENERGY CONSERVATIONa. Benefit units that incorporate conservation features in the construction of all on-site dwelling units heated by electricity that save at least 20 percent of space heat energy use from the maximum permitted by the Northwest Energy Code, as amended. No more than 50 percent of the required savings may result from the installation of heat pumps. None of the required savings shall be achieved by reduction of glazing area below 15 percent of floor area. Energy use shall be expressed as allowable energy load per square foot or as total transmittance (UA).0.15 bonus unit per benefit unit that achieves the required savings.b. Benefit units that incorporate conservation features in the construction of all on-site dwelling units heated by natural gas, or other nonelectric heat source, that save at least 25 percent of space heat energy use from the maximum permitted by the Northwest Energy Code, as amended. None of the required savings shall be achieved by reduction of glazing area below 15 percent of floor area. Energy use shall be expressed as allowable energy load per square foot or as total transmittance (UA).0.10 bonus unit per benefit unit that achieves the required savings.c. Developments located within 1/2 mile of transit routes served on at least a half-hourly basis during the peak hours and hourly during the daytime nonpeak hours or within 1/2 mile of a light rail transit or commuter rail station.10 percent increase above the base density of the zone.5. PUBLIC ARTa. Devoting 1% of the project budget to public art on site.5 percent increase above the base density of the zone.b. Contributing 1% of the project budget to the King County public art fund for development of art projects. The contribution shall be used for projects located within a one mile radius of the development project.5 percent increase above the base density of the zone.6. COTTAGE HOUSINGProvision of three to sixteen detached cottage units clustered around at least one common open space.Two hundred percent of the base density of the underlying zone. Limited to parcels in the R4-R8 zones. Such RDI proposals shall not be eligible to utilize other RDI bonus density incentives listed in this section.7. COMPACT HOUSINGIn R and UR zones, for the construction of detached single family homes 1500 square feet or smaller.One hundred fifty percent of the base density of the underlying zone.8. WALKABLE COMMUNITIESIn commercial centers located inside the urban growth area, as part of a development proposal that includes elements of walkable design and transit oriented development.Two hundred percent of the base density of the underlying zone.If proposed energy conservation bonus units of this section are reviewed in conjunction with a subdivision or a short subdivision, the applicant shall provide data and calculations for a typical house of the type to be built in the development that demonstrates to the department's satisfaction how the required savings will be achieved. A condition of approval shall be recorded with the plat and shown on the title of each lot specifying the required energy savings that must be achieved in the construction of the dwelling unit. The plat notation shall also specify that the savings shall be based on the energy code in effect at the time of preliminary plat application. (Ord. 16267 § 63, 2008: 15032 § 38, 2004: Ord. 14190 § 36, 2001: Ord. 14045 § 56, 2001: Ord. 10870 § 563, 1993).21A.34.050 Rules for calculating total permitted dwelling units.A. The formula for calculating the total number of dwelling units permitted through RDI review is as follows:DUs allowed by+Bonus DUs+DUs allowed by =TOTAL RDIRDI site basesending siteDUsdensitydensity (if any)B. The total dwelling units permitted through RDI review shall be calculated using the following steps: 1. Calculate the number of dwellings permitted by the base density of the site in accordance with K.C.C. chapter 21A.12; 2. Calculate the total number of bonus dwelling units earned by providing the public benefits listed in K.C.C. 21A.34.040; 3. Add the number of bonus dwelling units earned to the number of dwelling units permitted by the base density; 4. Add the number of dwelling units permitted by the base density of the site sending TDRs, if any; 5. Round fractional dwelling units to the nearest whole number; .49 or less dwelling units are rounded down; and 6. On sites with more than one zone or zone density, the maximum density shall be calculated for the site area of each zone. Bonus units may be reallocated within the zones in the same manner set forth for base units in K.C.C. 21A.12.180. (Ord. 14190 § 37, 2001: Ord. 10870 § 564, 1993).21A.34.060 Review process.A. All RDI proposals shall be reviewed concurrently with a primary proposal to consider the proposed site plan and methods used to earn extra density as follows: 1. For the purpose of this section, a primary proposal is defined as a proposed subdivision, conditional use permit or commercial building permit. 2. When the primary proposal requires a public hearing under this code or Title 19A, the public hearing on the primary proposal shall serve as the hearing on the RDI proposal. The reviewing authority shall make a consolidated decision on the proposed development and use of RDI and consider any appeals of the RDI proposal under the same appeal procedures set forth for the development proposal; 3. When the development proposal does not require a public hearing under this title or K.C.C. Title 19A, the RDI proposal shall be considered along with the development proposal, and any appeals of the RDI proposal shall be considered under the same appeal procedures set forth for the development proposal; and 4. The notice for the RDI proposal also shall include the development's proposed density and a general description of the public benefits offered to earn extra density.B. RDI applications which propose to earn bonus units by dedicating real property or public facilities shall include a letter from the applicable county receiving agency certifying that the proposed dedication qualifies for the density incentive and will be accepted by the agency or other qualifying organization. (Ord. 14190 § 38, 2001: Ord. 10870 § 565, 1993).21A.34.070 Minor adjustments in final site plans. When issuing building permits in an approved RDI development, the department may allow minor adjustments in the approved site plan involving the location or dimensions of buildings or landscaping, provided such adjustments shall not:A. Increase the number of dwelling units;B. Decrease the amount of perimeter landscaping (if any);C. Decrease residential parking facilities (unless the number of dwelling units is decreased);D. Locate structures closer to any site boundary line; orE. Change the locations of any points of ingress and egress to the site. (Ord. 10870 § 566, 1993).21A.34.080 Applicability of development standards.A. RDI developments shall comply with dimensional standards of the zone with a base density most closely comparable to the total approved density of the RDI development, provided that an RDI proposal in the R-4 through R-8 zone shall conform to the height requirements of the underlying zone in which it is located.B. RDI developments in the R-4 through R-8 zones shall be landscaped as follows: 1. When 75 percent or more of the units in the RDI development consists of townhouses or apartments, the development shall provide perimeter landscaping and tree retention in accordance with K.C.C. 21A.16 for townhouse or apartment projects. 2. When less than 75 percent of the units in the RDI consists of townhouses or apartments, the development shall provide landscaping and tree retention in accordance with K.C.C. 21A.16 for townhouses or apartments on the portion(s) of the development containing such units provided that, if buildings containing such units are more than 100 feet from the development's perimeter, the required landscaping may be reduced by 50 percent. 3. All other portions of the RDI shall provide landscaping or retain trees in accordance with K.C.C. 21A.16.C. RDI developments in all other zones shall be landscaped or retain trees in accordance with K.C.C. 21A.16.D. RDI developments shall provide parking as follows: 1. Projects with 100 percent affordable housing shall provide one off-street parking space per unit. The director may require additional parking, up to the maximum standards for attached dwelling units, which may be provided in common parking areas. 2. All other RDI proposals shall provide parking for: a. market rate/bonus units at levels consistent with K.C.C. 21A.18, and b. benefit units at 50 percent of the levels required for market rate/bonus units.E. RDI developments shall provide on-site recreation space as follows: 1. Projects with 100 percent affordable housing shall provide recreation space at 50 percent of the levels required in K.C.C. 21A.14. 2. All other RDI proposals shall provide recreation space for: a. market rate/bonus units at levels consistent with K.C.C. 21A.14, and b. benefit units at 50 percent of the levels required for market rate/bonus units. (Ord. 10870 § 567, 1993).21A.37GENERAL PROVISIONS - TRANSFER OF DEVELOPMENT RIGHTS (TDR)Sections:21A.37.010Transfer of development rights (TDR) program - purpose.21A.37.020Transfer of development rights (TDR) program - sending sites.21A.37.030Transfer of development rights (TDR) program - receiving sites.21A.37.040Transfer of development rights (TDR) program – calculations.21A.37.050Transfer of development rights (TDR) program - development limitations.21A.37.055Transfer of development rights (TDR) program - transportation-related greenhouse gas emissions for urban receiving sites.21A.37.060Transfer of development rights (TDR) program - documentation of restrictions.21A.37.070Transfer of development rights (TDR) program - sending site certification and interagency review committee process.21A.37.080Transfer of development rights (TDR) program - transfer process.21A.37.090Transfer of development rights (TDR) program - notice.21A.37.100Transfer of development rights (TDR) bank -- purpose.21A.37.110Transfer of development rights (TDR) bank expenditure and purchase authorization.21A.37.120Transfer of development rights (TDR) program - administration of TDR bank.21A.37.130Transfer of development rights (TDR) program - sale of TDR rights by TDR bank – TDR for affordable housing pilot program.21A.37.140Transfer of development rights (TDR) program - requirements for transfers by the TDR bank for use in incorporated receiving areas.21A.37.150Transfer of development rights (TDR) program - restrictions on expenditure of TDR bank funds on TDR amenities.21A.37.160Transfer of development rights (TDR) program - establishment and duties of the TDR executive board.21A.37.170Transfer of development rights (TDR) program - exemption from surplus provisions.21A.37.010 Transfer of development rights (TDR) program - purpose.A. The purpose of the transfer of development rights program is to transfer residential density from eligible sending sites to eligible receiving sites through a voluntary process that permanently preserves urban, rural and resource lands that provide a public benefit. The TDR provisions are intended to supplement land use regulations, resource protection efforts and open space acquisition programs and to encourage increased residential development density or increased commercial square footage, especially inside cities, where it can best be accommodated with the least impacts on the natural environment and public services by: 1. Providing an effective and predictable incentive process for property owners of rural, resource and urban separator land to preserve lands with a public benefit as described in K.C.C. 21A.37.020; and 2. Providing an efficient and streamlined administrative review system to ensure that transfers of development rights to receiving sites are evaluated in a timely way and balanced with other county goals and policies, and are adjusted to the specific conditions of each receiving site.B. The TDR provisions in this chapter shall only apply to TDR receiving site development proposals: 1. Submitted on or after September 17, 2001, and applications for approval of TDR sending sites submitted on or after September 17, 2001; and 2. For properties within the Skyway-West Hill or North Highline community service area subarea geographies, only as provided in K.C.C. chapter 21A.48. (Ord. 19555 § 15, 2022: Ord. 19146 § 74, 2020: Ord. 16267 § 64, 2008: Ord. 15032 § 39, 2004: Ord. 14190 § 3, 2001: Ord. 13274 § 1, 1998. Formerly K.C.C. 21A.55.100).21A.37.020 Transfer of development rights (TDR) program - sending sites.A. For the purpose of this chapter, sending site means the entire tax lot or lots qualified under this subsection. Sending sites shall: 1. Contain a public benefit such that preservation of that benefit by transferring residential development rights to another site is in the public interest; 2. Meet at least one of the following criteria: a. designation in the King County Comprehensive Plan or a functional plan as an agricultural production district or zoned A; b. designation in the King County Comprehensive Plan or a functional plan as forest production district or zoned F; c. designation in the King County Comprehensive Plan as Rural Area, zoned RA-2.5, RA-5 or RA-10, and meeting the definition in RCW 84.34.020 of open space or farm and agricultural land; d. designation in the King County Comprehensive Plan or a functional plan as a proposed Rural Area or Natural Resource Land regional trail or Rural Area or Natural Resource Land open space site, through either: (1) designation of a specific site; or (2) identification of proposed Rural Area or Natural Resource Land regional trail or Rural Area or Natural Resource Land open space sites which meet adopted standards and criteria, and for Rural Area or Natural Resource Land open space sites, meet the definition of open space land, as defined in RCW 84.34.020; e. identification as habitat for federally listed endangered or threatened species in a written determination by the King County department of natural resources and parks, Washington state Department of Fish and Wildlife, United States Fish and Wildlife Services or a federally recognized tribe that the sending site is appropriate for preservation or acquisition; f. designation in the King County Comprehensive Plan as urban separator and zoned R-1; or g.(1) designation in the King County Comprehensive Plan as urban residential medium or urban residential high; (2) zoned R-4, R-6, R-8, R-12, R-18, R-24 or R-48; and (3) approved for conservation futures tax funding by the King County council; 3. Consist of one or more contiguous lots that have a combined area that meets or exceeds the minimum lot area for construction requirements in K.C.C. 21A.12.100 for the zone in which the sending site is located. For purposes of this subsection, lots divided by a street are considered contiguous if the lots would share a common lot line if the street was removed. This provision may be waived by the interagency committee if the total acreage of a rural or resource sending site application exceeds one hundred acres; and 4. Not be in public ownership, except: a. as provided in K.C.C. 21A.37.110.C.; b. for lands zoned RA that are managed by the Washington state Department of Natural Resources as state grant or state forest lands; or c. for lands that are managed by King County for purposes of residential or commercial development.B. For the purposes of the TDR program, acquisition means obtaining fee simple rights in real property or a property right in a form that preserves in perpetuity the public benefit supporting the designation or qualification of the property as a sending site. A sending site shall be maintained in a condition that is consistent with the criteria in this section under which the sending was qualified.C. If a sending site has any outstanding code violations, the person responsible for code compliance should resolve these violations, including any required abatement, restoration, or payment of civil penalties, before a TDR sending site may be qualified by the interagency review committee created under K.C.C. 21A.37.070. However, the interagency may qualify and certify a TDR sending site with outstanding code violations if the person responsible for code compliance has made a good faith effort to resolve the violations and the proposal is in the public interest.D. For lots on which the entire lot or a portion of the lot has been cleared or graded in accordance with a Class II, III or IV special forest practice as defined in chapter 76.09 RCW within the six years before application as a TDR sending site, the applicant must provide an affidavit of compliance with the reforestation requirements of the Forest Practices Act, and any additional reforestation conditions of their forest practice permit. Lots on which the entire lot or a portion of the lot has been cleared or graded without any required forest practices or county authorization, shall be not qualified or certified as a TDR sending site for six years unless the six-year moratorium on development applications has been lifted or waived or the landowner has a reforestation plan approved by the Washington state Department of Natural Resources and King County. (Ord. 19484 § 16, 2022: Ord. 19146 § 75, 2020: Ord. 18427 § 11, 2016: Ord. 16950 § 28, 2010: Ord. 16267 § 65, 2008: Ord. 15032 § 40, 2004: Ord. 14199 § 240, 2001: Ord. 14190 § 4, 2001: Ord. 14045 § 59, 2001: Ord. 13274 § 4, 1998. Formerly K.C.C. 21A.55.130).21A.37.030 Transfer of development rights (TDR) program - receiving sites.A. Receiving sites shall be: 1. King County unincorporated urban sites, except as limited in subsection D. of this section, zoned R-4 through R-48, NB, CB, RB or O, or any combination thereof. The sites may also be within potential annexation areas established under the countywide planning policies; or 2. Cities where new growth is or will be encouraged under the Growth Management Act and the countywide planning policies and where facilities and services exist or where public investments in facilities and services will be made, or 3. RA-2.5 zoned parcels, except as limited in subsection E. of this section, that meet the criteria listed in this subsection A.3. may receive development rights transferred from rural forest focus areas, and accordingly may be subdivided and developed at a maximum density of one dwelling per two and one-half acres. Increased density allowed through the designation of rural receiving areas: a. must be eligible to be served by domestic Group A public water service; b. must be located within one-quarter mile of an existing predominant pattern of rural lots smaller than five acres in size; c. must not adversely impact regionally or locally significant resource areas or critical areas; d. must not require public services and facilities to be extended to create or encourage a new pattern of smaller lots; e. must not be located within rural forest focus areas; and f. must not be located on Vashon Island or Maury Island.B. Except as provided in this chapter, development of an unincorporated King County receiving site shall remain subject to all zoning code provisions for the base zone, except TDR receiving site developments shall comply with dimensional standards of the zone with a base density most closely comparable to the total approved density of the TDR receiving site development.C. An unincorporated King County receiving site may accept development rights from one or more sending sites, as follows: 1. For short subdivisions, up to the maximum density permitted under K.C.C. 21A.12.030 and 21A.12.040; and 2. For formal subdivisions, only as authorized in a subarea study that includes a comprehensive analysis of the impacts of receiving development rights.D. Property located within the outer boundaries of the Noise Remedy Areas as identified by the Seattle-Tacoma International Airport may not accept development rights.E. Property located within the shoreline jurisdiction or located on Vashon Island or Maury Island may not accept development rights. (Ord. 19484 § 16, 2022: Ord. 18427 § 12, 2016: Ord. 17485 § 31, 2012: Ord. 16267 § 66, 2008: Ord. 15606 § 24, 2006: Ord. 15032 § 41, 2004: Ord. 14190 § 5, 2001: Ord. 14045 § 60, 2001: Ord. 13274 § 5, 1998. Formerly K.C.C. 21A.55.140).21A.37.040 Transfer of development rights (TDR) program – calculations.A. The number of residential development rights that an unincorporated sending site is eligible to send to a receiving site shall be determined by applying the TDR sending site base density established in subsection D. of this section to the area of the sending site, after deducting the area associated with any existing development, any retained development rights and any portion of the sending site already in a conservation easement or other similar encumbrance. For each existing dwelling unit or retained development right, the sending site area shall be reduced by an area equivalent to the base density for that zone under K.C.C. 21A.12.030.B. Any fractions of development rights that result from the calculations in subsection A. of this section shall not be included in the final determination of total development rights available for transfer.C. For purposes of calculating the amount of development rights a sending site can transfer, the amount of land contained within a sending site shall be determined as follows: 1. If the sending site is an entire tax lot, the square footage or acreage shall be determined: a. by the King County department of assessments records; or b. by a survey funded by the applicant that has been prepared and stamped by a surveyor licensed in the state of Washington; and 2. If the sending site consists of a lot that is divided by a zoning boundary, the square footage or acreage shall be calculated separately for each zoning classification. The square footage or acreage within each zoning classification shall be determined by the King County record of the action that established the zoning and property lines, such as an approved lot line adjustment. When such records are not available or are not adequate to determine the square footage or acreage within each zoning classification, the department of local services, permitting division, shall calculate the square footage or acreage through the geographic information system (GIS) mapping system.D. For the purposes of the transfer of development rights (TDR) program only, the following TDR sending site base densities apply: 1. Sending sites designated in the King County Comprehensive Plan as urban separator and zoned R-1 shall have a base density of four dwelling units per acre; 2. Sending sites zoned RA-2.5 shall have a base density of one unit for each two and one-half acres. Sending sites zoned RA-2.5 that are vacant and are smaller than 1.25 acres shall be allocated one additional TDR for each vacant lot that is smaller than 1.25 acres; 3. Sending sites zoned RA-5 or RA-10 shall have a base density of one dwelling unit per five acres. Vacant sending sites that are zone RA-5 and are smaller than two and one-half acres or that are zoned RA-10 and are smaller than five acres shall be allocated one additional TDR for each vacant lot that is smaller than two and one-half acres or five acres, respectively; 4. Sending sites zoned RA and that have a designation under the King County Shoreline Master Program of conservancy or natural shall be allocated one additional TDR; 5. Sending sites zoned A-10 and A-35 shall have a base density of one dwelling unit per five acres for transfer purposes only; 6. Sending sites zoned F within the forest production district shall have a base density of one dwelling unit per eighty acres or one dwelling unit per each lot that is between fifteen and eighty acres in size; or. 7. Sending sites in the urban unincorporated area that meet the criteria in K.C.C. 21A.37.020.A.2.g. shall be allocated TDRs that are equivalent to the zoning base density established in K.C.C. 21A.12.030 for every one acre of gross land area.E. A sending site zoned RA, A or F may send one development right for every legal lot larger than five thousand square feet that was created on or before September 17, 2001, if that number is greater than the number of development rights determined under subsection A. of this section. A sending site zoned R-1 may send one development right for every legal lot larger than two thousand five hundred square feet that was created on or before September 17, 2001, if that number is greater than the number of development rights determined under subsection A. of this section.F. The number of development rights that a King County unincorporated rural or natural resources land sending site is eligible to send to a King County incorporated urban area receiving site shall be determined through the application of a conversion ratio established by King County and the incorporated municipal jurisdiction. The conversion ratio will be applied to the number of available sending site development rights determined under subsection A. or E. of this section.G. Development rights from one sending site may be allocated to more than one receiving site and one receiving site may accept development rights from more than one sending site.H. The determination of the number of residential development rights a sending site has available for transfer to a receiving site shall be valid for transfer purposes only, shall be documented in a TDR qualification report prepared by the department of natural resources and parks and sent to the applicant. The qualification report and shall be considered a final determination, not to be revised due to changes to the sending site’s zoning, and shall be valid unless conditions on the sending site property that would affect the number of development rights the sending site has available for transfer have changed.I. Each residential transferable development right that originates from a sending site zoned RA, A or F shall be designated "Rural" and is equivalent to two additional units above base density in eligible receiving sites located in unincorporated urban King County. Each residential transferable development right that originates from a sending site zoned R-1 urban separator shall be designated "Urban" and is equivalent to one additional unit above base density. Each residential transferable development right that originates from a sending site in urban unincorporated area lands meeting the criteria in K.C.C. 21A.37.020.A.2.g. shall be designated "Urban" and is equivalent to one additional unit above the base density. (Ord. 19146 § 76, 2020: Ord. 18791 § 181, 2018: Ord. 17485 § 32, 2012: Ord. 17420 § 111, 2012: Ord. 16950 § 29, 2010: Ord. 16267 § 67, 2008: Ord. 15032 § 42, 2004: Ord. 14190 § 6, 2001: Ord. 14045 § 61, 2001: Ord. 13274 § 6, 1998. Formerly K.C.C. 21A.55.150).21A.37.050 Transfer of development rights (TDR) program - development limitations.A. Following the transfer of residential development rights a sending site may subsequently accommodate remaining residential dwelling units, if any, on the buildable portion of the parcel or parcels or be subdivided, consistent with the zoned base density provisions of the density and dimensions tables in K.C.C. 21A.12.030 and 21A.12.040, the allowable dwelling unit calculations in K.C.C. 21A.12.070 and other King County development regulations. Any remaining residential dwelling units and associated accessory units shall be located in a single and contiguous reserved residential area that shall be adjacent to any existing development or roadways on the property. The reserved residential area shall be equal to the acreage associated with the minimum lot size of the zone for each remaining residential dwelling unit. For sending sites zoned RA, the subdivision potential remaining after a density transfer may only be actualized through a clustered subdivision, short subdivision or binding site plan that creates a permanent preservation tract as large or larger than the portion of the subdivision set aside as lots. Within rural forest focus areas, resource use tracts shall be at least fifteen acres of contiguous forest land.B. Only those nonresidential uses directly related to, and supportive of the criteria under which the site qualified are allowed on a sending site.C. The applicable limitations in this section shall be included in the sending site conservation easement. (Ord. 17485 § 33, 2012: Ord. 15245 § 10, 2005: Ord. 15032 § 43, 2004: Ord. 14190 § 7, 2001).21A.37.055 Transfer of development rights (TDR) program - transportation-related greenhouse gas emissions for urban receiving sites. An urban receiving site that purchases rural TDRs may include the reduced transportation-related greenhouse gas emissions that the department of natural resources and parks estimates will result from the TDR in calculating the receiving site's greenhouse gas emissions. (Ord. 17485 § 34, 2012: Ord. Ord. 16267 § 68, 2008).21A.37.060 Transfer of development rights (TDR) program - documentation of restrictions.A. Prior to issuing a certificate for transferable development rights to a sending site, the department of natural resources and parks, or its successor shall record deed restrictions in the form of a conservation easement documenting the development rights that have been removed from the property and shall place a notice on the title of the sending site. The department of local services, permitting division, or its successor, shall establish and maintain an internal tracking system that identifies all certified transfer of developments rights sending sites.B. A conservation easement granted to the county or other appropriate land management agency and that meets the requirements of K.C.C. 21A.37.050 shall be required for land contained in the sending site. The conservation easement shall be documented by a map. The conservation easement shall be placed on the entire lot or lots. The conservation easement shall identify limitations in perpetuity on future residential and nonresidential development consistent with this chapter, as follows: 1. A conservation easement, which contains the easement map, shall be recorded on the entire sending site to indicate development limitations on the sending site; 2. For a sending site zoned A-10 or A-35, the conservation easement shall be consistent in form and substance with the purchase agreements used in the agricultural land development rights purchase program. The conservation easement shall preclude subdivision of the subject property but may permit not more than one dwelling per sending site, and shall permit agricultural uses as provided in the A-10 or A-35 zone; 3. For a rural sending site the conservation easement shall allow for restoration, maintenance or enhancement of native vegetation. A present conditions report shall be required to document the location of existing structures and existing native vegetation and the baseline conservation values of protected property at the time the conservation easement is put in place. If residential development will be allowed on the site under the conservation easement, the present conditions report shall be used to guide the location of residential development; 4. For a sending site qualifying as habitat for federal listed endangered or threatened species, the conservation easement shall protect habitat and allow for restoration, maintenance or enhancement of native vegetation. A present conditions report shall be required to document the location of existing structures. If existing or future residential development will be allowed on the site under the conservation easement, the present conditions report shall be used by the owner to guide the location of residential development; and 5. For a sending site zoned F, the conservation easement shall encumber the entire sending site. Lots between fifteen acres and eighty acres in size are not eligible to participate in the TDR program if they include any existing dwelling units intended to be retained, or if a new dwelling unit is proposed. For eligible lots between fifteen acres and eighty acres in size, the sending site must include the entire lot. For lots greater than eighty acres in size, the sending site shall be a minimum of eighty acres. The conservation easement shall permit forestry uses subject to a forest stewardship plan prepared by the applicant and approved by the county for ongoing forest management practices. The Forest Stewardship Plan shall serve as a present conditions report documenting the baseline conditions of the property and shall include a description of the site’s forest resources and the long term forest management objectives of the property owner, and shall not impose standards that exceed Title 222 WAC. (Ord. 18791 § 182, 2018: Ord. 17485 § 35, 2012: Ord. 17420 § 112, 2012: Ord. 16267 § 69, 2008: Ord. 15032 § 44, 2004: Ord. 14190 § 8, 2001).21A.37.070 Transfer of development rights (TDR) program - sending site certification and interagency review committee process.A. An interagency review committee, chaired by the department of local services permitting division manager and the director of the department of natural resources and parks, or designees, shall be responsible for qualification of sending sites. Determinations on sending site certifications made by the committee are appealable to the examiner under K.C.C. 20.22.040. The department of natural resources and parks shall be responsible for preparing a TDR qualification report, which shall be signed by the director of the department of natural resources and parks or designee, documenting the review and decision of the committee. The qualification report shall: 1. Specify all deficiencies of an application, if the decision of the committee is to disqualify the application; 2. For all qualifying applications, provide a determination as to whether or not additional residential dwelling units and associated accessory units may be accommodated in accordance with K.C.C. 21A.37.050.A.; and 3. Be issued a TDR certification letter within sixty days of the date of submittal of a completed sending site certification application.B. Responsibility for preparing a completed application rests exclusively with the applicant. Application for sending site certification shall include: 1. A legal description of the site; 2. A title report; 3. A brief description of the site resources and public benefit to be preserved; 4. A site plan showing the existing and proposed dwelling units, nonresidential structures, driveways, submerged lands and any area already subject to a conservation easement or other similar encumbrance; 5. Assessors map or maps of the lot or lots; 6. A statement of intent indicating whether the property ownership, after TDR certification, will be retained in private ownership or dedicated to King County or another public or private nonprofit agency; 7. Any or all of the following written in conformance with criteria established through a public rule consistent with K.C.C. chapter 2.98, if the site is qualifying as habitat for a threatened or endangered species: a. a wildlife habitat conservation plan; b. a wildlife habitat restoration plan; or c. a wildlife present conditions report; 8. If the site qualifies as an urban unincorporated area sending site meeting the criteria in K.C.C. 21A.37.020.A.2.g.; 9. A forest stewardship plan, written in conformance with criteria established through a public rule consistent with K.C.C. chapter 2.98, if required under K.C.C. 21A.37.060.B.3. and 6.; 10. An affidavit of compliance with the reforestation requirements of the Forest Practices Act and any additional reforestation conditions of the forest practices permit for the site, if required under K.C.C. 21A.37.020.D.; 11. A completed density calculation worksheet for estimating the number of available development rights; and 12. The application fee consistent with K.C.C. 27.10.170. (Ord. 19146 § 77, 2020: Ord. 18791 § 183, 2018: Ord. 18230 § 134, 2016: Ord. 17485 § 36, 2012: Ord. 17420 § 113, 2012: Ord. 15032 § 45, 2004: Ord. 14561 § 28, 2002: Ord. 14199 § 241, 2001: Ord.14190 § 9, 2001: Ord. 13274 § 7, 1998. Formerly K.C.C. 21A55.160).21A.37.080 Transfer of development rights (TDR) program - transfer process.A. TDR development rights where both the proposed sending and receiving sites would be within unincorporated King County shall be transferred using the following process: 1. Following interagency review committee review and approval of the sending site application as described in K.C.C. 21A.37.070 the interagency review committee shall issue a TDR qualification report, agreeing to issue a TDR certificate in exchange for the proposed sending site conservation easement. After signing and notarizing the conservation easement and receiving the TDR certificate from the county, the sending site owner may market the TDR sending site development rights to potential purchasers. The TDR certificate shall be in the name of the property owner and separate from the land title. If a TDR sending site that has been reviewed and approved by the interagency review committee changes ownership, the TDR qualification report may be transferred to the new owner if requested in writing to the department of natural resources and parks by the person or persons that owned the property when the TDR qualification report was issued, if documents evidencing the transfer of ownership are also provided to the department of natural resources and parks; 2. In applying for receiving site approval, the applicant shall provide the department of local services, permitting division, with one of the following: a. a TDR qualification report issued in the name of the applicant, b. a TDR qualification report issued in the name of another person or persons and a copy of a signed option to purchase those TDR sending site development rights, c. a TDR certificate issued in the name of the applicant, or d. a TDR certificate issued in the name of another person or persons and a copy of a signed option to purchase those TDR sending site development rights; 3. Following building permit approval, but before building permit issuance by the department of local services, permitting division, or following preliminary plat approval or preliminary short plat approval, but before final plat or short plat recording of a receiving site development proposal which includes the use of TDR development rights, the receiving site applicant shall deliver the TDR certificate issued in the applicant's name for the number of TDR development rights being used and the TDR extinguishment document to the county; 4. When the receiving site development proposal requires a public hearing under this title or K.C.C. Title 19A or its successor, that public hearing shall also serve as the hearing on the TDR proposal. The reviewing authority shall make a consolidated decision on the proposed development and use of TDR development rights and consider any appeals of the TDR proposal under the same appeal procedures set forth for the development proposal; and 5. When the development proposal does not require a public hearing under this title or K.C.C. Title 19A, the TDR proposal shall be considered along with the development proposal, and any appeals of the TDR proposal shall be considered under the same appeal procedures set forth for the development proposal. 6. Development rights from a sending site shall be considered transferred to a receiving site when a final decision is made on the TDR receiving area development proposal, the sending site is permanently protected by a completed and recorded land dedication or conservation easement, notification has been provided to the King County assessor's office and a TDR extinguishment document has been provided to the department of natural resources and parks, or its successor.B. TDR development rights where the proposed receiving site would be within an incorporated King County municipal jurisdiction shall be reviewed and transferred using that jurisdiction’s development application review process. (Ord. 18791 § 184, 2018: Ord. 17485 § 37, 2012: Ord. 17420 § 114, 2012: Ord. 16267 § 70, 2008: Ord. 15032 § 46, 2004: Ord. 14190 § 10, 2001: Ord. 13274 § 8, 1998. Formerly K.C.C. 21A.55.170).21A.37.090 Transfer of development rights (TDR) program - notice. Public notice consistent with the provisions of K.C.C. 20.20.060 for Type Four land use decisions shall be provided for parcels identified as TDR receiving sites. (Ord. 14190 § 11, 2001: Ord. 13274 § 9, 1998. Formerly K.C.C. 21A.55.180).21A.37.100 Transfer of development rights (TDR) bank -- purpose. The purpose of the TDR bank is to assist in the implementation of the transfer of development rights (TDR) program by bridging the time gap between willing sellers and buyers of development rights by purchasing and selling development rights, purchasing conservation easements, and facilitating interlocal TDR agreements with cities in King County through the provision of amenity funds. The TDR bank may acquire development rights and conservation easements only from sending sites located in the rural area or in an agricultural or forest land use designation in the King County Comprehensive Plan, or in the urban unincorporated area only from sites meeting the criteria in K.C.C. 21A.37.020.A.2.g. Development rights purchased from the TDR bank may only be used for receiving sites in cities or in the urban unincorporated area as designated in the King County Comprehensive Plan. (Ord. 19146 § 78, 2020: Ord. 17485 § 38, 2012: Ord. 16267 § 71, 2008: Ord. 14763 § 1, 2003: Ord. 14190 § 12, 2001: Ord. 14045 § 62, 2001: Ord. 13733 § 8, 2000. Formerly K.C.C. 21A.55.200).21A.37.110 Transfer of development rights (TDR) bank expenditure and purchase authorization.A. The TDR bank may purchase development rights from qualified sending sites at prices not to exceed fair market value and to sell development rights at prices not less than fair market value, except as allowed in K.C.C. 21A.37.130. The TDR bank may accept donations of development rights from qualified TDR sending sites.B. The TDR bank may purchase a conservation easement only if the property subject to the conservation easement is qualified as a sending site as evidenced by a TDR qualification report, the conservation easement restricts development of the sending site in the manner required by K.C.C. 21A.37.060 and the development rights generated by encumbering the sending site with the conservation easement are issued to the TDR bank at no additional cost.C. Any development rights, generated by encumbering property with a conservation easement, may be issued to the TDR bank if: 1.a. The conservation easement is acquired through a county park, open space, trail, agricultural, forestry or other natural resource acquisition program for a property that is qualified as a TDR sending site as evidenced by a TDR qualification report; or b. the property is acquired by the county with the intent of conveying the property encumbered by a reserved conservation easement. The number of development rights generated by this reserved conservation easement shall be determined by the TDR qualification report; and 2. Under either subsection C.1.a. or b. of this section, there will be no additional cost to the county for acquiring the development rights.D. The TDR bank may use funds to facilitate development rights transfers. These expenditures may include, but are not limited to, establishing and maintaining internet web pages, marketing TDR receiving sites, procuring title reports and appraisals and reimbursing the costs incurred by the department of natural resources and parks, water and land resources division, or its successor, for administering the TDR bank fund and executing development rights purchases and sales.E. The TDR bank fund may be used to cover the cost of providing staff support for identifying and qualifying sending and receiving sites, and the costs of providing staff support for the TDR interagency review committee.F. Upon approval of the TDR executive board, proceeds from the sale of TDR bank development rights shall be available for acquisition of additional development rights and as amenity funds to facilitate interlocal TDR agreements with cities in King County and for projects in receiving areas located in urban unincorporated King County. Amenity funds provided to a city from the sale of TDR bank development rights to that city are limited to one-third of the proceeds from the sale. (Ord. 19146 § 79, 2020: Ord. 18427 § 13, 2016: Ord. 17485 § 39, 2012: Ord. 16950 § 30, 2010: Ord. 16267 § 72, 2008: Ord. 15032 § 47, 2004: Ord. 14763 § 2, 2003: Ord. 14561 § 29, 2002: Ord. 14199 § 242, 2001: Ord. 14190 § 13: Ord. 13733 § 10, 2000. Formerly K.C.C. 21A.55.210).21A.37.120 Transfer of development rights (TDR) program - administration of TDR bank.A. The department of natural resources and parks, water and land resources division, or its successor, shall administer the TDR bank fund and execute purchases of development rights and conservation easements and sales of development rights in a timely manner consistent with policy set by the TDR executive board. These responsibilities include, but are not limited to: 1. Managing the TDR bank fund; 2. Authorizing and monitoring expenditures; 3. Keeping records of the dates, amounts and locations of development rights purchases and sales, and conservation easement purchases; 4. Executing development rights purchases, sales and conservation easements; and 5. Providing periodic summary reports of TDR bank activity for TDR executive board consideration.B. The department of natural resources and parks, water and land resources division, or its successor, in executing purchase and sale agreements for acquisition of development rights and conservation easements shall ensure sufficient values are being obtained and that all transactions, conservation easements or fee simple acquisitions are consistent with public land acquisition guidelines. (Ord. 14763 § 3, 2003: Ord. 14199 § 243, 2001: Ord. 14190 § 14, 2001: Ord. 13733 § 11, 2000. Formerly K.C.C. 21A.55.220).21A.37.130 Transfer of development rights (TDR) program - sale of TDR rights by TDR bank – TDR for affordable housing pilot program.A.1. The sale of development rights by the TDR bank shall be at a price that equals or exceeds the fair market value of the development rights, except as provided in subsection A.2. of this section. The fair market value of the development rights shall be established by the department of natural resources and shall be based on the amount the county paid for the development rights and the prevailing market conditions. 2.a. The department of natural resources and parks shall undertake a "TDR for affordable housing" pilot program, in which transferrable development rights necessary to construct up to one hundred total units shall be sold at the administrative cost incurred by the county or fifteen percent of the fair market value of the development rights, whichever is less. b. In order to qualify for this program, all units built using the development rights must be either: (1) rental housing permanently priced to serve households with a total household income at or below sixty percent of AMI. A covenant on the property that specifies the income level being served, rent levels and requirements for reporting to King County shall be recorded at final approval; or (2) housing reserved for income- and asset-qualified home buyers with total household income at or below sixty percent of AMI. The units shall be limited to owner-occupied housing with prices restricted based on typical underwriting ratios and other lending standards, and with no restriction placed on resale. Final approval conditions shall specify requirements for reporting to King County on both buyer eligibility and housing prices. c. .(1) In areas where the inclusionary housing regulations adopted in K.C.C. chapter 21A.48* apply, development rights to build units through this pilot program shall only be sold for units in accordance with K.C.C. 21A.48.020 or K.C.C. 21.48.030. (2) For all other areas in unincorporated King County, in the R-4 through R-48 zones, development rights to build units through this pilot program shall only be sold for units between one hundred fifty percent and two hundred percent of the receiving site's base density as set forth in K.C.C. 21A.12.030. d.(1) The department of natural resources and parks shall track the sale of development rights and completion of units constructed through this program. When the one hundred unit threshold is reached, the department shall, within six months of that date, transmit a report to the council that includes, but is not limited to: (a) the location of the receiving sites where development rights under this pilot program were used; (b) lessons learned from the pilot program, including feedback from developers who purchased development rights through the program; and (c) a recommendation on whether to make the pilot program permanent, repeal the program or modify the program. (2) the report shall be accompanied by a proposed ordinance effectuating the recommendation in subsection A.2.d.(1)(c) of this section. (3) the report and proposed ordinance shall be filed in the form of a paper original and an electronic copy with the clerk of the council, who shall retain the original and provide an electronic copy to all councilmembers, the council chief of staff and the lead staff to the mobility and environment committee or its successor.B. When selling development rights, the TDR bank may select prospective purchasers based on the price offered for the development rights, the number of development rights offered to be purchased and the potential for the sale to achieve the purposes of the TDR program.C. The TDR bank may sell development rights only in whole or half increments to incorporated receiving sites through an interlocal agreement or, after the county enacts legislation that complies with chapter 365-198 WAC, to incorporated receiving sites in a city that has enacted legislation that complies with chapter 365-198 WAC. The TDR bank may sell development rights only in whole increments to unincorporated King County receiving sites.D. All offers to purchase development rights from the TDR bank shall be in writing, shall include a certification that the development rights, if used, shall be used only inside an identified city or within the urban unincorporated area, include a minimum ten percent down payment with purchase option, shall include the number of development rights to be purchased, location of the receiving site, proposed purchase price and the required date or dates for completion of the sale, not later than three years after the date of receipt by King County of the purchase offer.E. Payment for purchase of development rights from the TDR bank shall be in full at the time the development rights are transferred unless otherwise authorized by the department of natural resources and parks. (Ord. 19555 § 16, 2022: Ord. 19146 § 80, 2020: Ord. 17485 § 40, 2012: Ord. 15032 § 48, 2004: Ord. 14199 § 244, 2001: Ord. 14190 § 15, 2001: Ord. 13733 § 12, 2000. Formerly K.C.C. 21A.55.230).*Reviser's note: Ordinance 1[9555 referred to "section 21 of this ordinance," which was the section creating the new chapter K.C.C. 21A.48, which was apparently intended.21A.37.140 Transfer of development rights (TDR) program - requirements for transfers by the TDR bank for use in incorporated receiving areas.A. For development rights sold by the TDR bank to be used in incorporated receiving site areas, the county and the affected city or cities must either have executed an interlocal agreement and the city or cities must have enacted appropriate legislation to implement the program for the receiving area or the county and the affected city or cities must each have enacted legislation that complies with chapter 365-198 WAC.B.1. At a minimum, each interlocal agreement shall: a. [shall]* describe the legislation that the receiving jurisdiction adopted or will adopt to allow the use of development rights; b. shall identify the receiving area; c. shall require the execution of a TDR extinguishment document in conformance with K.C.C. 21A.37.080; and d. shall address the conversion ratio to be used in the receiving site area. 2. If the city is to receive any amenity funds, the interlocal agreement shall set forth the amount of funding and the amenities to be provided in accordance with K.C.C. 21A.37.150 I. Such an interlocal agreement may also indicate that a priority should be given by the county to acquiring development rights from sending sites in specified geographic areas. If a city has a particular interest in the preservation of land in a rural or resource area or in the specific conditions on which it will be preserved, then the interlocal agreement may provide for periodic inspection or special terms in the conservation easement to be recorded against the sending site as a pre acquisition condition to purchases of development rights within specified areas by the TDR bank.C. A TDR conversion ratio for development rights purchased from a sending site and transferred to an incorporated receiving site area may express the amount of additional development rights in terms of any combination of units, floor area, height or other applicable development standards that may be modified by the city to provide incentives for the purchase of development rights. (Ord. 17485 § 41, 2012: Ord. 14190 § 16, 2001: Ord. 13733 § 13, 2000. Formerly K.C.C. 21A.55.240).*Reviser’s note: Added but not underlined in Ordinance 17485. See K.C.C. 1.24.075.21A.37.150 Transfer of development rights (TDR) program - restrictions on expenditure of TDR bank funds on TDR amenities.A. Expenditures by the county for amenities to facilitate development rights sales in cities shall be authorized by the TDR executive board during review of proposed interlocal agreements, and should be roughly proportionate to the value and number of development rights anticipated to be accepted in an incorporated receiving site pursuant to the controlling interlocal agreement, in accordance with K.C.C. 21A.37.040. Expenditures by the county to fund projects in receiving areas located in urban unincorporated King County shall be authorized by the TDR executive board and should be roughly proportionate to the value and number of development rights accepted in the unincorporated urban area.B. The county shall not expend funds on TDR amenities in a city before execution of an interlocal agreement, except that: 1. The executive board may authorize up to twelve thousand dollars be spent by the county on TDR amenities before a development rights transfer for use at a receiving site or for the execution of an interlocal agreement if the TDR executive board recommends that the funds be spent based on a finding that the expenditure will expedite a proposed transfer of development rights or facilitate acceptance of a proposed transfer of development rights by the community around a proposed or established receiving site area; 2. King County may distribute the funds directly to a city if a scope of work, schedule and budget governing the use of the funds is mutually agreed to in writing by King County and the affected city. Such an agreement need not be in the form of an interlocal agreement; and 3. The funds may be used for project design renderings, engineering or other professional services performed by persons or entities selected from the King County approved architecture and engineering roster maintained by the department of finance or an affected city's approved architecture and engineering roster, or selected by an affected city through its procurements processes consistent with state law and city ordinances.C. TDR amenities may include the acquisition, design or construction of public art, cultural and community facilities, parks, open space, trails, roads, parking, landscaping, sidewalks, other streetscape improvements, transit-related improvements or other improvements or programs that facilitate increased densities on or near receiving sites.D. When King County funds amenities in whole or in part, the funding shall not commit the county to funding any additional amenities or improvements to existing or uncompleted amenities.E. King County funding of amenities shall not exceed appropriations adopted by the council or funding authorized in interlocal agreements, whichever is less.F. Public transportation amenities shall enhance the transportation system. These amenities may include capital improvements such as passenger and layover facilities, if the improvements are within a designated receiving area or within one thousand five hundred feet of a receiving site. These amenities may also include programs such as the provision of security at passenger and layover facilities and programs that reduce the use of single occupant vehicles, including car sharing and bus pass programs.G. Road fund amenities shall enhance the transportation system. These amenities may include capital improvements, such as streets, traffic signals, sidewalks, street landscaping, bicycle lanes and pedestrian overpasses, if the improvements are within a designated receiving site area or within one thousand five hundred feet of a receiving site. These amenities may also include programs that enhance the transportation system.H. All amenity funding provided by King County to cities, or to urban unincorporated receiving areas to facilitate the transfer of development rights shall be consistent with federal, state and local laws.I. The timing and amounts of funds for amenities paid by King County to each participating city shall be determined in an adopted interlocal agreement. The interlocal agreement shall set forth the amount of funding to be provided by the county, an anticipated scope of work, work schedule and budget governing the use of the amenity funds. Except for the amount of funding to be provided by the county, these terms may be modified by written agreement between King County and the city. Such an agreement need not be in the form of an interlocal agreement. Such an agreement must be authorized by the TDR executive board. If amenity funds are paid to a city to operate a program, the interlocal agreement shall set the period during which the program is to be funded by King County.J. A city that receives amenity funds from the county is responsible for using the funds for the purposes and according to the terms of the governing interlocal agreement.K. To facilitate timely implementation of capital improvements or programs at the lowest possible cost, King County may make amenity payments as authorized in an interlocal agreement to a city before completion of the required improvements or implementation programs, as applicable. If all or part of the required improvements or implementation programs in an interlocal agreement to be paid for from King County funds are not completed by a city within five years from the date of the transfer of amenity funds, then, unless the funds have been used for substitute amenities by agreement of the city and King County, those funds, plus interest, shall be returned to King County and deposited into the originating amenity fund for reallocation to other TDR projects.L. King County is not responsible for maintenance, operating and replacement costs associated with amenity capital improvements inside cities, unless expressly agreed to in an interlocal agreement. (Ord. 18427 § 14, 2016: Ord. 17485 § 42, 2012: Ord. 14190 § 17, 2001: Ord. 13733 § 14, 2000. Formerly K.C.C. 21A.55.250).21A.37.160 Transfer of development rights (TDR) program - establishment and duties of the TDR executive board.A. The TDR executive board is hereby established. The TDR executive board shall be composed of the director of the budget office, the director of the department of natural resources and parks, the director of the department of local services and the director of finance, or their designees. A representative from the King County council staff, designated by the council chair, may participate as an ex officio, nonvoting member of the TDR executive board. The TDR executive board shall be chaired by the director of the department of natural resources and parks or designee.B. The issues that may be addressed by the executive board include, but are not limited to, using site evaluation criteria established by administrative rules, ranking and selecting sending sites to be purchased by the TDR bank, recommending interlocal agreements and the provision of TDR amenities, if any, to be forwarded to the executive, identifying future funding for amenities in the annual budget process, enter into other written agreements necessary to facilitate density transfers by the TDR bank and otherwise oversee the operation of the TDR bank to measure the effectiveness in achieving the policy goals of the TDR program.C. The department of natural resources and parks shall provide lead staff support to the TDR executive board. Staff duties include, but are not limited to: 1. Making recommendations to the TDR executive board on TDR program and TDR bank issues on which the TDR executive board must take action; 2. Facilitating development rights transfers through marketing and outreach to the public, community organizations, developers and cities; 3. Identifying potential receiving sites; 4. Developing proposed interlocal agreements with cities; 5. Assisting in the implementation of TDR executive board policy in cooperation with other departments; 6. Ranking certified sending sites for consideration by the TDR executive board; 7. Negotiating with cities to establish city receiving areas with the provision of amenities; 8. Preparing agendas for TDR executive board meetings; 9. Recording TDR executive board meeting summaries; 10. Preparing administrative rules in accordance with K.C.C. chapter 2.98 to implement this chapter; and 11. Preparing periodic reports on the progress of the TDR program to the council with assistance from other departments. (Ord. 18791 § 185, 2018: Ord. 15032 § 49, 2004: Ord. 14763 § 4, 2003: Ord. 14561 § 30, 2002: Ord. 14199 § 245, 2001: Ord. 14190 § 18, 2001: Ord. 13733 § 15, 2000. Formerly K.C.C. 21A.55.260).21A.37.170 Transfer of development rights (TDR) program - exemption from surplus provisions. The transfer of development rights from the TDR bank may be completed consistent with King County's needs and in accordance with the criteria of this chapter. The transfers are exempt from the real and personal property provisions of K.C.C. chapter 4.56. (Ord. 14190 § 19, 2001: Ord. 13733 § 16, 2000. Formerly K.C.C. 21A.55.270).21A.38GENERAL PROVISIONS - PROPERTY-SPECIFIC DEVELOPMENT STANDARDS/SPECIAL DISTRICT OVERLAYSSections:21A.38.010Purpose.21A.38.020Authority and application.21A.38.030Property-specific development standards - general provisions.21A.38.040Special district overlay - general provisions.21A.38.050Special district overlay - pedestrian-oriented commercial development.21A.38.060Special district overlay - office/research park development.21A.38.080Special district overlay - UPD implementation.21A.38.100Special district overlay - North Highline commercial and industrial.21A.38.120Special district overlay - wetland management areas.21A.38.130Special district overlay - agricultural production buffer.21A.38.150Special district overlay - ground water protection.21A.38.160Special district overlay - aviation facilities.21A.38.170Special district overlay - urban aquifer protection area.21A.38.180Special district overlay - highway-oriented development.21A.38.200Special district overlay - erosion hazards near sensitive water bodies.21A.38.210Special district overlay - heron habitat protection area.21A.38.255Special district overlay - Bear Creek office and retail.21A.38.260Special district overlay - Fall City business district.21A.38.265Special district overlay – Martin Luther King Jr. Way South mixed-use special district overlay.21A.38.270Special district overlay – affordable housing in Vashon Rural Town.21A.38.275Special district overlay - Skyway microenterprise.21A.38.280Special district overlay - North Highline pedestrian-oriented.21A.38.010 Purpose. The purposes of this chapter are to provide for alternative development standards to address unique site characteristics and to address development opportunities which can exceed the quality of standard developments, by:A. Establishing authority to adopt property-specific development standards for increasing minimum requirements of this title on individual sites; orB. Establishing special district overlays with alternative standards for special areas designated by community plans or the Comprehensive Plan. (Ord. 12171 § 4, 1996: Ord. 10870 § 574, 1993).21A.38.020 Authority and application.A. This chapter authorizes King County to increase development standards or limit uses on specific properties beyond the general requirements of this title through property-specific development standards, and to carry out comprehensive plan policies and map designations and community, subarea or neighborhood plan policies through special overlay districts that supplement or modify standard zones through different uses, design or density standards or review processes;B. Property-specific development standards shall be applied to specific properties through either area zoning as provided in K.C.C. chapters 20.12 and 20.18, or reclassifications of individual properties as provided in K.C.C. chapters 20.22 and 21A.44; andC. Special district overlays shall be applied to specific properties or areas containing several properties through the area zoning process as provided in K.C.C. chapters 20.12 and 20.18. (Ord. 18230 § 135, 2016: Ord. 17841 § 54, 2014: Ord. 12823 § 2, 1997: Ord. 12809 § 3, 1997: Ord. 12171 § 5, 1996: Ord. 10870 § 575, 1993).21A.38.030 Property-specific development standards - general provisions.A. Property-specific development standards, denoted by the zoning map symbol -P after the zone's map symbol or a notation in the geographic information system data layers, shall be established on individual properties through either reclassifications or area zoning. All property-specific development standards are contained in Appendix of Ordinance 12824* as currently in effect or hereinafter amended and shall be maintained by the department of local services, permitting division, in the Property Specific Development Conditions notebook. Upon the effective date of reclassification of a property to a zone with a "-P" suffix, the property-specific development standards adopted thereby shall apply to any development proposal on the subject property subject to county review, including, but not limited to, a building permit, grading permit, subdivision, short subdivision, subsequent reclassification to a potential zone, urban planned development, conditional use permit, variance and special use permit.B. Property-specific development standards shall address problems unique to individual properties or a limited number of neighboring properties that are not addressed or anticipated by general minimum requirements of this title or other regulations.C. Property-specific development standards shall cite the provisions of this title, if any, that are to be augmented, limited, or increased, shall be supported by documentation that addresses the need for such a condition or conditions, and shall include street addresses, tax lot numbers or other clear means of identifying the properties subject to the additional standards. Property-specific development standards are limited to: 1. Limiting the range of permitted land uses; 2. Requiring special development standards for property with physical constraints (e.g. environmental hazards, view corridors); 3. Requiring specific site design features (e.g. building orientation, lot layout, clustering, trails or access location); 4. Specifying the phasing of the development of a site; 5. Requiring public facility site dedications or improvements (e.g. roads, utilities, parks, open space, trails, school sites); or 6. Designating sending and receiving sites for transferring density credits as provided in K.C.C. chapter 21A.36.D. Property-specific development standards shall not be used to expand permitted uses or reduce minimum requirements of this title. (Ord. 18791 § 186, 2018: Ord. 17485 § 45, 2012: Ord. 17420 § 115, 2012: Ord. 12824 § 21, 1997: Ord. 11621 § 97, 1994: Ord. 10870 § 576, 1993).*Available in the office of the clerk of the council.21A.38.040 Special district overlay - general provisions. Special district overlays shall be classified on the official zoning map and as a notation in the department's electronic parcel record, as follows:A. A special district overlay shall be classified through the area zoning process as provided in K.C.C. chapters 20.12 and 20.18. Classification of an overlay district shall include policies that prescribe the purposes and location of the overlay;B. A special district overlay shall be applied to land through an area zoning process as provided in K.C.C. chapters 20.12 and 20.18 and shall be indicated on the zoning map and as a notation in the department's electronic parcel record and shall be designated in Appendix B of Ordinance 12824* as maintained by the department of local services, permitting division, with the suffix "-SO" following the map symbol of the underlying zone or zones;C. The special district overlays in this chapter are the only overlays authorized by the code. New or amended overlays to carry out new or different goals or policies shall be adopted as part of this chapter and be available for use in all appropriate community, subarea or neighborhood planning areas; D. The special district overlays in this chapter may waive, modify and substitute for the range of permitted uses and development standards established by this title for any use or underlying zone;E. Unless they are specifically modified by this chapter, the standard requirements of this title and other county ordinances and regulations govern all development and land uses within special district overlays;F. A special district overlay on an individual site may be modified by property-specific development standards as provided in K.C.C. 21A.38.030;G. A special district overlay may not be deleted by a zone reclassification; andH. Special district overlay development standards may be modified or waived through the consideration of a variance, subject to the variance criteria in K.C.C. 21A.44.030. (Ord. 19146 § 81, 2020: Ord. 18791 § 187, 2018: Ord. 17841 § 55, 2014: Ord. 17420 § 116, 2012: Ord. 15051 § 216, 2004: Ord. 12823 § 3, 1997: Ord. 12809 § 4, 1997: Ord. 12171 § 6, 1996: Ord. 11621 § 98, 1994: Ord. 10870 § 577, 1993).*Available in the King County Archives.21A.38.050 Special district overlay - pedestrian-oriented commercial development.A. The purpose of the pedestrian-oriented commercial development special district overlay is to provide for high-density, pedestrian-oriented retail and employment uses. The pedestrian-oriented commercial districts shall only be established in areas designated as a center on the adopted Urban Centers map of the King County Comprehensive Plan and zoned CB, RB or O.B. Permitted uses shall be those uses permitted in the underlying zone, excluding the following: 1. Motor vehicle, boat and mobile home dealer; 2. Gasoline service station; 3. Uses with drive-through facilities, except SIC Industry Number 5812 (Eating places) in buildings existing before July 2017; 4. SIC Industry Group 598 (Fuel dealers); 5. Uses with outside storage, e.g. lumber yards, miscellaneous equipment rental or machinery sales; 6. Bulk retail; 7. Recreation/cultural uses as set forth in K.C.C. 21A.08.040, except parks, sports clubs, theaters, libraries and museums; 8. SIC Major Group 75 (Automotive repair, services and parking) except 7521 (automobile parking; but excluding tow-in parking lots); 9. SIC Major Group 76 (Miscellaneous repair services), except 7631 (Watch, clock and jewelry repair); 10. SIC Major Group 78 (Motion pictures); 11. SIC Major Group 80 (Health services), except offices and outpatient clinics (801-804); 12. SIC Industry Group 421 (Trucking and courier service); 13. Public agency archive; 14. Self-service storage; 15. Manufacturing land uses as set forth in K.C.C. 21A.08.080, except SIC Industry Code 2759 (Commercial printing); 16. Resource land uses as set forth in K.C.C. 21A.08.090; 17. SIC Industry Code 7261 (Funeral home/crematory); 18. Cemetery, columbarium or mausoleum; 19. Interim recycling facility; 20. Utility facility, except underground water, gas or wastewater pipelines; and 21. Vactor waste receiving facility.C. The following development standards shall apply to development located in pedestrian-oriented commercial overlay districts: 1. For properties that have frontage on a public street, the following conditions shall apply: a. main building entrances shall be oriented to the public street; b. at the ground floor (at grade), buildings shall be located no more than five feet from the sidewalk or sidewalk improvement, but shall not encroach on the public right-of-way. For buildings existing before August 20, 2020, with setbacks greater than five feet and that have substantial improvements made to them after August 20, 2020, a minimum five-foot-wide pedestrian walkway shall be constructed that connects the main building entrance to the public sidewalk or sidewalk improvement; c. building facades shall comprise at least seventy-five percent of the total street frontage for a property and if applicable, at least seventy-five percent of the total pedestrian route frontage for a property; d. minimum setbacks of the underlying zoning are waived; e. building facades that front onto a street shall incorporate windows into at least thirty percent of the building facade surface area and overhead protection above all building entrances and along at least fifty percent of length of the building facade, which may extend over the sidewalk if it does not impede use of the sidewalk by the public; f. ground floor building facades shall include ornamentation such as decorative architectural treatments or finishes, pedestrian scale lighting, and window and door trim; andg. buildings facades shall not be comprised of uninterrupted glass curtain walls or mirrored glass; 2. vehicle access shall be limited to the rear access alley or rear access street where such an alley or street exists; 3. Floor-to-lot area ratio shall not exceed 5:1 for nonresidential structures, not including parking structures; 4. The landscaping requirements of K.C.C. chapter 21A.16 shall apply to all new development and buildings existing before August 20, 2020, that have substantial improvements made to them after August 20, 2020; and 5. Off-street parking requirements K.C.C. 21A.18.110 and K.C.C. 21A.48.050 shall apply, except that the relief from K.C.C. 21A.18.110.A.4. that may be granted by the director shall only allow use of on-street parallel parking in front of or adjacent to the subject parcel for the parking spaces that cannot be accommodated to the rear or sides of buildings. (Ord. 19555 § 17, 2022: Ord. 19146 § 82, 2020: Ord. 18592 § 1, 2017: Ord. 13022 § 30, 1998: Ord. 12823 § 4, 1997: Ord. 10870 § 578, 1993).21A.38.060 Special district overlay - office/research park development.A. The purpose of the office/research park special district overlay is to establish an area for development to occur in a campus setting with integrated building designs, flexible grouping of commercial and industrial uses, generous landscaping and buffering treatment, and coordinated auto and pedestrian circulation plans. Office/research park districts shall only be established in areas designated within a community plan and zoned RB, O or I zones. Permitted uses shall include all uses permitted in the RB, O and I zones, as set forth in K.C.C. chapter 21A.08, regardless of the classification used as the underlying zone on a particular parcel of land.B. The following development standards shall apply to uses locating in office/research park overlay districts: 1. All uses shall be conducted inside an entirely enclosed building; 2. An internal circulation plan shall be developed to facilitate pedestrian and vehicular traffic flow between major project phases and individual developments; 3. The standards in this section shall be applied to the development as a unified site, not withstanding any division of thedevelopment site under a binding site plan or subdivision; 4. All buildings shall maintain a fifty-foot setback from perimeter streets and from rural area and residential zones; 5. The total permitted impervious lot coverage shall be eighty-percent. The remaining twenty-percent shall be devoted to open space. Open space may include all required landscaping, and any unbuildable critical areas and their associated buffers; 6. The landscaping standards in K.C.C. chapter 21A.16 are modified as follows: a. Twenty-foot wide Type II landscaping shall be provided along exterior streets, and twenty-foot wide Type III landscaping shall be provided along interior streets; b. Twenty-foot wide Type I landscaping shall be provided along property lines adjacent to rural area and residential zones; c. Fifteen-foot wide Type II landscaping shall be provided along lines adjacent to nonresidential zoned areas; and d. Type IV landscaping shall be provided within all surface parking lots as follows: (1) Fifteen percent of the parking area, excluding required perimeter landscaping, shall be landscaped in parking lots with more than thirty-parking stalls; (2) At least one tree for every four parking stalls shall be provided, to be reasonably distributed throughout the parking lot; and (3) No parking stall shall be more than forty-feet from some landscaping; e. An inventory of existing site vegetation shall be conducted pursuant to the procedures in K.C.C. chapter 21A.16, and f. An overall landscaping plan that conforms to the requirements of this subsection shall be submitted for the entire district or each major development phase before the issuance of any site development, grading or building permits; 7. Lighting within an office/industrial park shall shield the light source from the direct view of surrounding residential areas; 8. Refuse collection/recycling areas and loading or delivery areas shall be located at least one hundred feet from residential areas and screened with a solid view obscuring barrier; 9. Off street parking standards as in K.C.C. chapter 21A.18 are modified as follows: a. one space for every three hundred square feet of floor area shall be provided for all uses, except on-site daycare, exercise facilities, eating areas for employees, archive space for tenants and retail/service uses; b. parking for on-site daycare, exercise facilities, eating areas for employees, archive space for tenants, and retail/service uses shall be no less than one space for every one thousand square feet of floor area and no greater than one space for every five hundred square feet of floor area; and c. at least twenty-five percent of required parking shall be located in a parking structure; and 10. Sign standards in K.C.C. chapter 21A.20 are modified as follows: a. Signs visible from the exterior of the park shall be limited to one monument office/research park identification sign at each entrance. The signs shall not exceed an area of sixty-four square feet per sign; b. no pole signs shall be permitted; and c. all other signs shall be visible only from within the park. (Ord. 17539 § 63, 2013: Ord. 15606 § 25, 2006: Ord.11621 § 100, 1994: Ord. 10870 § 579, 1993).21A.38.080 Special district overlay - UPD implementation. Implementation of the UPD designation shall comply with the following:A. The minimum site size for an UPD permit application shall be not less than one hundred acres. "Site size" for purposes of this subsection means contiguous land under one ownership or under the control of a single legal entity responsible for submitting an UPD permit application and for carrying out all provisions of the development agreement; andB. The UPD shall comply with the standards and procedures set out in K.C.C. chapter 21A.39. (Ord. 16267 § 73, 2008: Ord. 10870 § 581, 1993).21A.38.100 Special district overlay - North Highline commercial and industrial.A. The purpose of the North Highline commercial and industrial special district overlay is to accommodate and support existing commercial and industrial areas by permitting a range of appropriate uses consistent with nearby residential areas.B. The special district overlay shall be designated only through the area zoning process and applied to areas substantially developed with a mix of commercial and light industrial uses and zoned CB, RB, O or I.C. The standards of this title and other county codes shall be applicable to development within the special district overlay except as follows: 1. Legally established commercial or industrial uses that exist within an area as of November 28, 1994, but that are not otherwise permitted by the zoning, shall be considered permitted uses upon only the lots that they occupied as of that date. 2. Permitted uses shall include those of the base zone and I zone, except that the following are not allowed: a. any use permitted in the I zone requiring a conditional use permit; b. auction houses; c. livestock sales; d. motor vehicle and boat dealers; e. SIC Major Group 24 (lumber and wood products, except furniture) except 2431 (millwork) and 2434 (wood kitchen cabinets); f. SIC Major Group 32 (stone, clay, glass and concrete products); g. SIC Industry 7534 (tire retreading); h. SIC Major Group 02 (raising livestock and small animals); i. SIC Industry 2951 (asphalt paving mixtures and blocks); j. resource accessory uses; k. outdoor storage of equipment or materials occupying more than twenty-five percent of the site associated with SIC Industry 7312 (outdoor advertising services); and l. interim recycling facilities on lots that directly abut properties outside of the special district overlay. 3. Use limitations of the base zone shall not apply to commercial/industrial accessory uses. 4. For nonresidential development, off-street parking shall be no less than twenty-five percent and no more than seventy-five percent of the minimum required in K.C.C. chapter 21A.18.D. For properties that have frontage on a pedestrian street or streets or route or routes as designated in an applicable plan or area zoning process, except for gasoline service stations (SIC 5541) and grocery stores (SIC 5411) that also sell gasoline, the following conditions shall apply: 1. Main building entrances shall be oriented to the pedestrian street; 2. At the ground floor (at grade), buildings shall be located no more than five feet from the sidewalk or sidewalk improvement, but in no instance shall encroach on the public right-of-way; 3. Building facades shall comprise at least seventy-five percent of the total pedestrian street frontage for a property, and if applicable, at least seventy-five percent of the total pedestrian route frontage for a property;4. Minimum side setbacks of the underlying zoning are waived;5. Building facades of ground floor retail, general business service and professional office land uses, that front onto a pedestrian street or route shall include windows and overhead protection; 6. Building facades, along a pedestrian street or route, that are without ornamentation or are comprised of uninterrupted glass curtain walls or mirrored glass are not permitted; and 7. Vehicle access shall be limited to the rear access alley or rear access street where such an alley or street exists. (Ord. 19555 § 18, 2022: Ord. 17191 § 1, 2011: Ord. 17037 § 1, 2011: Ord. 12823 § 7, 1997: Ord. 11567 § 1, 1994).21A.38.120 Special district overlay - wetland management areas.A. The purpose of the wetland management area special overlay district is to provide a means to designate certain unique and outstanding wetlands when necessary to protect their functions and values from the impacts created from geographic and hydrologic isolation and impervious surface.B. the following development standards shall be applied in addition to all applicable requirements of K.C.C. chapter 21A.24 to development proposals located within a wetland management area district overlay: 1. All subdivisions and short subdivisions on residentially zoned properties that are identified in an adopted basin plan for impervious surface limitations, shall have a maximum impervious surface area of eight percent of the gross acreage of the plat. For areas that are not covered by an adopted basin plan, this limit shall apply to all residentially zoned lands located within the wetland management area. Distribution of the allowable impervious area among the platted lots shall be recorded on the face of the plat. Impervious surface of existing roads need not be counted towards the allowable impervious area. This condition may be modified by the director for the minimum necessary to accommodate unusual site access conditions; 2. All subdivisions and short subdivisions on properties identified in an adopted basin plan for clustering and setaside requirements shall be required to cluster away from wetlands or the axis of corridors along stream tributaries and identified swales connecting wetlands in order to minimize land disturbance and maximize distance from these sensitive features. At least sixty-five percent of affected portions of RA-zoned properties and at least fifty percent of all other affected portions of the property shall be left in native vegetation, preferably forest, and placed in a permanent open space tract. In the absence of a basin plan, these requirements shall apply to all lands containing or adjacent to a wetland, a stream tributary corridor or a swale connecting wetlands; and 3. Clearing and grading activity from October 1 through March 31 shall meet the provisions of K.C.C. 16.82.150D wherever not already applicable. (Ord. 13307 § 1, 1998: Ord. 12823 § 14, 1997: Ord. 12809 § 5, 1997).21A.38.130 Special district overlay - agricultural production buffer.A. The purpose of the agricultural production buffer special district overlay is to provide a buffer between agricultural and upslope residential land uses. An agricultural production buffer special district overlay shall only be established in areas adjacent to an agricultural production district and zoned RA.B. The following development standard shall apply to residential subdivisions locating in an agricultural production buffer special district overlay: Lots shall be clustered in accordance with K.C.C. 21A.14.040 and at least seventy-five percent of a site shall remain as open space, unless greater lot area is required by the Seattle-King County department of public health. (Ord. 15032 § 50, 2004: Ord. 12823 § 8, 1997).21A.38.150 Special district overlay - ground water protection.A. The purpose of the ground water protection special district overlay is to limit land uses that have the potential to severely contaminate groundwater supplies and to provide increased areas of permeable surface to allow for infiltration of surface water into ground resources.B. For all commercial and industrial development proposals, at least 40 percent of the site shall remain in natural vegetation or planted with landscaping, which area shall be used to maintain predevelopment infiltration rates for the entire site. For purposes of this special district overlay, the following shall be considered commercial and industrial land uses: 1. amusement/entertainment land uses as defined by K.C.C. 21A.08.040 except golf facilities; 2. general services land uses as defined by K.C.C. 21A.08.050 except health and educational services, daycare 1, churches, synagogues, and temples; 3. government/business services land uses as defined by K.C.C. 21A.08.060 except government services; 4. retail/wholesale land uses as defined by K.C.C. 21A.08.070 except forest product sales and agricultural product sales; 5. manufacturing land uses as defined by K.C.C. 21A.08.080; and, 6. mineral extraction and processing land uses as defined by K.C.C. 21A.08.090.C. Permitted uses within the area of the ground water protection special district overlay shall be those permitted in the underlying zone, excluding the following as defined by Standard Industrial Classification number and type: 1. SIC 4581, airports, flying fields, and airport terminal services; 2. SIC 4953, refuse systems, (including landfills and garbage transfer stations operated by a public agency); 3. SIC 4952, sewerage systems (including wastewater treatment facilities); and 4. SIC 7996, amusement parks; SIC 7948, racing, including track operation; or other commercial establishments or enterprises involving large assemblages of people or automobiles except where excluded by section B above; 5. SIC 0752, animal boarding and kennel services; 6. SIC 1721, building painting services; 7. SIC 3260, pottery and related products manufacturing; 8. SIC 3599, machine shop services; 9. SIC 3732, boat building and repairing; 10. SIC 3993, electric and neon sign manufacturing; 11. SIC 4226, automobile storage services; 12. SIC 7334, blueprinting and photocopying services; 13. SIC 7534, tire retreading and repair services; 14. SIC 7542, car washes; 15. SIC 8731, commercial, physical and biological research laboratory services; 16. SIC 02, interim agricultural crop production and livestock quarters or grazing on properties 5 acres or larger in size; 17. SIC 0752, public agency animal control facility; 18. SIC 2230, 2260, textile dyeing; 19. SIC 2269, 2299, textile and textile goods finishing; 20. SIC 2700, printing and publishing industries; 21. SIC 2834, pharmaceuticals manufacturing; 22. SIC 2844, cosmetics, perfumes and toiletries manufacturing; 23. SIC 2893, printing ink manufacturing; 24. SIC 3000, rubber products fabrication; 25. SIC 3111, leather tanning and finishing; 26. SIC 3400, metal products manufacturing and fabrication; 27. SIC 3471, metal electroplating; 28. SIC 3691, 3692, battery rebuilding and manufacturing; 29. SIC 3711, automobile manufacturing; and 30. SIC 4600, petroleum pipeline operations. (Ord. 12823 § 10, 1997).21A.38.160 Special district overlay - aviation facilities.A. The purpose of the aviation facilities special district overlay is to protect existing non-commercial airports from encroaching residential development. An aviation facilities special district overlay shall only be established in the area up to 1/4 mile around airports and shall be zoned UR or RA.B. The following development standards shall apply to uses locating in aviation facilities special overlay districts:On the title of all properties within pending short subdivisions or subdivisions and binding site plans, the following statement shall be recorded and be shown to all prospective buyers of lots or homes:"This property is located near the (name of airport) which is recognized as a legitimate land use by King County. Air traffic in this area, whether at current or increased levels, is consistent with King County land use policies provided it conforms to all applicable state and federal laws." (Ord. 12823 § 11, 1997).21A.38.170 Special district overlay - urban aquifer protection area.A. The purpose of the urban aquifer protection area special district overlay is to provide additional protection for urban areas that are highly susceptible to ground water contamination. An urban aquifer protection area special district overlay shall only be established within areas designated in the comprehensive plan as highly susceptible to ground water contamination, including the surrounding area up to 1/2 mile, and zoned UR, R, NB, CB, O, and I. B. Permitted uses shall be those permitted in the underlying zone, excluding the following as defined by Standard Industrial Classification (SIC) number and type: 1. SIC 4953, refuse systems (including hazardous waste recycling or treatment and solid waste landfills); 2. SIC 461, pipelines, except natural gas (including petroleum pipelines); and 3. businesses maintaining open storage of toxic substances.C. New septic tank drainfield systems shall be prohibited. (Ord. 12823 § 12, 1997).21A.38.180 Special district overlay - highway-oriented development.A. The purpose of the highway-oriented development special district overlay is to ensure the compatibility of highway-oriented land uses adjacent to rural residential and resource land uses. A highway-oriented special district overlay shall only be established along existing or former state or U.S. highway route corridors and zoned RA, UR, NB, RB or I.B. Except in the RB zone at highway interchanges, permitted uses in the RA, UR, NB, RB or I zones shall be those in the underlying zone, excluding the following as defined by Standard Industrial Classification (SIC) number and type: 1. SIC 5812, eating places; and 2. SIC 5813, drinking places.C. Permitted uses in the RB zone at highway interchanges shall be limited to the following highway oriented commercial services for the traveling public, as defined by Standard Industrial Classification (SIC) number and type: 1. SIC 5411, grocery stores (including convenience stores); 2. SIC 5541, gasoline service stations; 3. SIC 5812, eating places; and 4. SIC 7011, hotels and motels.D. The following development standards shall apply to uses located in highway-oriented overlay districts: 1. Business signs are limited to those allowed in the NB zone classification. Ground supported signs shall not exceed five feet in height. 2. Natural vegetation shall be retained wherever possible, and landscaping shall be used for screening. The following commercial screening matrix shall be applied where NB, RB and I zoned properties, and properties with potential NB, RB or I zoning, have common boundaries with rural or resource zoned lands. The purpose of this is to allow for adequate buffering between commercial or industrial and rural land mercial Screening MatrixCommercial Property ZoningAdjacent Property ZoningNBNeighborhood BusinessRBRegionalBusinessIIndustrialRA(Rural Area)Type I Buffer30’ DepthType I Buffer30’ DepthType I Buffer50’ DepthF (Forest)A (Agricultural)Type I Buffer30’ DepthType I Buffer50’ DepthType I Buffer50’ Depth 3. Primary vehicular access shall be from a principal arterial road. Secondary vehicular access shall be from a collector arterial road. 4. At the time of site plan review, the county may require additional right-of-way dedication to provide new roadways. 5. Utilities in RB zones shall be placed underground. 6. All uses shall be evaluated for impacts to ground water quality. (Ord. 12823 § 13, 1997).21A.38.200 Special district overlay - erosion hazards near sensitive water bodies.A. The purpose of the erosion hazards near sensitive water bodies special overlay district is to provide a means to designate sloped areas posing erosion hazards which drain directly to lakes or streams of high resource value which are particularly sensitive to the impacts of increased erosion and the resulting sediment loads from development.B. The following development standards shall be applied in addition to all applicable requirements of K.C.C. 21A.24 to development proposals located within erosion hazards near a sensitive water bodies district overlay: 1. A no-disturbance area shall be established on the sloped portion of the special district overlay to prevent damage from erosion. Land clearing or development shall not occur in the no-disturbance area, except for the clearing activities listed in subsection a. Clearing activities listed in subsection a shall only be permitted if they meet the requirements of subsection b. a. Clearing activities may be permitted as follows: i. for the construction of single family residences on pre-existing separate lots; ii. for the construction of utility corridors to service existing development along existing rights-of-way including any vacated portions of otherwise contiguous rights-of-way; iii. for the construction of roads providing sole access to buildable property and associated utility facilities within those roadways; or iv. for the construction of development within an isolated no-disturbance area of two acres or less in size. The isolated no-disturbance area is either geologically separated from other no-disturbance areas or lies completely within a separate drainage subbasin and is, therefore, hydrologically isolated from the rest of the no-disturbance area. b. The clearing activities listed in subsection a. may be permitted only if the following requirements are met: i. a report which meets the requirements of K.C.C. 21A.24.120 shall show that the clearing activities will not subject the area to risk of landslide or erosion and that the purpose of the no-disturbance area is not compromised in any way; ii. the clearing activities shall be mitigated, monitored and bonded consistent with the mitigation requirements applicable to sensitive areas regulated in K.C.C. 21A.24; iii. the clearing activities are limited to the minimal area and duration necessary for construction; and iv. the clearing activities are consistent with K.C.C. 21A.24. 2. The upslope boundary of the no-disturbance area lies at the first obvious break in slope from the upland plateau over onto the steep valley walls. The downslope boundary of this zone includes those areas designated as erosion or landslide hazard areas pursuant to K.C.C. 21A.24.220 and 21A.24.280. The sensitive areas folio indicates the general location of these hazard areas, but it cannot be used to specify the areas' precise boundaries. Maps of the approximate boundaries of these no-disturbance zones shall be available at the department. Single family or multi-family residential density from the no-disturbance area may be reallocated onto any buildable portion of the site pursuant to K.C.C. 21A.12.080, or transferred to other sites pursuant to K.C.C. 21A.36; 3. New development proposals for sites which drained predeveloped runoff to the no-disturbance zone shall evaluate the suitability of onsite soils for infiltration. All runoff from newly constructed impervious surfaces shall be retained on-site unless this requirement precludes the ability to meet minimum density requirements in K.C.C. 21A.12. When minimum density cannot be met, runoff shall be retained on-site as follows: a. Infiltration of all site runoff shall be required in granular soils as defined in the King County Surface Water Design Manual. b. Infiltration of downspouts shall be required in granular soils and in soil conditions defined as allowable in the Surface Water Design Manual when feasible to fit the required trench lengths onsite; c. When infiltration of downspouts is not feasible, downspout dispersion trenches shall be required when minimum flow paths defined in the Surface Water Design Manual can be met onsite or into adjacent open space; and d. When dispersion of downspouts is not feasible, downspouts shall be connected to the drainage system via perforated pipe. 4. For the portions of proposed subdivisions, short subdivisions and binding site plans that cannot infiltrate runoff up to the 100-year peak flow, at least 25 percent shall remain undisturbed and set aside in an open space tract consistent with K.C.C. 21A.24.150-180; and 5. For the portions of all development proposals that cannot infiltrate runoff up to the 100-year peak flow, no more than 35 percent of the gross site area shall be covered by impervious surfaces. For new subdivisions and short subdivisions, maximum lot coverage should be specified for subsequent residential building permits on individual lots. 6. If the application of this section would deny all reasonable use of property, the applicant may apply for a reasonable use exception pursuant to K.C.C. 21A.24.070B. 7. The director may modify the property specific development standards required by B.1 through B.5 of this section, when a development proposal complies with the following: a. The proposed development is subject to public/private partnerships such as an approved community block grant or other such water quality program designed to improve water quality in the basin, b. The proposed development is designated by King County, in consultation with the Lake Sammamish Management Committee, as a demonstration project designed to implement best management practices and state of the art technology that assures the greatest possible improvement to water quality, and c. A site specific study is conducted by the applicant and approved by the director, which demonstrates that the proposed development substantially increases water quality by showing the following: (1) water quality on-site is improved; (2) the development project will not subject downstream channels to increased risk of landslide or erosion; (3) the development project will not subject the nearest sensitive water body to additional erosion hazards; and (4) the project is consistent with element a. and b. above, and provides predictable improvements to the water quality of Lake Sammamish. (Ord. 12823 § 15, 1997).21A.38.210 Special district overlay - heron habitat protection area.A. The purpose of the heron habitat protection area special district overlay is to provide a means to designate areas that provide essential feeding, nesting and roosting habitat for identified great blue heron rookeries. A district overlay will usually contain several isolated areas of known heron habitat in the general region surrounding the heron rookery.B. The following development standards shall be applied in addition to all applicable requirements of K.C.C. chapter 21A.24 and Title 25 to development proposals located within a heron habitat protection area district overlay: 1. The following conditions shall apply to the wetland or along the main channel of the stream riparian zone containing the heron rookery (tributary streams are excluded): a. The one-hundred-year floodplain shall be left undisturbed. Development proposals on individual lots shall require the one-hundred-year floodplain to retain the native vegetation and be placed in a county-approved conservation easement or notice shall be placed on the title of the lot. The notice shall be approved by King County and filed with the records and licensing services division. The notice shall inform the public of the presence and location of the floodplain and heron habitat on the property and that limitations on actions in or affecting the area exist. Subdivisions, short subdivisions and binding site plans shall require the one-hundred-year floodplain to retain the native vegetation and be placed in a critical areas tract, to be dedicated to the homeowner's association or other legal entity that assumes maintenance and protection of the tract. Determination of the floodplain shall be done for each permit application based on actual field survey using county-approved floodplain elevations; b. There shall be a six-hundred-sixty-foot radius buffer maintained around the periphery of the great blue heron rookery. If the critical areas and buffers are not adequate to provide the radius, then the buffer shall be expanded to meet the requirement. A rookery and its buffer shall be designated as critical area tract, easement or noticed on title as required in this subsection; and c. All access shall be restricted under nest trees from February 15 to July 31 and noted on signage at the floodplain or buffer edge, whichever is further from the rookery. Access may be further restricted with fencing or dense plantings with native plant material approved by the county. All developments in R-12 or higher density zones shall restrict access and provide an interpretive sign that provides information about the stream or wetland and its wildlife, biological, and hydrological functions. All signs shall be consistent with critical area signage requirements and subject to review and approval of the county; 2. Subdivisions, short subdivisions, binding site plans, site development permits or other commercial or multifamily permits adjacent to stream reaches and wetlands designated on the heron habitat protection area district overlay map, shall provide buffers that are fifty feet greater than required pursuant to K.C.C. chapter 21A.24 along those streams and wetlands to provide habitat for herons. This additional fifty-foot buffer shall be planted with dense native plant material to discourage human intrusion into feeding or nesting and roosting areas. Plantings shall be reviewed and approved by the department. If conformance with the additional buffer requirement results in an unbuildable lot, then the minimum variation necessary to accommodate the proposed development shall be determined in consultation with county biologists and be reviewed and approved by the department; 3. Along the shoreline of lakes and river corridors included in the heron habitat protection area, all subdivisions, short subdivisions, binding site plans, site development permits or other commercial or multifamily permits shall provide a fifty-foot buffer in addition to required shoreline setbacks of K.C.C. Title 25 and chapter 21A.24. Along the shoreline of the major rivers (Sammamish, Green, Cedar, Snoqualmie, Snohomish, Skykomish and White rivers), the setback requirement may be waived if a special wildlife study shows no great blue heron nesting, roosting and feeding areas on the site. These studies shall be done by a wildlife biologist and approved by county biologists. This additional fifty-foot buffer shall be planted with dense native plant material to discourage human intrusion into feeding or nesting and roosting areas. Plantings shall be reviewed and approved by the department; and 4. New docks, piers, bulkheads and boat ramps constructed within the heron habitat protection area shall mitigate for loss of heron feeding habitat by providing enhanced native vegetation approved by the county adjacent to the development or between the development and the shoreline. Bulkheads shall be buffered from the water's edge by enhanced plantings of native vegetation approved by the county. (Ord. 15971 § 99, 2007: Ord. 15606 § 26, 2006: Ord. 12823 § 16, 1997).21A.38.255 Special district overlay - Bear Creek office and retail.A. The purpose of the Bear Creek office and retail special district overlay is to provide additional commercial opportunities to support area residents and the local economy and to provide retail options for employees of the office zones.B. Allowed uses within the special district overlay shall be those uses allowed in the office zone in K.C.C. chapter 21A.08 and the following permitted land uses: 1. Building materials and hardware stores; 2. Retail nursery, garden center and farm supply stores; 3. Department and variety stores; 4. SIC Major Group 54 - Food stores; 5. SIC Industry Group 553 - Auto supply stores; 6. SIC Industry Group 554 - Gasoline service stations; 7. SIC Major Group 56 - Apparel and accessory stores; 8. Furniture and home furnishings stores; 9. SIC Major Group 58 - Eating and drinking places; 10. Drug store; 11. SIC Industry Group 592 - Liquor stores; 12. SIC Industry Group 593 - Used goods: antiques/secondhand shops; 13. Sporting goods and related stores; 14. Book, stationary, video and art supply stores, except adult use facilities; 15. Jewelry stores; 16. Hobby, toy and games shops; 17. Photographic and electronic shops; 18. Fabric shops; 19. Florist shops; 20. Personal medical supply stores; 21. Pet shops; and 22. General services - Daycare II. (Ord. 19146 § 85, 2020).21A.38.260 Special district overlay - Fall City business district.A. The purpose of the Fall City business district special district overlay is to allow commercial development in Fall City to occur with on-site septic systems until such time as an alternative wastewater system is available. The special district shall only be established in areas of Fall City zoned CB and shall be evaluated to determine if it is applicable to other rural commercial centers.B. The standards of this title and other county codes shall be applicable to development within the Fall City business district special district overlay except as follows: 1. The permitted uses in K.C.C. Chapter 21A.08 do not apply and are replaced with the following: a. Residential land uses as set forth in K.C.C. 21A.08.030: i. As a permitted use: (A) Multifamily residential units shall only be allowed on the upper floors of buildings; and (B) Home occupations under K.C.C. chapter 21A.30; ii. As a conditional use: (A) Bed and Breakfast (five rooms maximum); and (B) Hotel/Motel. b. Recreational/cultural land uses as set forth in K.C.C. 21A.08.040: i. As a permitted use: (A) Library; (B) Museum; (C) Arboretum; and (D) Park. ii. As a conditional use: (A) Sports Club/Fitness Center; (B) Amusement/Recreation Services/Arcades (Indoor); (C) Bowling Center c. General services land uses as set forth in K.C.C. 21A.08.050: i. As a permitted use: (A) General Personal Services, except escort services; (B) Funeral Home; (C) Appliance/Equipment Repair; (D) Medical or Dental Office/Outpatient Clinic; (E) Medical or Dental Lab; (F) Day Care I; (G) Day Care II; (H) Veterinary Clinic; (I) Social Services; (J) Animal Specialty Services; (K) Artist Studios; (L) Nursing and Personal Care Facilities; ii. As a conditional use: (A) Theater (Movie or Live Performance); (B) Religious Use; d. Government/Business services land uses as set forth in K.C.C. 21A.08.060: i. As a permitted use: (A) General Business Service; (B) Professional Office: Bank, Credit Union, Insurance Office. ii. As a conditional use: (A) Public Agency or Utility Office; (B) Police Substation; (C) Fire Station; (D) Utility Facility; (E) Self Service Storage; e. Retail/commercial land uses as set forth in K.C.C. 21A.08.070: i. As a permitted use on the ground floor: (A) Food Store; (B) Drug Store/Pharmacy; (C) Retail Store: includes florist, book store, apparel and accessories store, furniture/home furnishings store, antique/recycled goods store, sporting goods store, video store, art supply store, hobby store, jewelry store, toy store, game store, photo store, electronic/appliance store, fabric shops, pet shops, and other retail stores (excluding adult-only retail); (D) Eating and Drinking Places, including coffee shops and bakeries; (E) Remote tasting rooms. ii. As a conditional use: (A) Liquor Store or Retail Store Selling Alcohol; (B) Hardware/Building Supply Store; (C) Nursery/Garden Center; (D) Department Store; (E) Auto Dealers (indoor sales rooms only); f. Manufacturing land uses as set forth in K.C.C. 21A.08.080 are not allowed. g. Resource land uses as set forth in K.C.C. 21A.08.090: i. As a permitted use: (A) Solar photovoltaic/solar thermal energy systems; (B) Private storm water management facilities; (C) Growing and Harvesting Crops (within rear/internal side yards or roof gardens, and with organic methods only); (D) Raising Livestock and Small Animals (per the requirements of Section 21A.30 of the Zoning Code) ii. As a conditional use: Wind Turbines h. Regional land uses as set forth in K.C.C. 21A.08.100 with a special use permit: Communication Facility. 2. The densities and dimensions set forth in K.C.C. chapter 21A.12 apply, except as follows: a. Residential density is limited to six dwelling units per acre. For any building with more than ten dwelling units, at least ten percent of the dwelling units shall be classified as affordable under 21A.34.040F.1; b. Buildings are limited to two floors, plus an optional basement; c. The elevation of the ground floor may be elevated a maximum of six feet above the average grade of the site along the front facade of the building; d. If the ground floor is designed to accommodate non-residential uses, the elevation of the ground floor should be placed near the elevation of the sidewalk to minimize the need for stairs and ADA ramps; e. If the ground floor is designed to accommodate non-residential space, the height of the ceiling, as measured from finished floor, shall be no more than eighteen feet; f. Building height shall not exceed forty feet, as measured from the average grade of the site along the front facade of the building. (Ord. 19146 § 84, 2020: Ord. 19030 § 27, 2019: Ord. 17485 § 43, 2012).21A.38.265 Special district overlay – Martin Luther King Jr. Way South mixed-use special district overlay.A. The purpose of the Martin Luther King Jr. Way South mixed-use special district overlay is to facilitate linkages to the existing Martin Luther King Jr Way South Neighborhood Business Center, incentivize commercial opportunities close to existing high-density housing, incentivize commercial development by allowing more uses than traditionally found in mixed-use developments and provide flexibility in current square footage limitations.B. The following development standards shall be applied to all development proposals within the Martin Luther King Jr. Way South mixed-use special district overlay: 1. New buildings shall be limited to mixed-use as defined in K.C.C. 21A.06.753; 2. A professional office as defined in K.C.C. 21A.06.910 is an allowed use as part of a mixed-use building in subsection B.1. of this section; and 3. Any nonresidential component of the building that is personal services allowed in the zone under K.C.C. 21A.08.050 or retail use allowed in the zone under K.C.C. 21A.08.070 shall comply with K.C.C. 21A.12.230, except that K.C.C. 21A.12.230.A., B. and C. do not apply to the development. (Ord. 19146 § 83, 2020).21A.38.270 Special district overlay – affordable housing in Vashon Rural Town.A. The purpose of the affordable housing special district overlay is to provide an optional incentive that will lead to an increase in the supply of affordable housing within the Vashon Rural Town. This special district overlay shall only apply on a voluntary basis to the parcels shown in Map Amendment #3 in Attachment B of Ordinance 18623*. Use of the special district overlay is voluntary and these eligible parcels retain all existing development and land use rights and may exercise those without using this special district overlay.B. The special district overlay is eligible to be used by any residential or mixed use development that complies with the following standards: 1. A minimum of fifty percent of the units in each development shall be affordable to households with incomes at or below sixty percent of area median income, and the remainder of the units in each development shall be affordable to households with incomes up to a maximum of eighty percent of area median income; 2.a. Rents of rental units, including both rent and the average cost of essential utilities, shall be set at no greater than thirty percent of the maximum gross income for the applicable income level; or b. The sales price of owner occupied units shall be set so that they are affordable for income and asset qualified home buyers at the applicable income level. Prices shall be restricted based on typical underwriting ratios and other lending standards; 3. The development is located on an eligible parcel as shown in Map Amendment #3 in Attachment B to Ordinance 18623*; and 4. The development adheres to all special district overlay standards listed in subsection C. of this section.C. All development shall comply with all applicable King County development regulations, including K.C.C. Title 9, K.C.C. Title 13, K.C.C. Title 14, K.C.C. Title 16, K.C.C. Title 17, K.C.C. Title 19A, K.C.C. Title 20, K.C.C. Title 21A, K.C.C. Title 23, K.C.C. Title 27 and K.C.C. Title 27A, except as follows: 1. The maximum density shall be as follows: a. any parcel zoned R-1 may develop up to a maximum density of four dwelling units per acre; b. any parcel zoned R-4 may develop up to a maximum density of eight dwelling units per acre; c. any parcel zoned R-8 or R-12 may develop up to a maximum density of eighteen dwelling units per acre; d. any mixed use development in the Community Business (CB) zone that contains a residential component may develop up to a maximum density of eighteen dwelling units per acre; 2. To reduce the impacts of a new development on potable water supplies, the development shall incorporate at least three of the following water conservation measures, and that only one of the outdoor measures from subsection C.3.a. through h. of this section may be counted toward the minimum requirement: a. mulch landscape beds with two inches organic mulch; b. use grass type requiring less irrigation and minimal maintenance; c. use Xeriscape landscape techniques on seventy-five percent or more of site landscaped area; d. landscape with plants appropriate for site topography and soil types, emphasizing use of plants with low watering requirements, which means they are drought tolerant; e. install subsurface or drip systems for irrigation with timers; f. install a rainwater collection system, such as a cistern, that reduces water consumption for irrigation by fifty percent annually; g. provide one-hundred percent of landscaping water use with captured precipitation or reused water purified without the use of chemicals; h. install smart scheduling technology. This strategy counts for a maximum reduction of thirty percent provided all landscape water use is controlled by a soil moisture sensor control system or a weather-based irrigation control system; i. reduce total indoor and outdoor water consumption by at least twenty-five percent over standard practices; j. provide water submetering for each unit or entire building where central hot water systems are used; k. install all bathroom faucets with 1.5 gallons per minute or better; l. install all showerheads not to exceed 1.75 gallons per minute; m. install all kitchen faucets not to exceed two gallons per minute; n. install high efficiency toilets not to exceed 1.28 gallons per flush or 1.6/1.1 for dual flush; o. install no-cartridge waterless urinals or 1/8 gallon urinals and high efficiency toilets as noted above in all common areas; or p. install point-source, on-demand or recirculation pump hot water systems, where appropriate; 3. All new units must connect to public water and public sewer; 4. Affordable housing units shall remain as affordable housing for a minimum of fifty years for ownership affordable housing units and for a minimum of thirty years for rental affordable housing units, starting from the date of final certificate of occupancy for the development; 5. Developments shall be landscaped as follows: a. when seventy-five percent or more of the units in the development consists of townhouses or apartments, the development shall provide perimeter landscaping and tree retention in accordance with K.C.C. chapter 21A.16 for townhouse or apartment projects; b. when less than seventy-five percent of the units in the development consists of townhouses or apartments, the development shall provide landscaping and tree retention in accordance with K.C.C. chapter 21A.16 for townhouses or apartments on the portion or portions of the development containing the units, but if buildings containing the units are more than one hundred feet from the development’s perimeter, the required landscaping may be reduced by fifty percent; and c. all other portions of the development shall provide landscaping or retain trees in accordance with K.C.C. chapter 21A.16; 6. Developments shall provide one off-street parking space per unit. The director may require additional parking, up to the maximum standards for attached dwelling units, which may be provided in common parking areas. Off-street parking may be reduced below one per unit, with the approval of the director, with submission of a site-specific parking study that demonstrates that parking demand is met; and 7. All developments shall provide on-site recreation space at a minimum of fifty percent of the levels required in K.C.C. chapter 21A.14.D. Use of the incentive in this section requires an affordable housing covenant recorded against the property as a condition of issuance of any construction permit or recording of a subdivision.E. The department is authorized to enforce the requirements of this section, including those pertaining to sale and rental affordability and other requirements of the covenant, through judicial action or administrative action under Title 23.F. A preapplication meeting shall be required for developments using the special district overlay in this section.G. As part of the preapplication process and before filing an application with the department, the applicant shall hold at least one community meeting in accordance with K.C.C. 20.20.035. In addition to the requirements of K.C.C. 20.20.035, the applicant shall: 1. Include in the mailed notice: a. the name of the affordable housing developer; b. the total number of planned dwelling units; c. preliminary architectural renderings of buildings; d. preliminary site plan; e. the dates, times and locations of community informational meetings about the development; f. contact information including names and phone numbers for the developer or applicant; and g. a county contact person or agency; 2. Conduct the meeting or meetings in a location accessible to the public at least thirty days before the anticipated date of application. The purpose of the meeting is to provide neighboring property owners and residents with information regarding the proposed development and to answer questions regarding the proposed development; and 3. Prepare and install a four-foot notice board that must be placed in a conspicuous location on the property proposed for development. The board shall be installed no later than the date the mailed notice for the community meeting is sent and shall remain in place until the development application is abandoned or when the permit is issued.H. An application for a development under the special district overlay in this section shall be considered complete when the information required under K.C.C. 20.20.040, as well as the following information and studies have been submitted and are adequate to review the proposal: 1. A proposed development plan and draft covenant that includes: a. the number of dwelling units that are part of the development; b. a description of the affordability levels for the units; c. the duration of the affordability of the units; d. the number of off-street parking spaces, and documentation of the director’s decision on any requests to reduce the number of spaces; e. the requirements and process for income limits and income verification, in accordance with federal, state and county standards; f. the specific water and energy conservation measures proposed; g. the consequence of any failure to satisfy the requirements of the covenant, which consequences shall include, but not be limited to, specific performance and disgorgement of any revenue that resulted from a rental or sale price that exceed that allowed by the covenant; and h. an acknowledgement that King County can enforce the covenant through a judicial action or K.C.C. Title 23; and 2. Any necessary information identified through the preapplication process. (Ord. 18623 § 9, 2017).*Available in the King County Archives.21A.38.275 Special district overlay - Skyway microenterprise.A. The purpose of the Skyway microenterprise special district overlay is to promote small-scale commercial opportunities and provide for pedestrian-oriented retail and service commercial areas that complement and link to nearby CB zones. The special district overlay shall only be established in the Skyway-West Hill subarea geography, areas designated as an unincorporated center on the adopted Urban Centers map of the King County Comprehensive Plan and on properties zoned NB or O.B. In addition to the development standards in this title, the following development standards shall also apply to commercial development within the special district overlay. Where a conflict exists, the following standards shall apply: 1. Commercial space per tenant shall not be larger than one thousand square feet in size; 2. Parking shall comply with the standards of K.C.C. chapter 21A.18, except that: a. required off-street parking and access shall be to rear or side of building; and b. on-street parking within two hundred and fifty feet of the site may be counted toward the off-street parking requirement for the commercial uses; 3. Permitted uses shall be those uses permitted in the underlying zone, excluding the following: a. automotive repair; b. automotive service; c. gasoline service stations; d. uses with drive-through facilities; e. vactor waste receiving facility; f. self-service storage; g. cemetery, columbarium or mausoleum; h. automobile parking, unless accessory to a permitted primary use occurring on the property; and i. interim recycling facility; and 4. In addition to the uses permitted in the underlying zone, the following uses shall also be permitted: a. apparel and accessory stores; b. furniture and home furnishings stores; c. Used goods: antiques/secondhand shops; and d. Jewelry stores. (Ord. 19555 § 19, 2022).21A.38.280 Special district overlay - North Highline pedestrian-oriented.A. The purpose of the North Highline pedestrian-oriented special district overlay is to require pedestrian-oriented development that facilitates walkability and connectivity between commercial areas and community amenities in North Highline's downtown core.B. In addition to the development standards in this title, the following development standards shall also apply to new and substantially improved development within the special district overlay. Where a conflict exists, the following standards shall apply: 1. Main building entrances shall be oriented to a public street; 2. At the ground floor, also known as "at grade," buildings shall be located no more than five feet from the sidewalk or sidewalk improvement, but shall not encroach on the public right-of-way; 3. Building facades shall comprise at least seventy-five percent of the total street frontage for a property; 4. Building facades shall include windows and overhead protection; 5. Building facades that are without ornamentation or are comprised of uninterrupted glass curtain walls or mirrored glass are not permitted; and 6. Vehicle access shall be limited to the rear access alley where such an alley exists.C. For nonresidential development, off-street parking shall be no less than twenty-five percent and no more than seventy-five percent of the minimum required in K.C.C. chapter 21A.18.D. Marijuana processors and producers are not allowed uses (Ord. 19555 § 20, 2022).21A.39GENERAL PROVISIONS - URBAN PLANNED DEVELOPMENTSSections:21A.39.010Urban Planned Development (UPD) permit - Purpose.21A.39.020UPD permit - application and review process.21A.39.030UPD permit - conditions of approval.21A.39.040UPD permit - Development agreement.21A.39.050UPD standards - Land uses.21A.39.060UPD standards - Affordable housing.21A.39.070UPD standards - On-site recreation.21A.39.080UPD standards - Transportation, road and school adequacy.21A.39.090UPD standards - Water and sewer service.21A.39.100UPD standards - Road design.21A.39.110UPD standards - Storm water management design.21A.39.120UPD standards - Applicability of other zoning code provisions.21A.39.130Latecomer agreements and fair share.21A.39.200Fully contained community (FCC) - Permit.21A.39.010 Urban Planned Development (UPD) permit - Purpose. The purpose of the urban planned development (UPD) permit process and standards set out in this chapter is to:A. Establish the UPD permit as the mechanism for standardized and consolidated review to implement a UPD;B. Establish conditions for the UPD to be complied with by all subsequent land use approvals implementing the UPD;C. Coordinate infrastructure and project phasing to the adequacy of public services;D. Implement open space protection specifically tailored to the UPD;E. Establish a specific range and intensity of land uses for the UPD, tailored to fit the site; andF. Provide diversity in housing types and affordability within UPDs.G. Promote site design that it supports and encourage the use of transit. (Ord. 10870 § 582, 1993).21A.39.020 UPD permit - application and review process.A. King County shall accept an application for an UPD permit only in areas designated urban by the comprehensive plan and contained within the boundaries of UPD Special District Overlays designated by a community plan or comprehensive plan, provided that density transfer from adjacent rural lands is allowed as provided for in K.C.C. chapter 21A.36.B. A UPD permit application, or modifications of an approved UPD permit that requires council review, shall be reviewed pursuant to the hearing examiner process outlined in K.C.C. chapter 21A.42, provided that: 1. The review of the UPD permit application shall not be completed until applicable sewer and/or water comprehensive utility plans or plan amendments are identified; 2. A UPD permit may be processed concurrently with any application for a subsequent development approval implementing the UPD permit.C. A processing memorandum of understanding (MOU) shall be adopted containing any of the following elements: 1. Schedule for processing including timelines for EIS, drainage master plan, UPD permit hearings, plats or other permits or approvals; 2. Budget for permit processing and review; 3. Establishment of a core UPD review team with one representative from each county department having a principal UPD permit review role. The department responsible for coordinating review of the UPD shall enter into memorandums of understanding with other county departments specifying special tasks and timetables consistent with the schedule for performance by each department and/or independent consulting; 4. Retention of a third-party facilitator at the applicant's cost to assist the county's review; 5. Establishment of baseline monitoring requirements and design parameters that are to apply under existing law during the UPD application and review process; 6. Final scope for EIS, that shall be adjusted for adopted county substantive environmental or mitigation requirements that will apply to the UPD permit such as K.C.C. chapter 21A.24, the SWM Manual, road and school adequacy standards, impact fee or mitigation programs or other adopted standards.D. The processing MOU shall be completed initially within ninety days after the request by a UPD permit applicant, unless the county and applicant agree to a different time. If the county and applicant have not reached agreement within ninety days, then either may request final resolution of the processing MOU by a committee consisting of the department of local services permitting division manager and the director of the department of natural resources and parks or designees;E. The county shall prepare a UPD application form consistent with the information required under K.C.C. 21A.39.030, that shall take into account that detailed information that may not be available at the time of the application will be developed through the environmental impact statement and review process. (Ord. 18791 § 188, 2018: Ord. 17420 § 117, 2012: Ord. 15606 § 28, 2006: Ord. 14199 § 238, 2001: Ord. 11621 § 101, 1994: Ord. 10870 § 583, 1993).21A.39.030 UPD permit - conditions of approval.A. In approving a UPD permit, conditions of approval shall at a minimum establish: 1. A site plan for the entire UPD showing locations of critical areas and buffers, required open spaces, UPD perimeter buffers, location and range of densities for residential development and location and size of nonresidential development; 2. The expected buildout time period for the entire project and the various phases; 3. Project phasing and other project-specific conditions to mitigate impacts on the environment, on public facilities and services including transportation, utilities, drainage, police and fire protection, schools and parks; 4. Affordable housing requirements; 5. Road and storm water design standards that shall apply to the various phases of the project; 6. Bulk design and dimensional standards that shall be implemented throughout subsequent development within the UPD; 7. The size and range of uses authorized for any nonresidential development within the UPD; 8. The minimum and maximum number of residential units for the UPD; and 9. Any or both sewer and water comprehensive utility plans or amendments required to be completed before development can occur; and 10. Provisions for the applicant's surrender of an approved UPD permit before commencement of construction or cessation of UPD development based upon causes beyond the applicant's control or other circumstances, with the property to develop thereafter under the base zoning in effect prior to the UPD permit approval.B. A UPD permit and development agreement may allow development standards different from those otherwise imposed under the King County Code, including, but not limited to, K.C.C. 21A.39.050, 21A.39.060, 21A.39.070, 21A.39.080, 21A.39.090, 21A.39.100, 21A.39.110 and 21A.39.120, in order to provide flexibility to achieve public benefits, respond to changing community needs, and encourage modifications that provide the functional equivalent or adequately achieve the purposes of county standards. Any approved development standards that differ from those in the King County Code shall not require any further zoning reclassification, variance from King County standards or other county approval apart from the UPD permit approval. The development standards as approved through the UPD permit and development agreement shall apply to and govern the development and implementation of each UPD site in lieu of any conflicting or different standards or requirements elsewhere in the King County Code.C. Subsequently adopted standards that differ from those of the UPD permit shall apply to the UPD only where necessary to address imminent public health and safety hazards or where the UPD permit specifies a time period or phase after which certain identified standards can be modified. Determination of the appropriate standards for future phases that are not fully defined during the initial approval process may be postponed. Building permit applications shall be subject to the building codes in effect when the permit is applied for.D. An approved UPD permit, including site plan elements or conditions of approval, may be amended or modified at the request of the applicant or the applicant's successor in interest designated by the applicant in writing. The director may administratively approve minor modifications to an approved UPD permit. Modifications that do not qualify as minor shall be deemed major modifications and shall be reviewed in the same manner as that in K.C.C. 21A.39.020 for new UPD permit applications. Any increase in the total number of dwelling units in a UPD above the maximum number in the approved UPD permit, or any decrease in the minimum density for residential areas of the UPD (exclusive of roads and critical areas), shall be deemed major modifications. The county through the development agreement for an approved UPD may specify additional criteria for determining whether proposed modifications are major or minor.E. Unless otherwise provided for through the UPD permit approval, and subject to any appropriate credits for fees paid or facilities provided by the UPD, applicable impact fee payment requirements shall be those that are in effect when subsequent implementing approvals such as subdivision applications, binding site plans, building permits or other approvals are applied for. (Ord. 15606 § 29, 2006: Ord. 11700 § 43, 1995: Ord. 10870 § 584, 1993).21A.39.040 UPD permit - Development agreement. The conditions of UPD permit approval shall be attached to a development agreement that is:A. Signed by King County executive and all property owners within the UPD in a form acceptable to King County.B. Binding on all property owners and their successors to develop a UPD only in accordance with the conditions of the UPD permit, but subject to surrender or cessation of the UPD permit and development as provided in 21A.39.030A.10.C. Recorded with King County division of records prior to the effective date of the UPD permit or any development proposal which was submitted and reviewed concurrently with the UPD permit application. (Ord. 10870 § 585, 1993). 21A.39.050 UPD standards - Land uses.A. Except as required by subsections B and C, a UPD may contain any non-residential use set out in the K.C.C. 21A.08 (Land Use Tables) when approved as part of the UPD permit. Any non-residential use shall be subject to any applicable UPD conditions contained in the development agreement that limits the scope or intensity of such use.B. The primary land use shall be residential and shall be provided as follows: 1. the base density of the UPD shall be that of the zone set for the site were it to not develop with a UPD, applied to the entire site including portions proposed for nonresidential uses. 2. the minimum density of the UPD shall be not less than the minimum residential density of the underlying zoning calculated for the portion of the site to be used for residential purposes, pursuant to the methodology outlined in K.C.C. 21A.12, and 3. the maximum density of the UPD shall be determined by the council in the UPD permit, subject to any maximum density set out in the community plan or comprehensive plan which designated the UPD special district overlay.C. UPDs shall at a minimum: 1. provide retail/commercial areas at a rate of one acre per 2500 projected UPD residents, or 2. demonstrate that existing or potential commercial development within one quarter mile of UPD boundaries will meet the convenience shopping needs of UPD residents. (Ord. 11621 § 102, 1994: Ord. 10870 § 586, 1993).21A.39.060 UPD standards - Affordable housing.A. Exclusive of dwelling units from the density bonus provisions, at least 30 percent of the residential units in each phase shall be affordable housing units defined and allocated as follows: 1. Ten percent of the affordable housing units shall be affordable to households at an income level: a. below 80 percent of the median household income for ownership units, and/or b. below 50 percent of the median household income for rental units. c. housing affordable for households at this level of median income will be required in any phase only if publicly funded or private non-profit programs for such housing are available, provided that the developer sets aside sufficient land for a period of up to five years. That period shall begin with approval of the final plat for each subdivision containing any land set aside for low income housing. If during that period, programs become available, the developer shall cooperate with the public agency or private non-profit for the development of such housing. d. if housing funds do not become available by the end of the five year period the land shall be released for other development consistent with the UPD. The overall requirement for units available to below 80 or 50 percent of median income households, whichever is applicable, shall be reduced by the number for which the five year period has elapsed and the overall requirement for units available to households between 80 to less than 100 percent (ownership units) or 50 to less than 80 percent (rental units) of median income shall be increased by the same number. 2. Ten percent of the affordable housing units shall be affordable to households at an income level: a. between 80 and less than 100 percent of the median household income for ownership units, and/or b. between 50 and less than 80 percent of the median household income for rental units; 3. Ten percent of the affordable housing units shall be affordable to households at an income level: a. between 100 and 120 percent of the median household income for ownership units; and/or b. between 80 and 100 percent of the median household income for rental units; and 4. The formula for determining median income for King County and affordable monthly housing payments based on a percentage of this income shall be determined at the time of the UPD permit approval.B. The affordable housing units that are owner-occupied shall be resale restricted to same income group (based on typical underwriting ratios and other lending standards) for 15 years from date of first sale. Renter occupied units shall be restricted for thirty years to ensure continuing affordability for households of the applicable income level. (Ord. 10870 § 587, 1993).21A.39.070 UPD standards - On-site recreation. The UPD shall provide the amount of on-site recreation required pursuant to K.C.C. 21A.14. (Ord. 10870 § 588, 1993).21A.39.080 UPD standards - Transportation, road and school adequacy.A. Transportation, and school adequacy impacts relative to the standards set forth in K.C.C. 21A.28 shall be evaluated based on complete development of the total site area in the UPD permit application.B. Required facility construction and dedication and other mitigation measures may be phased in conjunction with subsequent land use approvals consistent with their proportion of the total project impacts. (Ord. 10870 § 589, 1993).21A.39.090 UPD standards - Water and sewer service.A. All UPDs shall be served with public water and sewer systems that: 1. Comply with applicable comprehensive utility plans, and 2. Are in place at the time said service is needed for the UPD or any completed phase thereof.B. The UPD shall provide all on-site and off-site improvements and additions to water and sewer facilities required to support the UPD, at the expense of the UPD, which may include developer extension agreements (latecomer provision), LIDs or other capital facility financing. (Ord. 10870 § 590, 1993).21A.39.100 UPD standards - Road design. The road design standards applied to subsequent land use actions which implement the UPD shall be such standards in effect at the time of UPD permit approval, except when new standards are specifically determined by the King County council to be necessary for public safety. (Ord. 10870 § 591, 1993).21A.39.110 UPD standards - Storm water management design. The SWM design standards in effect at the time of UPD permit approval shall be applied to subsequent land use actions which implement the UPD except when new standards are specifically determined by the King County council to be necessary for public safety. (Ord. 10870 § 592, 1993).21A.39.120 UPD standards - Applicability of other zoning code provisions.A. Except as may be specified in the UPD permit conditions, all developments and uses on the UPD site proposed subsequent to the UPD permit approval shall comply with all the other applicable provisions of this title. B. Except as may be otherwise specified in the UPD permit conditions the development standards for the UPD shall be as follows: 1. Individual residential subareas shall use the standards of the zone that is closest in density to the proposed subarea development; and 2. Commercial or industrial uses shall be subject to the standards of CB zone. (Ord. 10870 § 593, 1993).21A.39.130 Latecomer agreements and fair share. If the UPD provides more than its fair share contribution, to infrastructure improvements or public services including but not limited to roads, sewers, water, fire, police, schools or park and recreation facilities, then the UPD shall receive latecomer fees, offsets, credits, reductions, or other adjustments to reflect the UPD's fair share obligations. (Ord. 10870 § 594, 1993).21A.39.200 Fully contained community (FCC) - Permit.A. King County shall accept an application for a FCC permit only in areas designated as a FCC by the Comprehensive Plan and contained within the boundaries of a FCC special district overlay designated by the area zoning implementing the Comprehensive Plan.B. In order to be approved, a proposed FCC permit shall comply with the provisions relating to urban planned development permits in King County Code 21A.39.020B and C and 21A.39.030 through 21A.39.130, except that a proposed FCC shall comply with the following additional standards: 1. New infrastructure (including transportation and utilities infrastructure) is provided for and impact fees are established and imposed on the FCC consistent with the requirements of RCW 82.02.050; 2. Transit-oriented site planning and traffic demand management programs are implemented in the FCC. Pedestrian, bicycle, and high occupancy vehicle facilities are given high priority in design and management of the FCC; 3. Buffers are provided between the FCC and adjacent urban and low-density residential development. Buffers located on the perimeter boundaries of the FCC delineated boundaries, consisting of either landscaped areas with native vegetation or natural areas, shall be provided and maintained to reduce impacts on adjacent lands; 4. A mix of uses is provided to offer jobs, housing, and services to the residents of the new FCC. No particular percentage formula for the mix of uses is required. Instead, the mix of uses for an FCC shall be evaluated on a case-by-case basis, in light of the geography, market demand area, transportation patterns, and other relevant factors affecting the proposed FCC. Service uses in the FCC may also serve residents outside the FCC, where appropriate; 5. Affordable housing is provided within the new FCC for a broad range of income levels, including housing affordable by households with income levels below and near the median income for King County; 6. Environmental protection has been addressed and provided for in the new FCC, at levels at least equivalent to those imposed by adopted King County environmental regulations; 7. Development regulations are established to ensure urban growth will not occur in adjacent nonurban areas. Such regulations shall include but are not limited to rural zoning of adjacent rural areas, urban planned development permit conditions requiring sizing of FCC water and sewer systems so as to ensure urban growth will not occur in adjacent nonurban areas; and/or urban planned development permit conditions prohibiting connection by property owners in the adjacent rural area (excepting public school sites) to new FCC sewer and water mains or lines; 8. Provision is made to mitigate impacts of the FCC on designated agricultural lands, forest lands, and mineral resource lands; and 9. The plan for the new FCC is consistent with the development regulations established for the protection of critical areas of king County pursuant to RCW 36.70A.170.C. If an applicant utilizes the procedural provisions of this section of King County Code 21A.39, any previously submitted urban planned development permit applications are deemed the equivalent of and accepted as complete applications for a FCC permit under this chapter.D. If the Comprehensive Plan designates more than one FCC site within a FCC area, the FCC applications may be submitted and reviewed independently unless a combined review is requested by the owners of the proposed FCC sites. If FCC permits on adjoining properties within the designated FCC area are considered in combined review, then the applicants can request that the criteria specified in K.C.C. 21A.39.200 be applied to the combined area and uses within the two adjoining fee permit sites. In applying the FCC criteria of K.C.C. 21A.39.200 B to an FCC permit, the county shall consider the uses and other characteristics of any existing FCC permit on an adjoining site within the FCC area.E. Approved urban planned developments. Any approved urban planned development can proceed with development consistent with the terms of the recorded development agreement or, at the owner's election, may request king County to review and issue an FCC permit. The additional review process shall follow the processing requirements for a FCC but would incorporate the prior urban planned development permit file and prior proceedings and would be limited to determining whether there is a basis for the additional findings and conclusions necessary for a FCC permit beyond those required for an urban planned development. (Ord. 12171 § 8, 1996).21A.40APPLICATION REQUIREMENTS/NOTICE METHODSSections:21A.40.070Applications - Limitations on refiling of applications.21A.40.070 Applications - Limitations on refiling of applications. Upon denial by the council of a zone reclassification or a special use permit, no new application for substantially the same proposal shall be accepted within one year from the date of denial. (Ord. 10870 § 602, 1993).21A.41COMMERCIAL SITE DEVELOPMENT PERMITSSections:21A.41.010Purpose.21A.41.020Applicability.21A.41.050Public comments.21A.41.060Application of development standards.21A.41.070Approval.21A.41.080Financial guarantees.21A.41.100Limitation of permit approval.21A.41.110Modification to an approved permit.21A.41.120Administrative rules.21A.41.010 Purpose. The purpose of this chapter is to establish an optional comprehensive site review process of proposed commercial development resulting in a permit which can combine any or all of the following:A. Site development requirements specified prior to building and/or grading permit applications.B. Site review and application of rules and regulations generally applied to the whole site without regard to existing or proposed internal lot lines.C. Site development coordination and project phasing occurring over a period of years.D. Evaluation of commercially and industrially zoned property for the creation or alteration of lots when reviewed concurrently with a binding site plan application. (Ord. 11621 § 120, 1994).21A.41.020 Applicability.A. An application for commercial site development permit may be submitted for commercial development projects on sites consisting of one (1) or more contiguous lots legally created and zoned to permit the proposed uses. B. A commercial site development permit is separate from and does not replace other required permits such as conditional use permits or shoreline substantial development permits. A commercial site development permit may be combined and reviewed concurrently with other permits. (Ord. 11621 § 121, 1994).21A.41.050 Public comments. All public comments shall be in writing and signed, shall reference the proposed commercial site development permit application, and shall include the full name, address and telephone number of the person commenting. All comments shall be received within the designated comment period. The designated comment period shall commence on the day following publication or posting of the application notice and shall terminate at 4:30 p.m. on the fifteenth (15th) day thereafter. If the department determines that application notice shall be published as well as posted, the department shall make every attempt to have the comment periods run concurrently. If, however, more than one method of notification is used, the termination date shall be calculated from the last notification date. If the fifteenth (15th) day is a non-work day for the county, the designated comment period shall cease at 4:30 p.m. on the next county work day immediately following the fifteenth (15th) day. (Ord. 11621 § 124, 1994).21A.41.060 Application of development standards. An application for commercial site development permit shall be reviewed pursuant to chapter 43.21C RCW, SEPA as implemented by WAC 197-11; K.C.C. 9.04, Surface Water Management; K.C.C. 14.42, Road Standards; K.C.C. 16.82, Grading; K.C.C. Title 17, Fire Code; K.C.C. 20.44, County Environmental Procedures; K.C.C. Title 21A, Zoning; K.C.C. Title 25, Shoreline Management; administrative rules adopted pursuant to K.C.C. 2.98 to implement any such code or ordinance provision; King County board of health rules and regulations; county approved utility comprehensive plans; conformity with applicable P-suffix conditions. Lot-based standards, such as internal circulation, landscaping signage and setback requirements, are typically applied to each individual lot within the site. However, the director may approve an application for commercial site development where such standards have been applied to the site as if it consisted of one parcel. Lot-based regulations shall not be waived altogether. The director may modify lot-based or lot line requirements contained within the building, fire and other similar uniform codes adopted by the county, provided the site is being reviewed concurrently with a binding site plan application. (Ord. 13022 § 31, 1998: Ord. 11621 § 125, 1994).21A.41.070 Approval.A. The director may approve, deny, or approve with conditions an application for a commercial site development. The decision shall be based on the following factors: 1. Conformity with adopted county and state rules and regulations in effect on the date the complete application was filed, including but not limited to those listed in section 21A.41.060. 2. Consideration of the recommendations or comments of interested parties and those agencies having pertinent expertise or jurisdiction, consistent with the requirements of this title. B. Subsequent permits for the subject site shall be issued only in compliance with the approved commercial site development plan. Additional site development conditions and site review will not be required for subsequent permits provided the approved plan is not altered.C. Approval of the proposed commercial site development shall not provide the applicant with a vested right to build without regard to subsequent changes in the building and fire codes listed in K.C.C. 16.04 and 17.04 regulating construction.D. The director shall mail a copy of the decision to the applicant and any other person who has presented written comment to the department. (Ord. 11621 § 126, 1994).21A.41.080 Financial guarantees. Performance guarantees consistent with the provisions of Title 27A may be required to assure that development occurs according to the approved plan. (Ord. 12020 § 55, 1995: Ord. 11621 § 127, 1994).21A.41.100 Limitation of permit approval.A. A commercial site development permit approved without a phasing plan shall be null and void if the applicant fails to file a complete building permit application(s) for all buildings within three years of the approval date, or by a date specified by the director; and fails to have all valid building permits issued within four years of the commercial site development permit approval date; orB. A commercial site development permit approved with a phasing plan shall be null and void if the applicant fails to meet the conditions and time schedules specified in the approved phasing plan. (Ord. 11621 § 129, 1994).21A.41.110 Modification to an approved permit.A. A subsequent building permit application may contain minor modifications to an approved commercial site development plan if the modification does not: 1. Increase the building floor area by more than 10%; 2. Increase the number of dwelling units; 3. Increase the total impervious surface area, provided that, relocatable facilities for schools shall be exempt from this restriction; does not result in an insufficient amount of parking and/or loading; 4. Locate buildings outside an approved building envelope, provided that, relocatable facilities for schools shall be exempt from this restriction; 5. Change the number of ingress and egress points to the site; 6. Significantly increase the traffic impacts of peak hour trips to and from the site; or 7. Significantly increase the quantity of imported or exported materials or increase the area of site disturbance.B. Modifications that exceed the conditions of approval as stated in this section and require a new review as determined by the director shall only be accomplished by applying for a new commercial site development permit for the entire site. The new application shall be reviewed according to the laws and rules in effect at the time of application. (Ord. 17191 § 52, 2011: Ord. 11621 § 130, 1994).21A.41.120 Administrative rules. The director may promulgate administrative rules and regulations pursuant to K.C.C. 2.98, to implement the provisions and requirements of this chapter. (Ord. 11621 § 131, 1994).21A.42REVIEW PROCEDURES/NOTICE REQUIREMENTSSections:21A.42.030Code compliance review — decisions and appeals.21A.42.040Director review — actions subject to review.21A.42.080Director review — decision regarding development proposal — rules.21A.42.090Director review - decision final unless appealed (as amended by Ordinance 18230, Section 136.21A.42.090Director review - decision final unless appealed (as amended by Ordinance 17841, Section 56, and Ordinance 19648, Section 48).21A.42.100Examiner review - zone reclassification, shoreline environment redesignation, urban plan developments, special use permits, amendment or deletion of P-suffix conditions, plat vacations and short plat vacations.21A.42.110Combined review.21A.42.130Records.21A.42.140Review process for high schools.21A.42.150Modifications and expansions of uses or developments authorized by existing land use permits - Permits defined.21A.42.160Modifications or expansions of uses or developments authorized by existing land use permits - When use now permitted outright.21A.42.170Modifications or expansions of uses authorized by existing land use permits - Required findings.21A.42.180Modifications and expansions - use or development authorized by an existing planned unit development approval.21A.42.190Modifications and expansions - uses or development authorized by existing conditional use, special use or unclassified use permits.21A.42.210Expansions and modification - school authorized by an existing land use permit.21A.42.300Agricultural technical review committee.21A.42.030 Code compliance review — decisions and appeals.A. The department shall approve, approve with conditions, or deny development proposals based on compliance with this title and any other development condition affecting the proposal.B. K.C.C. chapter 20.20 applies to appeals of decisions on development proposals. (Ord. 15051 § 219, 2004: Ord. 10870 § 611, 1993).21A.42.040 Director review — actions subject to review. The following actions shall be subject to the director review procedures in this chapter:A. Applications for variances, exceptions under K.C.C. 21A.24.070, and conditional uses; andB. Periodic review of mineral extraction operations. (Ord. 15051 § 220, 2004: Ord. 12196 § 55, 1996: Ord. 11621 § 105, 1994: Ord. 10870 § 612, 1993).21A.42.080 Director review — decision regarding development proposal — rules.A. Decisions regarding the approval or denial of development proposals, excluding periodic review of mineral extraction operations, subject to director review shall be based upon compliance with the required showings of K.C.C. chapter 21A.44. Periodic reviews of mineral extraction operations shall be based upon the criteria outlined in K.C.C. 21A.22.050.B.B. The written decision contained in the record shall show: 1. Facts, findings and conclusions supporting the decision and demonstrating compliance with the applicable decision criteria; and 2. Any conditions and limitations imposed, if the request is granted.C. The director shall mail a copy of the written decision to the applicant and to all parties of record.D. The director shall adopt rules for the transaction of business and shall keep a public record of his actions, finding, waivers and determinations. (Ord. 18683 § 57, 2018: Ord. 15051 § 221, 2004: Ord. 12196 § 56, 1996: Ord. 10870 § 616, 1993).21A.42.090 Director review - decision final unless appealed (as amended by Ordinance 18230, Section 136).*A. The decision of the director shall be final unless the applicant or an aggrieved party files an appeal to the hearing examiner pursuant to K.C.C. 20.22.080.B. The examiner shall review and make decisions based upon information contained in the written appeal and the record.C. The examiner's decision may affirm, modify or reverse the decision of the director.D. As provided by K.C.C. 20.22.220.A. and C.: 1. The examiner shall render a decision within ten days of the closing of hearing; and 2. The decision shall be final unless appealed under the provisions of K.C.C. 20.22.220.B.E. Establishment of any use or activity authorized in accordance with a conditional use permit or variance shall occur within four years of the effective date of the decision for such permit or variance, except that for schools the period shall be five years. The period may be extended for one additional year by the director if the applicant has submitted the applications necessary to establish the use or activity and has provided written justification for the extension.F. For the purpose of this section, "establishment" shall occur upon the issuance of all local permits or approvals for on-site improvements needed to begin the authorized use or activity, if the conditions or improvements required by the permits or approvals are completed within the timeframes of the permits.G. Once a use, activity or improvement allowed by a conditional use permit or variance has been established, it may continue as long as all conditions of permit issuance are met. (Ord. 18230 § 136, 2016: Ord. 12196 § 57, 1996: Ord. 11940 § 1, 1995: Ord. 10870 § 617, 1993).*Reviser's note: K.C.C. 21A.42.090 was amended by both Ordinance 18230 and Ordinance 17841 in a way that all amendments could not be incorporated in the section. The version amended by Ordinance 17841 was also amended by Ordinance 19648. Each version of the section is published in the code, in accordance with K.C.C. 1.02.090.C.21A.42.090 Director review - decision final unless appealed (as amended by Ordinance 17841, Section 56, and Ordinance 19648, Section 48).*A.1. The decision of the director under this chapter, except for those in subsection A.2. of this section, is a Type 2 decision under K.C.C. 20.20.020; and 2. The decision of the director made under K.C.C. chapter 21A.32 shall be final unless appealed following the appeal process for the underlying permit .B. Establishment of any use or activity authorized in accordance with a conditional use permit or variance shall occur within four years of the effective date of the decision for the permit or variance, except that for schools the period shall be five years. The period may be extended for one additional year by the director if the applicant has submitted the applications necessary to establish the use or activity and has provided written justification for the extension.C. For the purpose of this section, "establishment" shall occur upon the issuance of all local permits or approvals for on-site improvements needed to begin the authorized use or activity, if the conditions or improvements required by the permits or approvals are completed within the timeframes of the permits.D. Once a use, activity, or improvement, allowed by a conditional use permit or variance, has been established, it may continue as long as all conditions of permit issuance are met. (Ord. 19648 § 48, 2023: Ord. 18230 § 136, 2016: Ord. 12196 § 57, 1996: Ord. 11940 § 1, 1995: Ord. 10870 § 617, 1993).*Reviser's note: K.C.C. 21A.42.090 was amended by both Ordinance 18230 and Ordinance 17841 in a way that all amendments could not be incorporated in the section. The version amended by Ordinance 17841 was also amended by Ordinance 19648. Each version of the section is published in the code, in accordance with K.C.C. 1.02.090.C.21A.42.100 Examiner review — zone reclassifications, shoreline environment redesignation, urban plan developments, special use permits, amendment or deletion of P-suffix conditions, plat vacations and short plat vacations. Applications for zone reclassifications, shoreline environment redesignation, special use permits, urban plan developments, amendment or deletion of P-suffix conditions, plat vacations and short plat vacations shall be reviewed by the department subject to the criteria in K.C.C. chapter 21A.44 and to the procedures and criteria in K.C.C. chapter 20.22 for action subject to approval by the council and notice shall be provided in accordance with K.C.C. chapter 20.20. (Ord. 18230 § 137, 2016: Ord. 15051 § 222, 2004: Ord. 11621 § 106, 1994: Ord. 10870 § 618, 1993).21A.42.110 Combined review. Proposed actions may be combined for review purposes with any other action subject to the same review process, provided:A. Notice requirements for combined review shall not be less than the greatest individual action requirement; andB. No permit shall be approved without prior review and approval of any required variance. (Ord. 10870 § 619, 1993).21A.42.130 Records. The department shall maintain public records for all permit approvals and denials containing the following information:A. Application documents; B. Tape recorded verbatim records of required public hearing;C. Written recommendations and decisions for proposed actions;D. Ordinances showing final council actions;E. Evidence of notice;F. Written comments received; andG. Material submitted as exhibits. (Ord. 10870 § 621, 1993).21A.42.140 Review process for high schools.A. The School District shall hold a public hearing on the request for a building permit on the proposed high school and may merge the public hearing for environmental review with this hearing. The hearing shall address the proposal's compliance with the applicable development standards and whether the impacts of traffic on the neighborhood have been addressed pursuant to the State Environmental Policy Act, Chapter 43.21C RCW, and/or through the payment of road impact fees. The hearing may be conducted by the Board of Directors, or where authorized by board policy, by a hearing examiner appointed by the School Board. The District shall provide notice of the hearing as follows: 1. by posting the property; 2. by publishing in a newspaper of general circulation in the general area where the proposed high school is located; 3. by sending notices by first class mail to owners of property in an area within five hundred feet of the proposed high school, but the area shall be expanded as necessary to send mailed notices to at least twenty different property owners; and 4. by sending notices to other residents of the District that have requested notice.B. At a regularly scheduled or special Board meeting, the Board of Directors shall adopt findings of compliance with applicable King County development standards, including the decision criteria outlined in K.C.C. chapter 21A.44, or adopt proposed actions necessary to reach compliance. If a hearing examiner has been appointed, the Board of Directors shall review and adopt or reject the hearing examiner's proposed findings and/or proposed actions. The board may include in the record any information supporting its findings or any information from prior public meetings held on the same general subject at the discretion of the Board.C. Copies of the findings and/or the proposed actions shall be mailed to all parties of record and to the county.D. Any aggrieved party of record may request the Board of Directors to reconsider the findings within twenty calendar days of its adoption. An aggrieved party requesting reconsideration shall submit written evidence challenging the findings or otherwise specifically identify reasons why the District has failed to reasonably comply with the applicable King County development standards or the decision criteria outlined in K.C.C. chapter 21A.44. Within thirty calendar days after a request for reconsideration has been filed with the District, the Board of Directors may reconsider and revise the findings and/or proposed actions, or may decline to reconsider. Failure to act, or to initiate the process for reconsideration by notifying the aggrieved party of record of intent to reconsider, within the thirty day period shall be deemed to constitute a decision not to reconsider.E. The Board's final findings shall be attached to the District's building permit application and shall be considered as prima facie evidence of compliance with the applicable King County development standards. (Ord. 14045 § 57, 2001: Ord. 10870 § 634 (part), 1993).21A.42.150 Modifications and expansions of uses or developments authorized by existing land use permits - Permits defined. For the purposes of this chapter, a land use permit shall mean a conditional use permit, special use permit, unclassified use permit, or planned unit development. (Ord. 13130 § 7, 1998).21A.42.160 Modifications or expansions of uses or developments authorized by existing land use permits - When use now permitted outright. Proposed modifications or expansions to a use or development authorized by an existing land use permit shall not require an amendment to the existing land use permit if the use is now permitted outright in the zone district in which it is located and shall not require findings pursuant to K.C.C. 21A.42.170. (Ord. 13130 § 8, 1998).21A.42.170 Modifications or expansions of uses authorized by existing land use permits - Required findings. Modifications or expansions approved by the department shall be based on written findings that the proposed modifications or expansions provide the same level of protection for and compatibility with adjacent land uses as the original land use permit.(Ord. 13130 § 9, 1998).21A.42.180 Modifications and expansions - use or development authorized by an existing planned unit development approval. Modifications and expansions of uses or developments authorized by an existing planned unit development approval shall be subject to the following provisions.A. Any approved modification or expansion shall be recorded.B. Modifications to building location or dimensions shall be reviewed pursuant to the code compliance process of this chapter unless: 1. Buildings are located closer to the nearest property line(s); or 2. An increase in square footage of buildings is proposed.C. Modifications not exempted from the code compliance process of this chapter by subsection B. of this section and all expansions shall be subject to the approval of a conditional use permit. (Ord. 17191 § 53, 2011: Ord. 13130 § 10, 1998).21A.42.190 Modifications and expansions - uses or development authorized by existing conditional use, special use or unclassified use permits.A. The department may review and approve, in accordance with the code compliance process of this chapter, an expansion of a use or development authorized by an existing conditional use, special use or unclassified use permit as follows: 1. The expansion shall conform to this title and the original land use permit, except that the project-wide amount of each of the following may be increased up to ten percent: a. building square footage; b. impervious surface; c. parking; or d. building height; 2. No subsequent expansions shall be approved under this subsection if the cumulative amount of such expansions exceeds the percentage prescribed in subsection A.1. of this section; and 3. An expansion of a use or development authorized by an existing conditional use, special use or unclassified use permit that does not conform to subsection A.1. of this section may only be approved if: a. the expansion is within a use or development authorized by an existing conditional use permit and is reviewed and approved as a conditional use; or b. the expansion is within a use or development authorized by an existing special use or unclassified use permit and is reviewed and approved as a special use.B. The department may review and approve, in accordance with the code compliance process of this chapter, a modification of a use or a development authorized by an existing conditional use, special use or unclassified use permit that does not make a substantial change, as determined by the department, to the conditional use, special use or unclassified use. For the purpose of this subsection, a "substantial change" includes, but is not limited to, a change to the conditions of approval that leads to significant built or natural environmental impacts that were not addressed in the original approval or the creation of a new use.C. This section shall not apply to modifications or expansions of: 1. Telecommunication facilities under K.C.C. 21A.26.140; 2. Minor telecommunication facilities under K.C.C. 21A.27.090; or 3. Nonconformances under K.C.C. 21A.32.065. (Ord. 17841 § 57, 2014: Ord. 17191 § 54, 2011: Ord. 15606 § 30, 2006: Ord. 13130 § 11, 1998).21A.42.210 Expansions and modification - school authorized by an existing land use permit. In the RA zone, the following apply to the expansion or modification of a school authorized by an existing land use permit:A. Pursuant to the code compliance process of this chapter, the department may review and approve an expansion or modification of an elementary school authorized by an existing land use permit even if the use is not permitted outright in the RA zone. Such expansions or modifications shall conform to all other provisions of this title;B. Pursuant to the code compliance process of this chapter, the department may review and approve an expansion of a middle school, junior high school or high school authorized by an existing land use permit even if the use is not permitted outright in the RA zone. Such expansions shall conform to all other provisions of this title. Any expansions under this subsection shall be subject to the following: 1. the project-wide amount of each of the following may be increased by up to ten percent: a. building square footage; b. impervious surface; c. parking; and d. building height; and 2. No subsequent expansions shall be approved under this subsection if the cumulative amount of such expansions exceeds the percentage prescribed in subsection B.1. of this section;C. An expansion of a school that does not conform to the provisions of subsection B. of this section may only be approved if the expansion is reviewed and approved as a conditional use; andD. The department may review and approve, in accordance with the code compliance process of this chapter, a modification of a middle school, junior high school or high school authorized by an existing land use permit that does not make a substantial change to the existing land use permit, as determined by the department. For the purpose of this subsection, a "substantial change" includes, but is not limited to, a change to the conditions of approval that leads to significant built or natural environmental impacts that were not addressed in the original approval. (Ord. 17485 § 44, 2012).21A.42.300 Agricultural technical review committee.A. There is hereby established an agricultural technical review committee consisting of representatives of the department of local services, permitting division, natural resources and parks and public health and the King County Conservation District.B. The agricultural technical review committee is authorized to review proposals to expand or modify agricultural activities and to site agricultural support services, as identified in K.C.C. 21A.08.090, and to make a recommendation to the director or designee. The agricultural technical review committee’s recommendation will be based on the applicant’s submission of a business plan that establishes satisfaction of the relevant criteria set forth in this section.C. The director or designee shall sit on the committee and shall make a final decision on proposals to expand or modify agricultural activities or to site agricultural support services. This decision shall be a Type 1 decision under K.C.C. chapter 20.20. the director’s decision will require the property owner to sign and record on title, at the owner’s sole expense, a covenant in a form acceptable to the county that informs subsequent owners of the conditions and limitations under which the use must be maintained.D. The director, after a recommendation from the agricultural technical review committee established by this section, may modify development standards for agricultural activities as identified in K.C.C. 21A.08.090, subject to the following criteria. The proposed modification or expansion must: 1. Be located on existing impervious surface or lands not otherwise suitable for direct agricultural production based upon soil conditions or other factors and cannot be returned to productivity by drainage maintenance; 2. Be allowed under any Farmland Preservation Program conservation easement and zoning development standards; 3. Be supported by adequate utilities, parking, internal circulation and other infrastructure; 4. Not interfere with neighborhood circulation or interfere with existing or permitted development or use on neighboring properties; 5. Be designed in a manner that is compatible with the character and appearance of existing or proposed development in the vicinity of the subject property; 6. Not be in conflict with the health and safety of the community and is such that pedestrian and vehicular traffic associated with the use must not be hazardous or conflict with existing and anticipated traffic in the neighborhood; 7. Be supported by adequate public facilities or services and must not adversely affect public services to the surrounding area; and 8. Not be in conflict with the policies of the Comprehensive Plan or the basic purposes of K.C.C. Title 21A.E. Siting of agricultural support services as provided in K.C.C. 21A.08.090 may be authorized by the director, after a recommendation from the agricultural technical review committee established by this section, subject to the following criteria. The proposed use must: 1.a. Be limited to processing, warehousing and storage, including refrigeration, retail sales and other similar support services of locally produced agricultural products. Sixty percent or more of the products must be grown or raised in the agricultural production district. At the time of initial application, the applicant shall submit a projection of the source of products to be produced; b. Be limited to farmworker housing to support agricultural operations located in the agricultural production district; or c. Be limited to farm operations, including equipment repair, and other similar services primarily supporting agricultural operations located in the agricultural production district. Sixty percent or more of the services business must be to support agricultural operations in the agricultural production district. At the time of initial application, the applicant shall submit a projection of the source of products to be produced; 2. Meet the setback and size limitation in K.C.C. 21A.08.090.B.24. for structures and areas used for agricultural support services, including walls, fences and screening vegetation, and not interfere with neighborhood circulation or interfere with existing or permitted development or use on neighboring properties; 3. Be designed in a manner which is compatible with the character and appearance of existing, or proposed development in the vicinity of the subject property, and provide sufficient screening vegetation; 4. Not be in conflict with the health and safety of the community and must be such that pedestrian and vehicular traffic associated with the use will not be hazardous or conflict with existing and anticipated traffic in the neighborhood; 5. Be supported by adequate public facilities or services, will not adversely affect public services to the surrounding area and shall not depend on urban services; and 6. Not be in conflict with the policies of the Comprehensive Plan or the basic purposes of K.C.C. Title 21A. (Ord. 18791 § 189, 2018: Ord. 18626 § 15, 2017).21A.43IMPACT FEESSections:21A.43.005Authority.21A.43.010Purpose.21A.43.020Impact fee program elements.21A.43.030Fee calculations.21A.43.040Fee collection.21A.43.050Assessment of impact fees.21A.43.060Effective date.21A.43.070Adjustments, exceptions, and appeals.21A.43.080Exemption or reduction for low or moderate income housing.21A.43.090Impact fee accounts and refunds.21A.43.005 Authority. The provisions of this chapter for the assessment and collection of impact fees are adopted pursuant to Chapter 82.02 RCW. (Ord. 11621 § 109, 1994).21A.43.010 Purpose. The purpose of this chapter is to implement the capital facilities element of the Comprehensive Plan and the Growth Management Act by:A. Ensuring that adequate public school facilities and improvements are available to serve new development;B. Establishing standards whereby new development pays a proportionate share of the cost for public school facilities needed to serve such new development;C. Ensuring that school impact fees are imposed through established procedures and criteria so that specific developments do not pay arbitrary fees or duplicative fees for the same impact; andD. Providing needed funding for growth-related school improvements to meet the future growth needs of King County. (Ord. 11621 § 110, 1994).21A.43.020 Impact fee program elements.A. Impact fees will be assessed on every new dwelling unit in the district for which a fee schedule has been established.B. Impact fees will be imposed on a district-by-district basis, on behalf of any school district which provides to the county a capital facilities plan, the district's standards of service for the various grade spans, estimates of the cost of providing needed facilities and other capital improvements, and the data from the district called for by the formula in K.C.C. 21A.43.030. The actual fee schedule for the district will be adopted by ordinance based on this information and the fee calculation set out for K.C.C. 21A.43.030. Any impact fee imposed shall be reasonably related to the impact caused by the development and shall not exceed a proportionate share of the cost of system improvements that are reasonably related to the development. The impact fee formula shall account in the fee calculation for future revenues the district will receive from the development. The ordinance adopting the fee schedule shall specify under what circumstances the fee may be adjusted in the interests of fairness.C. The impact fee shall be based on a capital facilities plan developed by the district and approved by the school board, and adopted by reference by the county as part of the capital facilities element of the comprehensive plan for the purpose of establishing the fee program. (Ord. 11621 § 111, 1994).21A.43.030 Fee calculations.A. The fee for each district shall be calculated based on the formula set out in Attachment A to Ordinance 11621*.B. Separate fees shall be calculated for single family and multi-family residential units and separate student generation rates must be determined by the district for each type of residential unit. For purposes of this chapter single family units shall mean single detached dwelling units, and multi-family units shall mean townhouses and apartments.C. The fee shall be calculated on a district-by-district basis using the appropriate factors and data to be supplied by the district, as indicated in Attachment A to Ordinance 11621*. The fee calculations shall be made on a district-wide basis to assure maximum utilization of all school facilities in the district used currently or within the last two years for instructional purposes.D. The formula in Attachment A to Ordinance 11621* also provides a credit for the anticipated tax contributions that would be made by the development based on historical levels of voter support for bond issues in the school district.E. The formula in Attachment A to Ordinance 11621* also provides for a credit for school facilities or sites actually provided by a developer which the school district finds to be acceptable. (Ord. 13338 § 15, 1998: Ord. 12148 § 1, 1996: Ord. 11621 § 112, 1994).*Available in the King County Archives.21A.43.040 Fee collection. Fees shall be collected by the department of local services, permitting division, and maintained in a separate account for each school district, pursuant to K.C.C. 21A.43.070. Fees shall be paid to the district pursuant to administrative rules of an interlocal agreement between the county and the district. (Ord. 18791 § 190, 2018: Ord. 17420 § 118, 2012: Ord. 11621 § 113, 1994).21A.43.050 Assessment of impact fees.A. In school districts where impact fees have been adopted by county ordinance and except as provided in K.C.C. 21A.43.080, the county shall collect impact fees, based on the schedules set forth in each ordinance establishing the fee to be collected for the district, from any applicant seeking development approval from the county where such development activity requires final plat, PUD or UPD approval or the issuance of a residential building permit or a mobile home permit and the fee for the lot or unit has not been previously paid. No approval shall be granted and no permit shall be issued until the required school impact fees set forth in the district's impact fee schedule contained in K.C.C. Title 27 have been paid.B. For a plat, PUD or UPD applied for on or after the effective date of the ordinance adopting the fee for the district in question receiving final approval, fifty percent of the impact fees due on the plat, PUD or UPD shall be assessed and collected from the applicant at the time of final approval, using the impact fee schedules in effect when the plat, PUD or UPD was approved. The balance of the assessed fee shall be allocated to the dwelling units in the project, and shall be collected when the building permits are issued. Residential developments proposed for short plats shall be governed by subsection D of this section.C. If on the effective date of an ordinance adopting an impact fee for a district, a plat, PUD or UPD has already received preliminary approval, such plat, PUD or UPD shall not be required to pay fifty percent of the impact fees at the time of final approval, but the impact fees shall be assessed and collected from the lot owner at the time the building permits are issued, using the impact fee schedules in effect at the time of building permit application. If on the effective date of a district's ordinance, an applicant has applied for preliminary plat, PUD or UPD approval, but has not yet received such approval, the applicant shall follow the procedures set forth in subsection B of this section.D. For existing lots or lots not covered by subsection B of this section, application for single family and multifamily residential building permits, mobile home permits, and site plan approval for mobile home parks, the total amount of the impact fees shall be assessed and collected from the applicant when the building permit is issued, using the impact fee schedules in effect at the time of permit application.E. Any application for preliminary plat, PUD or UPD approval or multifamily zoning which has been approved subject to conditions requiring the payment of impact fees established pursuant to this chapter, shall be required to pay the fee in accordance with the condition of approval.F. In lieu of impact fee payment pursuant to subsections A. through E. of this section, each applicant for a single-family residential construction permit may request deferral of impact fee collection for up to the first twenty single-family residential construction building permits per year. Applicants shall be identified by their contractor registration number. Deferred payment of impact fees shall occur either at the time of final permit inspection by the department of local services, permitting division, or eighteen months after the building permit is issued, whichever is earlier. (Ord. 18791 § 191, 2018: Ord. 18331 § 1, 2016: Ord. 11621 § 114, 1994).21A.43.060 Effective Date. As of September 10, 1993, no fee shall be assessed or collected on any pending building permit which had been applied for prior to the effective date of the impact fee. (Ord. 11621 § 115, 1994).21A.43.070 Adjustments, exceptions, and appeals.A. The following are excluded from the application of the impact fees: 1. Any form of housing exclusively for the senior citizen, including nursing homes and retirement centers, so long as these uses are maintained; 2. Reconstruction, remodeling, or replacement of existing dwelling units which does not result in additional new dwelling units. In the case of replacement of a dwelling, a complete application for a building permit must be submitted within three years after it has been removed or destroyed; 3. Shelters for temporary placement, relocation facilities, transitional housing facilities and Community Residential Facilities as defined in K.C.C. 21A.06.220; 4. Any development activity that is exempt from the payment of an impact fee pursuant to RCW 82.02.100, due to mitigation of the same system improvement under the State Environmental Policy Act; 5. Any development activity for which school impacts have been mitigated pursuant to a condition of plat, PUD or UPD approval to pay fees, dedicate land or construct or improve school facilities, unless the condition of the plat, PUD or UPD approval provides otherwise; provided that the condition of the plat, PUD or UPD approval predates the effective date of a school district's fee implementing ordinance; 6. Any development activity for which school impacts have been mitigated pursuant to a voluntary agreement entered into with a school district to pay fees, dedicate land or construct or improve school facilities, unless the terms of the voluntary agreement provide otherwise; provided that the agreement predates the effective date of a school district's fee implementing ordinance; 7. Housing units which fully qualify as housing for persons age 55 and over meeting the requirements of the Federal Housing Amendments Act of 1988, 42 U.S.C. 3607(b)(2)(c) and (b)(3), as subsequently amended, and which have recorded covenants or other legal arrangements precluding school-aged children as residents in those units; 8. Mobile homes permitted as temporary dwellings pursuant to K.C.C. 21A.32.170; and 9. Accessory dwelling units as defined in K.C.C. 21A.06.350 and K.C.C. 21A.08.030B.7.a.B. Arrangement may be made for later payment with the approval of the school district only if the district determines that it will be unable to use or will not need the payment until a later time, provided that sufficient security, as defined by the district, is provided to assure payment. Security shall be made to and held by the school district, which will be responsible for tracking and documenting the security interest.C. The fee amount established in the schedule shall be reduced by the amount of any payment previously made for the lot or development activity in question, either as a condition of approval or pursuant to a voluntary agreement with a school district entered into after the effective date of a school district's fee implementing ordinance.D. After the effective date of a school district's fee implementing ordinance, whenever a development is granted approval subject to a condition that the developer actually provide school sites, school facilities, or improvements to school facilities acceptable to the district, or whenever the developer has agreed, pursuant to the terms of a voluntary agreement with the school district, to provide land, provide school facilities, or make improvements to existing facilities, the developer shall be entitled to a credit for the value of the land or actual cost of construction against the fee that would be chargeable under the formula provided by this chapter. The land value or cost of construction shall be estimated at the time of approval, but must be documented. If construction costs are estimated, the documentation shall be confirmed after the construction is completed to assure that an accurate credit amount is provided. If the land value or construction costs are less than the calculated fee amount, the difference remaining shall be chargeable as a school impact fee.E. Impact fees may be adjusted by the county, at the county's discretion, if one of the following circumstances exist, provided that the discount set forth in the fee formula fails to adjust for the error in the calculation or fails to ameliorate for the unfairness of the fee: 1. The developer demonstrates that an impact fee assessment was incorrectly calculated; or 2. Unusual circumstances identified by the developer demonstrate that if the standard impact fee amount was applied to the development, it would be unfair or unjust.F. A developer may provide studies and data to demonstrate that any particular factor used by the district may not be appropriately applied to the development proposal, but the district's data shall be presumed valid unless clearly demonstrated to be otherwise by the proponent.G. Any appeal of the decision of the director or the hearing examiner with regard to imposition of an impact for or fee amounts shall follow the appeal process for the underlying permit and not be subject to a separate appeal process. Where no other administrative appeal process is available, an appeal may be taken to the hearing examiner using the appeal procedures for variances. Any errors in the formula identified as a result of an appeal should be referred to the council for possible modification.H. Impact fees may be paid under protest in order to obtain a building permit or other approval of development activity, when an appeal is filed. (Ord. 12148 § 2, 1996: Ord. 11621 § 116, 1994).21A.43.080 Exemption or reduction for low or moderate income housing.A. Low or moderate income housing projects being developed by public housing agencies or private nonprofit housing developers shall be exempt from the payment of school impact fees. The amount of the school impact fees not collected from low or moderate income household development shall be paid from public funds other than impact fee accounts. The impact fees for these units shall be considered paid for by the district through its other funding sources, without the district actually transferring funds from its other funding sources into the impact fee account. The planning and community development division shall review proposed developments of low or moderate income housing by such public or nonprofit developers pursuant to criteria and procedures adopted by administrative rule, and shall advise the department of local services, permitting division, as to whether the project qualifies for the exemption.B. Private developers who dedicate residential units for occupancy by low or moderate income households may apply to the division for reductions in school impact fees pursuant to the criteria established for public housing agencies and private non-profit housing developers pursuant to subsection A. of this section, and subject to the provisions of subsection A. of this section. The division shall review proposed developments of low or moderate income housing by such private developers pursuant to criteria and procedures adopted by administrative rule, and shall advise the department of local services, permitting division, as to whether the project qualifies for the exemption. If the division recommends the exemption, the department of local services, permitting division, shall reduce the calculated school impact fee for the development by an amount that is proportionate to the number of units in the development that satisfy the adopted criteria.C. Individual low or moderate income home purchasers (as defined pursuant to the King County Comprehensive Housing Affordability Strategy (CHAS) who are purchasing homes at prices within their eligibility limits based on standard lending criteria and meet other means tests established by rule by the division are exempted from payment of the impact fee, provided that at such time as the property in question is transferred to another owner who does not qualify for the exemption, at which time the fee shall be due and payable.D. The division is hereby instructed and authorized to adopt, pursuant to K.C.C. chapter 2.98, administrative rules to implement this section. Such rules shall provide for the administration of this program and shall: 1. Encourage the construction of housing for low or moderate income households by public housing agencies or private non-profit housing developers participating in publicly sponsored or subsidized housing programs; 2. Encourage the construction in private developments of housing units for low or moderate income households that are in addition to units required by another housing program or development condition; 3. Ensure that housing that qualifies as low or moderate cost meets appropriate standards regarding household income, rent levels or sale prices, location, number of units and development size; and 4. Ensure that developers who obtain an exemption from or reduction of school impact fees will in fact build the proposed low or moderate cost housing and make it available to low or moderate income households for a minimum of fifteen years. 5. Ensure that individual low or moderate income purchasers meet appropriate eligibility standards based on income and other financial means tests.E. As a condition of receiving an exemption under subsection B. or C. of this section, the owner must execute and record a county-drafted lien, covenant, and/or other contractual provision against the property for a period of ten years for individual owners, and fifteen years for private developers, guaranteeing that the proposed development will continue to be used for low or moderate income housing. In the event that the pattern of development or the use of the development is no longer for low or moderate income housing, then the owner shall pay the impact fee amount from which the owner or any prior owner was exempt. The lien, covenant, or other contractual provision shall run with the land and apply to subsequent owners. (Ord. 18791 § 192, 2018: Ord. 17420 § 119, 2012: Ord. 11621 § 117, 1994).21A.43.090 Impact fee accounts and refunds.A. Impact fee receipts shall be earmarked specifically and retained in a special interest-bearing account established by the county solely for the district's school impact fees. All interest shall be retained in the account and expended for the purpose or purposes identified in subsection B. of this section. Annually, the county, based in part on the report submitted by the district under K.C.C. 21A.28.152, shall prepare a report on each impact fee account showing the source and amount of all moneys collected, earned, or received, and capital or system improvements that were financed in whole or in part by impact fees.B. Impact fees for the district's system improvements shall be expended by the district for capital improvements including but not limited to school planning, land acquisition, site improvements, necessary off-site improvements, construction, engineering, architectural, permitting, financing, and administrative expenses, relocatable facilities, capital equipment pertaining to educational facilities, and any other expenses which could be capitalized, and which are consistent with the school district's capital facilities plan.C. In the event that bonds or similar debt instruments are issued for the advanced provision of capital facilities for which impact fees may be expended and where consistent with the bond covenants, impact fees may be used to pay debt service on such bonds or similar debt instruments to the extent that the facilities or improvements provided are consistent with the requirements of this section.D. Impact fees shall be expended or encumbered, which means being committed as part of the funding for a facility for which the publicly funded share has been assured, building permits applied for, or construction contracts let, by the district for a permissible use within ten years of receipt by the county, unless there exists an extraordinary and compelling reason for fees to be held longer than ten years. Such extraordinary or compelling reasons shall be identified to the county by the district. The county must prepare written findings concurring with the district's reasons, and authorizing the later encumbrance or expenditure of the fees prior to the district so encumbering or expending the funds, or directing a refund of the fees.E. The current owner of property on which an impact fee has been paid may receive a refund of such fees if the impact fees have not been expended or encumbered within ten years of receipt of the funds by the county. In determining whether impact fees have been encumbered, impact fees shall be considered encumbered on a first in, first out basis. The county shall notify potential claimants by first-class mail deposited with the United States Postal Service addressed to the owner of the property as shown in the county tax records.F. An owner's request for a refund must be submitted to the permitting division in writing within one year of the date the right to claim the refund arises or the date that notice is given, whichever date is later. Any impact fees that are not expended or encumbered within these time limitations, and for which no application for a refund has been made within this one-year period, shall be retained and expended consistent with this section. Refunds of impact fees shall include any interest earned on the impact fees.G. Should the county seek to terminate any or all school impact fee requirements, all unexpended or unencumbered funds, including interest earned, shall be refunded to the current owner of the property for which a school impact fee was paid. Upon the finding that any or all fee requirements are to be terminated, the county shall place notice of the termination and the availability of refunds in a newspaper of general circulation at least two times and shall notify all potential claimants by first-class mail addressed to the owner of the property as shown in the county tax records. All funds available for refund shall be retained for a period of one year. At the end of one year, any remaining funds shall be retained by the county, but must be expended for the district, consistent with this section. The notice requirement in this subsection shall not apply if there are no unexpended or unencumbered balances within the account or accounts being terminated.H. A developer may request and shall receive a refund, including interest earned on the impact fees, when: 1. The developer does not proceed to finalize the development activity as required by statute or county code; and 2. No impact on the district has resulted. "Impact" shall be deemed to include cases where the district has expended or encumbered the impact fees in good faith prior to the application for a refund. In the event that the district has expended or encumbered the fees in good faith, no refund shall be forthcoming. However, if within a period of three years, the same or subsequent owner of the property proceeds with the same or substantially similar development activity, the owner shall be eligible for a credit. The owner must petition the county and provide receipts of impact fees paid by the owner for a development of the same or substantially similar nature on the same property or some portion thereof. The county shall determine whether to grant a credit, and such determinations may be appealed by following the procedures set forth in K.C.C. 21A.43.070.I. Interest due upon the refund of impact fees required by this section shall be calculated according to the average rate received by the county or the district on invested funds throughout the period during which the fees were retained. (Ord. 19648 § 49, 2023: Ord. 11621 § 118, 1994).21A.44DECISION CRITERIASections:21A.44.010Purpose.21A.44.020Temporary use permit.21A.44.030Variance.21A.44.040Conditional use permit.21A.44.050Special use permit.21A.44.060Zone reclassification.21A.44.070Urban plan development permit.21A.44.080Fully contained community (FCC) permit.21A.44.090Permits - variance.21A.44.100Shoreline conditional use.21A.44.010 Purpose. The purposes of this chapter are to allow for consistent evaluation of land use applications and to protect nearby properties from the possible effects of such requests by:A. Providing clear criteria on which to base a decision;B. Recognizing the effects of unique circumstances upon the development potential of a property;C. Avoiding the granting of special privileges;D. Avoiding development which may be unnecessarily detrimental to neighboring properties;E. Requiring that the design, scope and intensity of development is in keeping with the physical aspects of a site and adopted land use policies for the area; andF. Providing criteria which emphasize protection of the general character of neighborhoods. (Ord. 10870 § 622, 1993).21A.44.020 Temporary use permit. A temporary use permit shall be granted by the county, only if the applicant demonstrates that:A. The proposed temporary use will not be materially detrimental to the public welfare;B. The proposed temporary use is compatible with existing land uses in the immediate vicinity in terms of noise and hours of operation;C. The proposed temporary use, if located in a resource zone, will not be materially detrimental to the use of the land for resource purposes and will provide adequate off-site parking if necessary to protect against soil compaction;D. Adequate public off-street parking and traffic control for the exclusive use of the proposed temporary use can be provided in a safe manner; andE. The proposed temporary use is not otherwise permitted in the zone in which it is proposed. (Ord. 10870 § 623, 1993).21A.44.030 Variance. A variance shall be granted by the county, only if the applicant demonstrates all of the following:A. The strict enforcement of this title creates an unnecessary hardship to the property owner;B. The variance is necessary because of the unique size, shape, topography or location of the subject property; C. The subject property is deprived, under this title, of rights and privileges enjoyed by other properties in the vicinity and under an identical zone;D. The variance does not create health and safety hazards, is not materially detrimental to the public welfare or is not unduly injurious to property or improvements in the vicinity;E. The variance does not relieve an applicant from any of the procedural provisions of this title;F. The variance does not relieve an applicant from any standard or provision that specifically states that no variance from that standard or provision is permitted;G. The variance does not relieve an applicant from conditions established during prior permit review;H. The variance does not allow establishment of a use that is not otherwise permitted in the zone in which the proposal is located;I. The variance does not allow the creation of lots or densities that exceed the base residential density for the zone by more than ten percent;J. The variance is the minimum necessary to grant relief to the applicant;K. The variance from setback or height requirements does not infringe upon or interfere with easement or covenant rights or responsibilities;L. The variance does not relieve an applicant from any provisions of K.C.C. 21A.24, Critical Areas; andM. Within a special district overlay, the variance does not: 1. Modify, waive or define uses; 2. Waive requirements for special studies or reports; or 3. Reduce vegetation retention standards by more than a total of ten percent. (Ord. 15051 § 224, 2004: Ord. 12479 § 1, 1996: Ord. 11621 § 107, 1994: Ord. 10870 § 624, 1993).21A.44.040 Conditional use permit. A conditional use permit shall be granted by the county, only if the applicant demonstrates that:A. The conditional use is designed in a manner which is compatible with the character and appearance of an existing, or proposed development in the vicinity of the subject property;B. The location, size and height of buildings, structures, walls and fences, and screening vegetation for the conditional use shall not hinder neighborhood circulation or discourage the permitted development or use of neighboring properties;C. The conditional use is designed in a manner that is compatible with the physical characteristics of the subject property;D. Requested modifications to standards are limited to those which will mitigate impacts in a manner equal to or greater than the standards of this title;E. The conditional use is not in conflict with the health and safety of the community;F. The conditional use is such that pedestrian and vehicular traffic associated with the use will not be hazardous or conflict with existing and anticipated traffic in the neighborhood;G. The conditional use will be supported by adequate public facilities or services and will not adversely affect public services to the surrounding area or conditions can be established to mitigate adverse impacts on such facilities; andH. The conditional use is not in conflict with the policies of the Comprehensive Plan or the basic purposes of this title. (Ord. 15032 § 51, 2004: Ord. 11621 § 108, 1994: Ord. 10870 § 625, 1993).21A.44.050 Special use permit. A special use permit shall be granted by the county, only if the applicant demonstrates that:A. The characteristics of the special use will not be unreasonably incompatible with the types of uses permitted in surrounding areas;B. The special use will not materially endanger the health, safety and welfare of the community;C. The special use is such that pedestrian and vehicular traffic associated with the use will not be hazardous or conflict with existing and anticipated traffic in the neighborhood;D. The special use will be supported by adequate public facilities or services and will not adversely affect public services to the surrounding area or conditions can be established to mitigate adverse impacts;E. The location, size and height of buildings, structures, walls and fences, and screening vegetation for the special use shall not hinder or discourage the appropriate development or use of neighboring properties; andF. The special use is not in conflict with the policies of the Comprehensive Plan or the basic purposes of this title. (Ord. 10870 § 626, 1993).21A.44.060 Zone reclassification. A zone reclassification shall be granted only if the applicant demonstrates that the proposal complies with the criteria for approval specified in K.C.C. 20.22.140 and 20.22.150 and is consistent with the Comprehensive Plan and applicable community and functional plans. (Ord. 18230 § 138, 2016: Ord. 10870 § 627, 1993).21A.44.070 Urban plan development permit. An urban plan development permit shall be granted only if the applicant demonstrates compliance with the provisions of K.C.C. 21A.39. (Ord. 10870 § 628, 1993).21A.44.080 Fully contained community (FCC) permit. An application for a FCC permit shall be granted only if the applicant demonstrates compliance with the provisions of K.C.C. 21A.38 and 21A.39. (Ord. 12171 § 9, 1996).21A.44.090 Shoreline variance.A. A shoreline variance shall be granted by the county from the bulk, dimensional or performance standards set forth in K.C.C. 21A.25.220 only if the applicant demonstrates that: 1. The review criteria of WAC 173-27-170 have been met; 2. The shoreline variance does not permit a use that is specifically prohibited in the environmental designation; and 3. Views from nearby roads and public areas are protected.B. A variance from county zoning code requirements shall not be construed to mean a variance from shoreline master program use regulations and vice versa.C. The burden of proving that a proposed variance meets these conditions shall be on the applicant; absence of such proof shall be grounds for denial of the application. (Ord. 16985 § 113, 2010: Ord. 5734 § 15, 1981: Ord. 3688 § 804, 1974. Formerly K.C.C. 25.32.040).21A.44.100 Shoreline conditional use.A. A shoreline conditional use shall be granted by the department for conditional uses identified in K.C.C. 21A.25.100 and 21A.25.160 as shoreline conditional uses only if the applicant demonstrates that the review criteria of WAC 173-27-160 have been met.B. A shoreline conditional use may be granted by the department for uses not classified as conditional uses in K.C.C. 21A.25.100 and 21A.25.160 only if the applicant demonstrates that: 1. The criteria in subsection A. of this section have been met; 2. The use is not specifically prohibited in the shoreline environment; 3. The use clearly requires specific site location on the shoreline not provided for under the shoreline master program; and 4. Extraordinary circumstances preclude reasonable use of the property in a manner consistent with the use regulations of the K.C.C. chapter 21A.25.C. The burden of proving that a proposed shoreline conditional use meets the criteria enumerated in this section shall be on the applicant. Absence of that proof shall be grounds for denial of the application. (Ord. 19034 § 35, 2019: Ord. 18767 § 18, 2018: Ord. 16985 § 115, 2010: Ord. 3688 § 805, 1978. Formerly K.C.C. 25.32.050).21A.45HOMELESS ENCAMPMENTSSections:21A.45.010Purpose. (Effective until January 1, 2025.)21A.45.020Definitions. (Effective until January 1, 2025.)21A.45.030Approval required. (Effective until January 1, 2025.)21A.45.040Use and sponsorship agreements. (Effective until January 1, 2025.)21A.45.050Application submittal and content. (Effective until January 1, 2025.)21A.45.060Homeless encampment standards. (Effective until January 1, 2025.)21A.45.070Parking impacts. (Effective until January 1, 2025.)21A.45.080Community notice and informational meeting. (Effective until January 1, 2025.)21A.45.090Compliance with permit conditions and written code of conduct. (Effective until January 1, 2025.)21A.45.095Violations by managing agency - notice - cure - notice and orders to vacate (expires January 1, 2025).21A.45.100Option to modify standards. (Effective until January 1, 2025.)21A.45.010 Purpose. (Effective until January 1, 2025.) It is the purpose of this chapter to ensure the maintenance of a safe environment within the homeless encampments and to address the potential impacts to neighborhoods by establishment of such homeless encampments. (Ord. 15170 § 6, 2005).21A.45.020 Definitions. (Effective until January 1, 2025.) The definitions in this section apply throughout this chapter and to K.C.C. 20.20.020 unless the context clearly requires otherwise.A. "Homeless encampment" means a group of homeless persons temporarily residing out of doors on a site with a host and services provided by a sponsor and supervised by a managing agency.B. "Host" means the owner of the site property that has an agreement with the managing agency to allow the use of property for a homeless encampment. A "host" may be the same entity as the sponsor or the managing agency.C. "Managing agency" means an organization that has the capacity to organize and manage a homeless encampment. A "managing agency" may be the same entity as the host or the sponsor.D. "Public health" means the Seattle-King County department of public health.E. "Sponsor" means a local church or other local, community-based organization that has an agreement with the managing agency to provide basic services and support for the residents of a homeless encampment and liaison with the surrounding community and joins with the managing agency in an application for a county permit. A "sponsor" may be the same entity as the host or the managing agency. (Ord. 15170 § 7, 2005).21A.45.030 Approval required. (Effective until January 1, 2025.) A homeless encampment may be permitted as a temporary use in accordance with K.C.C. chapter 21A.32 only in compliance with this chapter. (Ord. 15170 § 8, 2005).21A.45.040 Use and sponsorship agreements. (Effective until January 1, 2025.) The following written agreements shall be provided by the applicant:A. If the applicant is not the sponsor, an agreement to provide or coordinate basic services and support for the homeless encampment residents and to join with the applicant in all applications for relevant permits; andB. If the applicant is not the host, an agreement granting permission to locate the homeless encampment at the proposed location and to join with the applicant in all applications for relevant permits. (Ord. 15170 § 9, 2005).21A.45.050 Application submittal and content. (Effective until January 1, 2025.)A. An application for a homeless encampment shall be submitted to the department at least thirty days in advance of the desired date to commence the use for a type 1 permit or forty days in advance of the desired date to commence the use for a type 2 permit.B. In addition to contents otherwise required for such applications, the application shall include: 1. A copy of a written code of conduct adopted by the host or entered into between the host and managing agency addressing the issues identified in the example code of conduct, Attachment A to Ordinance 15170*. The written code of conduct must require homeless encampment residents to abide by specific standards of conduct to promote health and safety within the homeless encampment and within the adjoining neighborhoods. The written code of conduct must prohibit the managing agency from preventing homeless encampment residents from calling 9-1-1 and from retaliating against homeless encampment residents who have called 9-1-1. Nothing in this subsection is intended to preclude the host and the managing agency from agreeing, in the written code of conduct, to additional terms or standards of conduct stricter than the example code of conduct; 2. The name of the managing agency and the sponsor including the name and telephone number of the person available to immediately respond to an onsite problem; 3. The host signature; 4. The name of the onsite camp manager, or designee, who is available to immediately respond to an onsite problem and whose telephone number is posted at the encampment entrance and visible from one hundred feet outside the encampment; and 5. The plan through which the managing agency and the sponsor will dispose of garbage and debris prior to vacating the encampment site at the end of the permit period. (Ord. 17950 § 2, 2014: Ord. 15170 § 10, 2005).*Available in the King County Archives.21A.45.060 Homeless encampment standards. (Effective until January 1, 2025.) A homeless encampment is subject to the following standards:A. The maximum number of residents at a homeless encampment site shall be determined taking into consideration site conditions, but in no case shall be greater than one hundred at any one time;B. The duration of a homeless encampment at any specific location shall not exceed one hundred twenty-two days at any one time, including setup and dismantling of the homeless encampment;C. A homeless encampment may be located at the same site no more than once every twelve months;D. The host and managing agency will assure all applicable public health regulations, including but not limited to the following, will be met: 1. Sanitary portable toilets; 2. Hand washing stations by the toilets; 3. Food preparation or service tents; 4. Security tents; 5. Refuse receptacles; and 6. Disposal of all garbage and debris before vacating the encampment site at the end of the permit period;E. The homeless encampment shall be within a half mile of a public transportation stop or the sponsor or host must demonstrate the ability for residents to obtain access to the nearest public transportation stop through sponsor or host provided van or car pools. During hours when public transportation is not available, the sponsor or host shall also make transportation available to anyone who is rejected from or ordered to leave the homeless encampment;F. The homeless encampment site must be buffered from surrounding properties with: 1. A minimum twenty-foot setback in each direction from the boundary of the lot on which the homeless encampment is located, excluding access; 2. Established vegetation sufficiently dense to obscure view; or 3. A six foot high, view-obscuring fence;G. No permanent structures shall be erected on the homeless encampment site;H. A regular trash patrol in the immediate vicinity of the homeless encampment site shall be provided;I. Public health guidelines on food donations and food handling and storage, including proper temperature control, shall be followed and homeless encampment residents involved in food donations and storage shall be made aware of these guidelines;J. The managing agency shall not permit children under the age of eighteen to stay overnight in the homeless encampment except under exigent circumstances. If a child under the age of eighteen, either alone or accompanied by a parent or guardian, attempts to stay overnight, the managing agency will endeavor to find alternative shelter for the child and any accompanying parent or guardian, including using services such as the King County 2-1-1 crisis clinic. If a child under the age of eighteen, either alone or accompanied by a parent or guardian, appears to be in danger, the managing agency shall immediately contact child protective services;K. The managing agency shall keep a log of all people who stay overnight in the homeless encampment, including names and dates;L. The managing agency shall take all reasonable and legal steps to obtain verifiable identification, such as a driver's license, government-issued identification card, military identification or passport from prospective and homeless encampment residents;M. The managing agency shall enforce the written code of conduct;N. The site property is owned or leased by the sponsor or an affiliated entity;O. The host shall provide a transportation plan as part of the permit process, andP. Managing agencies shall obtain criminal checks of prior convictions for sex offenses and outstanding warrants for violent offenses from the King County sheriff's office for all homeless encampment residents. For homeless encampment residents initially moving onto the site with the homeless encampment, the criminal checks must be completed at least seven days prior to the homeless encampment moving onto the site. For residents moving into the homeless encampment during the permit period, the criminal checks must be completed on or before the date that the new resident moves on site. The managing agency shall be responsible for verifying that the criminal checks occur and for permanently retaining information from the criminal checks. If an encampment resident or prospective encampment resident is a convicted sex offender or has an outstanding warrant for a violent offense, the managing agency shall prohibit the resident from residing at the encampment and shall immediately contact the sheriff's office with the information. (Ord. 17950 § 3, 2014: Ord. 15170 § 11, 2005).21A.45.070 Parking impacts. (Effective until January 1, 2025.) On-site parking spaces of the host use shall not be displaced unless sufficient parking remains available for the host's use to compensate for the loss of on-site parking spaces. (Ord. 15170 § 12, 2005).21A.45.080 Community notice and informational meeting. (Effective until January 1, 2025.) The managing agency, in partnership with the sponsor, shall:A. At least fourteen days before the anticipated start date of the homeless encampment, provide notification to all residences and businesses within five hundred feet of the boundary of the proposed homeless encampment site, but the area shall be expanded as necessary to provide notices to at least twenty different residences or businesses, as well as any homeowner association representing residents receiving notice. The notice shall contain the following specific information: 1. Name of sponsor; 2. Name of host if different from the sponsor; 3. Date the homeless encampment will begin; 4. Length of stay; 5. Maximum number of residents allowed; 6. Planned location of the homeless encampment; 7. Dates, times and locations of community informational meetings about the homeless encampment; 8. Contact information including names and phone numbers for the managing agency and the sponsor; and 9. A county contact person or agency; andB. Conduct at least one community informational meeting held on the host site, or nearby, at least ten days before the anticipated start date of the homeless encampment. The purpose of the meeting is to provide those residences and businesses that are entitled to notice under this section with information regarding the proposed duration and operation of the homeless encampment, conditions that will be placed on the operation of the homeless encampment and requirements of the written code of conduct, and to answer questions regarding the homeless encampment. (17416 § 19, 2012: Ord. 15170 § 13, 2005).21A.45.090 Compliance with permit conditions and written code of conduct. (Effective until January 1, 2025.)A. In order to assess compliance with the terms of the permit, inspections may be conducted at reasonable times without prior notice by the fire district, public health or department staff. The managing agency shall implement all directives of the fire district within forty-eight hours. Public health and department directives shall be implemented within the time specified by the respective agencies.B. Failure by the managing agency to take action against a resident who violates the terms of the written code of conduct may result in cancellation of the permit. (Ord. 15170 § 14, 2005).21A.45.095 Violations by managing agency - notice - cure - notice and orders to vacate (expires January 1, 2025). If a violation of K.C.C. 21A.45.090 is determined to have occurred, the department may issue a notice of violation to the managing agency and the sponsor. Within six days of the notice issuance, the managing agency or the sponsor shall demonstrate to the department that the violation has been cured. If the violation is not cured within this time period as determined by the department, the department may issue a notice and order as allowed by K.C.C. Title 23 requiring the residents to vacate the encampment site. By accepting the permit, and as a condition of the permit, the managing agency and the sponsor are presumed to agree to vacate the encampment site within seventeen days if a notice and order is issued and not appealed. (Ord. 17950 § 4, 2014).21A.45.100 Option to modify standards. (Effective until January 1, 2025.) An applicant for a homeless encampment may apply for a temporary use permit that applies standards that differ from those established by K.C.C. 21A.45.030, 21A.45.040, 21A.45.050, 21A.45.060, 21A.45.070, 21A.45.080 and 21A.45.090. In addition to all other permit application requirements, the applicant shall submit a description of the requirements to be modified and shall demonstrate how the modification will result in a safe homeless encampment under the specific circumstances of the application. The department shall review the proposed modifications and shall either deny or approve the application, with conditions if necessary, to ensure a safe homeless encampment with minimal impacts to the host neighborhood. The hearing examiner shall expedite the hearing on an appeal of the department's decision under this section. (Ord. 15170 § 15, 2005).21A.48INCLUSIONARY HOUSINGSections:21A.48.010Purpose - applicability - exceptions.21A.48.020Unincorporated activity center land use designation regulations.21A.48.030Skyway-West Hill and North Highline community service area subarea geographies regulations.21A.48.040Calculation of affordable dwelling units - limits on total number of market-rate dwelling units and affordable dwelling units.21A.48.050Regulation of affordable dwelling units and dimensional standards under this chapter.21A.48.060Approval of calculation of number of required affordable dwelling units and allowed market rate dwelling units a condition of development permit issuance - covenant or deed restriction required before certificate of occupancy issuance.21A.48.070Requirements of developments subject to this chapter.21A.48.080Approval of request for alternative compliance - modification or waiver of requirements for affordable dwelling units - requirements.21A.48.090Tracking and availability of use of inclusionary housing regulations -analysis in conjunction and relation to Comprehensive Plan - proposal of code changes - exception to timeline in K.C.C. 20.18.060 - department availability to brief local services and land use committee.21A.48.010 Purpose - applicability - exceptions.A. The purpose of the inclusionary housing regulations is to provide for the creation of new affordable dwelling units, particularly in areas where there is a high risk for displacement.B. The regulations and incentives in this chapter shall apply only to the Skyway-West Hill and North Highline community service area subarea geographies, as follows: 1. The standards in K.C.C. 21A.48.020 shall apply to areas with an unincorporated activity center land use designation; 2. The voluntary incentives in K.C.C. 21A.48.030 shall apply to areas that do not have an unincorporated activity center land use designation; and 3. The standards in K.C.C. 21A.48.040, K.C.C. 21A.48.050, K.C.C. 21A.48.060, K.C.C. 21A.48.070, K.C.C. 21A.48.080 and K.C.C. 21A.48.090 shall apply to any inclusionary housing project.C. Development or substantial improvement of one dwelling unit, an accessory dwelling unit, mobile home parks, cottage housing or senior citizen assisted housing shall not be subject to this chapter. Accessory dwelling units shall not be used to meet the requirements of this section. (Ord. 19555 § 22, 2022).21A.48.020 Unincorporated activity center land use designation regulations.A. This section shall apply to the unincorporated activity center land use designation.B. New or substantially improved residential or mixed-use developments shall provide affordable dwelling units, and may exceed the base density allowed in the zoning classification, in accordance with the standards listed below. Additional density is authorized with the use of transfers of development rights in accordance with K.C.C. chapter 21A.37, as shown in the table in this subsection. Additional units derived from TDRs shall conform with the percentages at the affordability levels listed. Where projects qualify, the TDR for affordable housing pilot program may be utilized in accordance with K.C.C. 21A.37.130.Mandatory Affordability RequirementsTDR AllowanceOccupancy Type and AMIMinimum Percentage of Total Units Required to be AffordableMaximum Density(as percentage of base density)Additional Maximum Density Allowed with purchase of TDRsOwner Occupied at 80% AMI100%200%None30%150%Additional 50%, up to 200% of base density15%125%Additional 50%, up to 175% of base densityAny combination of 80% AMI (Owner) and 60% AMI (Rental)100%200%None25%150%Additional 50%, up to 200% of base density12%125%Additional 50%, up to 175% of base densityRental at 60% AMI100%200%None20%150%Additional 50%, up to 200% of base density10%125%Additional 50%, up to 175% of base densityRental at 50% AMI100%200%None15% 150%Additional 50%, up to 200% of base density7% 125%Additional 50%, up to 175% of base density(Ord. 19555 § 23, 2022).21A.48.030 Skyway-West Hill and North Highline community service area subarea geographies regulations.A. This section shall apply within the Skyway-West Hill and North Highline community service area subarea geographies except for areas with an unincorporated activity center land use designation.B. New or substantially improved development may only exceed the base density allowed in the zoning classification in accordance with the standards listed below. Additional density is authorized with the use of transfers of development rights in accordance with K.C.C. chapter 21A.37, as shown in the table in this subsection. Additional units derived from TDRs shall conform with the percentages at the affordability levels listed. The price of the TDR shall be determined in accordance with K.C.C. 21A.37.130.Affordability RequirementsTDR AllowanceOccupancy Type and AMIMinimum Percentage of Total Units Required to be AffordableMaximum Density(as percentage of base density)Additional Maximum Density Allowed with purchase of TDRsDevelopments with 9 or fewer units0%100%Up to 150% base densityRental at 60% AMI100%200%None20%150%Additional 50%, up to 200% of base density10%125%Additional 50%, up to 175% of base densityRental at 50% AMI100%200%None15%150%Additional 50%, up to 200% of base density7%125%Additional 50%, up to 175% of base densityOwner Occupied at 80% AMI100%200%None30%150%Additional 50%, up to 200% of base density15%125%Additional 50%, up to 175% of base densityAny combination of 80% AMI (Owner) and 60% AMI (Rental)100%200%None25%150%Additional 50%, up to 200% of base density12%125%Additional 50%, up to 175% of base density(Ord. 19555 § 24, 2022).21A.48.040 Calculation of affordable dwelling units - limits on total number of market-rate dwelling units and affordable dwelling units.A. The number of required affordable dwelling units shall be calculated by multiplying the total number of dwelling units to be constructed by the applicable percentages of affordable dwelling units as established in K.C.C. 21A.48.020 or K.C.C. 21A.48.030, and for purposes of providing an affordable dwelling unit, fractions shall be rounded in accordance with K.C.C. 21A.12.070, except as follows: 1. For fractions below 0.50, the applicant shall pay a fee based on the fraction multiplied by the value of a single affordable dwelling unit. The fee and affordable dwelling unit value shall be calculated using the same method as required for payment in lieu of providing affordable dwelling units in K.C.C. 21A.48.080 . The revenues generated from the fee shall be dedicated to affordable housing projects in the same community service area subarea geography where the development is occurring; and 2. Affordable dwelling units in the development shall be calculated as follows: a. Studio dwelling units shall be counted as one-half of one affordable dwelling unit; b. One-bedroom and two-bedroom dwelling units shall be counted as one affordable dwelling unit; c. Three-bedroom dwelling units shall be counted as one and one-half affordable dwelling units; and d. Dwelling units with four or more bedrooms shall be counted as two affordable dwelling units.B. The total number of market-rate dwelling units and affordable dwelling units shall not exceed the total allowed density as established in this chapter and K.C.C. chapter 21A.12. (Ord. 19555 § 25, 2022).21A.48.050 Regulation of affordable dwelling units and dimensional standards under this chapter. For developments subject to this chapter:A. The affordable dwelling units shall: 1. Have a similar or larger unit size and bedroom composition as the market-rate dwelling units in the development; 2. Be integrated throughout the development; 3. Be constructed with materials and finishes of comparable quality to the market-rate dwelling units in the development; 4. Meet accessibility standards at the same ratio as required by the development; and 5. Have access equal to that of the market-rate dwelling units to on-site amenities including, but not limited to, parks, outdoor play areas, pools, exercise facilities and equipment, gathering spaces, bicycle repair facilities, shared work spaces and similar on-site amenities.B. All the dimensional standards of K.C.C. chapter 21A.12 and any applicable property-specific development standards and special district overlays apply, except as specifically prescribed by this chapter. The following modifications shall only be utilized for developments that provide housing in conformance with K.C.C. 21A.48.020 or K.C.C. 21A.48.030: 1. The maximum height limits are as follows: a. In the R-18, R-24 and R-48 zones, eighty feet; b. In the NB zone, sixty-five feet; c. In the CB zone, eighty feet; d. In the RB and O zones, eighty-five feet; and e. For properties subject to P-Suffix NH-PXX (the p-suffix established in Map Amendment 17 of Attachment D to Ordinance 19555)*: the height limits set in the P-Suffix; 2. In the R-18, R-24 and R-48 zones, any portion of a building that exceeds the base height for the zone set forth in K.C.C. chapter 21A.12 shall be set back an additional ten feet from the street property line and interior property line; 3. In the NB, CB, RB and O zones, any portion of a building that exceeds the maximum height allowed for the zone by K.C.C. 21A.12.040.B.6. shall be set back an additional ten feet from the street property line and interior property line; 4. The percentages of residential uses in mixed use developments in K.C.C. 21A.14.110 do not apply. The percentages are as follows: a. a maximum of seventy-five percent of the total built floor area when located in NB zones; and b. a maximum of eighty-five percent of the total built floor area when located in CB, RB and O zones; 5. The building floor area ratios in K.C.C. 21A.14.130 do not apply. Developments subject to this chapter shall not have a floor area ratio maximum; and 6. The parking and circulation standards of K.C.C. chapter 21A.18 apply, except: a. The minimum required parking spaces for apartments and townhouses shall be one space per dwelling unit; b. The minimum required parking spaces for nonresidential uses of the project shall be the minimum required in K.C.C. 21A.18.020, or the minimum required in any applicable property-specific development standard or special district overlay, whichever is less; and c. The director may authorize a reduction of up to fifty percent of the minimum required number of spaces for inclusionary housing projects without a required a parking study. The director shall consider proximity to transit, bedroom composition, availability of on-street parking and proposed nonresidential uses when determining the size of the reduction. (Ord. 19555 § 26, 2022).*Available in the King County Archives.21A.48.060 Approval of calculation of number of required affordable dwelling units and allowed market rate dwelling units a condition of development permit issuance - covenant or deed restriction required before certificate of occupancy issuance.A. As a condition of development permit issuance, the department shall approve the calculation of the number of required affordable dwelling units and allowed market-rate dwelling units.B. Before issuance of the certificate of occupancy, the applicant shall record a covenant or deed restriction on the property, in a form and substance acceptable to the prosecuting attorney's office and department of community of human services, reflecting the following: 1. A statement that the length of the term of the affordability shall be for the life of the development project for renter-occupied dwelling units or fifty years from the date of initial occupancy for owner-occupied dwelling units; 2. The total number of units; 3. The number of market-rate dwelling units; 4. The number and affordability of owner-occupied and rental affordable dwelling units based on the standards of this chapter; 5. A statement that for any owner-occupied dwelling units, the covenants or declarations have been reviewed by the director and the terms ensure that the purposes of this chapter are accomplished; 6. Reporting requirements as required by the department of community and human services, including subsequent community preference and affirmative marketing reports after the certificate of occupancy is issued; and 7. Signatures of the property owner and the director. (Ord. 19555 § 27, 2022).21A.48.070 Requirements of developments subject to this chapter. For developments subject to this chapter:A. As part of a complete permit application, the applicant shall submit a community preference and affirmative marketing plan. The plan shall include: 1. A tenant selection process for the affordable dwelling units that provides a preference for housing applicants with a current or past connection to the respective subarea geography where the project is located. The plan should provide no more than and aim to provide forty percent of the affordable dwelling units to tenants that meet the requirements for community preference; 2. An advertising and outreach plan designed to provide information to and attract potential housing applicants who would otherwise be less likely to apply, without regard to protected class status as established by federal, state and local laws. An affirmative advertising and outreach plan should generally help potential housing applicants know about vacancies, feel welcome to apply and have the opportunity to rent units; and 3. A process for housing applicants to file an appeal regarding the tenant selection process and verification of eligibility for preference.B. Before issuance of the building permit or subdivision approval, the community preference and affirmative marketing plan shall be reviewed and approved by the department of community and human services.C.1. At least sixty days before issuance of certificate of occupancy, the applicant shall submit a community preference and affirmative marketing initial report. The initial report shall include: a. information describing the activities conducted to implement the community preference and affirmative marketing plan; and b. information regarding the number of housing applicants: (1) that requested a preference; (2) deemed eligible under the preference criteria; (3) eligible for the preference that were selected for housing; and (4) that appealed the preference selection process and the outcome of each appeal. 2. Before issuance of the certificate of occupancy, the community preference and affirmative marketing initial report shall be subject to review and approval by the department of community and human services.D. The department of community and human services shall provide guidance and technical assistance to the applicant to ensure the community preference and affirmative marketing plan and community preference and affirmative marketing report complies with federal, state and local laws and regulations. (Ord. 19555 § 28, 2022).21A.48.080 Approval of request for alternative compliance - modification or waiver of requirements for affordable dwelling units - requirements.A. The director may, at their discretion, approve a request for alternative compliance for the inclusionary housing requirements. Requests for such modifications shall clearly set forth the facts upon which the request for relief is sought. Alternative compliance may include: 1. Providing affordable housing units off-site at another location within the same community service area subarea geography where the project is proposed; 2. Payment to the county in lieu of constructing affordable housing units to be used to create affordable housing units within the same community services area subarea geography; or 3. Such other means proposed by the applicant and approved at the discretion of the director, consistent with the following criteria for alternative compliance. B. Alternative compliance requests may only be approved when all of the following requirements are met: 1. The applicant demonstrates that the proposed alternative compliance method provides the same number and quality affordable housing units as those provided on site; 2. The affordable housing units provided through the alternative compliance method will provide the same mix of rental or owner-occupied units as would have otherwise been provided on site; and 3. In no case shall the director approve an alternative compliance request that results in zero affordable housing units being constructed on-site.C. If an alternative compliance request is approved that includes off-site affordable housing units, any building permits required for off-site affordable housing units shall be submitted before issuance of building permits or final subdivision approval for the subject property. Certificates of occupancy for off-site affordable housing units shall be issued before issuance of the final certificate of occupancy for the subject property.D. If an alternative compliance request is approved that includes payment in lieu of constructing affordable housing units, the formula for payments shall be established by department of community and human services through a public rule under K.C.C. chapter 2.98. The formula should be based on the cost to the county to construct and maintain an affordable dwelling unit. The payment obligation shall be paid before issuance of any building permits or final subdivision approval for the project.E. As part of the application review process for an inclusionary housing proposal, the director may authorize modifications to the dimensional standards in K.C.C. Title 21A. Approval of modifications may only be granted if the applicant demonstrates that the subject property cannot otherwise reasonably achieve the minimum density.F.1. As part of the application review process for an inclusionary housing proposal, the director may modify or waive the requirements for affordable dwelling units under this chapter if the applicant demonstrates that the cost of complying with this chapter would deprive the property owner of all economically beneficial use of the property or would create severe economic impact that unduly burdens the property owner. 2. Requests for such modifications shall clearly set forth the facts upon which the request for relief is sought. 3. Review of a modification or waiver of the requirements of this subsection F. may include the director considering the following factors, at a minimum: a. The severity of the economic impact caused by the application of the requirements of this chapter; b. A modification under subsection E. is not sufficient to alleviate the severity of economic impact caused by the application of the requirements of this chapter; c. The extent to which alternative uses of the property or configurations of the proposed development would alleviate the need for the requested waiver or modification; d. The extent to which any economic impact was due to decisions by the applicant or property owner; and e. Other factors relevant to whether the burden should be borne by the property owner. 4. The waiver or modification may be approved only to the extent necessary to grant relief from the deprivation of all economically beneficial use of the property or severe economic impact. 5. The following factors, on their own, shall not be a sufficient basis for the director to grant a waiver or modification for the requirements of this chapter: a. decrease in property value; b. inability for a property owner to fully utilize the increase in residential development capacity through implementation of this chapter; or c. the fact that any such increase in residential development capacity, combined with the requirements of this chapter, did not leave the property owner in a better financial position than would have been the case with no increase in residential development capacity and no application of the requirements of this chapter. (Ord. 19555 § 30, 2022).21A.48.090 Tracking and availability of use of inclusionary housing regulations - analysis in conjunction and relation to Comprehensive Plan - proposal of code changes - exception to timeline in K.C.C. 20.18.060 - department availability to brief local services and land use committee.A. The executive shall track the use of the inclusionary housing regulations in this chapter. The information shall be publicly available on a county website, and shall include, at a minimum, information describing: 1. The number and location of developments that applied to the department for approval and the number and location of developments that were subject to the requirements of this chapter; 2. The number and location of developments that applied for any alternative compliance, the number and location of developments that were granted such alternative compliance and the terms of each alternative compliance; 3. The number of market rate units and the number of affordable units constructed, including the location of all affordable units; and 4. The amount of revenue collected through in lieu and fractional fees for each subarea geography, and the amount and location those fees were spent in the subarea geography.B.1. In conjunction with the Comprehensive Plan update required by K.C.C. 20.18.060.B., excluding the 2024 Comprehensive Plan update, the executive shall analyze the inclusionary housing regulations to determine whether the purposes of the Comprehensive Plan and the inclusionary housing regulations are being met, and shall propose code changes to address any recommendations from that analysis as part of the Comprehensive Plan update to improve the efficacy of the regulations. 2. If the executive or council finds that the inclusionary housing regulations are not effective at providing for affordable housing units, nothing in this section shall prevent the executive from transmitting or the council from adopting an ordinance that modifies the regulations outside of the timeline in K.C.C. 20.18.060.C. The department shall be available to brief the local services and land use committee or its successor at least once per year on the implementation and overall efficacy of the inclusionary housing regulations and the information required by this section. (Ord. 19555 § 31, 2022).21A.49DEMONSTRATION OF FINANCIAL RESPONSIBILITYSections:21A.49.010Demonstration of financial responsibility when required by KI.C.C. chapter 21A.08.21A.49.010 Demonstration of financial responsibility when required by KI.C.C. chapter 21A.08. When required by K.C.C. chapter 21A.08, uses shall demonstrate financial responsibility as follows:A. Only for fossil fuel facilities and nonhydroelectric generation facilities, the applicant shall demonstrate financial responsibility in an amount necessary to compensate for the maximum damages that might occur from an explosion resulting from a worst-case release, as defined in 40 C.F.R. Sec. 68.3, of flammable gases and flammable liquids. The amount of financial responsibility shall be determined by the director based on a study of the maximum potential damages. The study shall: 1. Incorporate the volume of oils, gases, refrigerants, and other flammable or explosive chemicals stored, used, or generated within the facility; 2. Consider such matters as: a. the frequency of facility operations; b. facility layout and vegetation that could cause flammable vapor accumulation; c. the damages that could result from the explosion to public and private structures onsite and offsite; d. public infrastructure and environmental resources and functions; and e. The potential loss of life and injury to persons onsite and to members of the public; 3. Include modeling and disclosure of a nil or very low wind condition vapor cloud explosion scenario; 4. Be prepared by a person accredited in vapor cloud explosion analysis, or an equally qualified individual as authorized by the director, at the applicant's expense; and 5. Undergo third-party validation by a qualified entity to be hired upon mutual agreement of the applicant and the department, at the applicant's expense;B. For battery energy storage systems only, the applicant shall demonstrate financial responsibility for public liability and environmental risks, in an amount of one million dollars, conditioned upon or responsive to the applicant's payment of damages to persons and property, up to one million dollars, resulting from or caused by a thermal event at a battery energy storage system. Nothing in this subsection shall be construed to limit an applicant from voluntarily obtaining financial responsibility for public liability and environmental risks in excess of one million dollars.C. For fossil fuel facilities and nonhydroelectric generation facilities only, the applicant shall demonstrate financial responsibility in an amount necessary to compensate for facility decommissioning. The amount of financial responsibility shall be determined by the director based on a decommissioning plan for the closure of the facility. The plan shall include, but need not be limited to, the following: 1. Listing of the hazardous substances, as defined in RCW 70A.305.020, that will be stored, handled, or generated within the facility; the range of potential release volumes requiring cleanup in the event of failures of technological or safety catchment features; and whether such releases have the potential to contaminate groundwater or surface waters on or adjacent to the site; 2. The range of cleanup activities that would be required to address such hazardous substances; 3. Detailed estimates of the cost to implement the plan, including conducting cleanup and facility closure, based on the cost of hiring a third party to conduct all activities. All cost estimates must be in current dollars and may not include a net present value adjustment or offsets for salvage value of wastes or other property; and 4. Methods for estimating closure costs;D. For battery energy storage systems only, the applicant shall demonstrate financial responsibility in an amount necessary to compensate for facility decommissioning. The required financial responsibility for decommissioning, which may be packaged with, but shall be additional to, any public liability financial responsibility required by subsection B. of this section, shall be in an amount to carry out all contingencies of the decommissioning plan required by WAC 51-54A-1207, including: 1. The range of cleanup activities that would be required for site decommissioning; 2. Detailed estimates of the cost to implement the plan, including conducting facility closure, based on the cost of hiring a third party to conduct all activities. All cost estimates must be in current dollars and may not include a net present value adjustment or offsets for salvage value of wastes or other property; and 3. Methods for estimating closure costs;E. Financial responsibility shall be provided for the duration of facility operations, to be periodically reviewed, if required, in the manner prescribed for the use in K.C.C. chapter 21A.08;F.1. Financial responsibility required by this chapter may be established by any one of, or a combination of, the following methods: a. evidence of insurance; b. surety bonds issued by a bonding company authorized to do business in the United States; c. letter of credit; or d. other evidence of financial responsibility deemed acceptable by the department. 2. Self-bonding, as defined in 30 C.F.R. Sec. 800.5, shall not be an accepted method of providing financial responsibility; andG. Where enforcement of this chapter would conflict with chapter 36.32 RCW, the director may request the applicant to sign an agreement to complete retention of required financial responsibility consistent with K.C.C. 27A.30.060, in an amount equivalent to that required by this chapter, before the issuance of a clearing and grading permit. (Ord. 19824 § 17, 2024).21A.50ENFORCEMENTSections:21A.50.010Purpose.21A.50.020Authority and application.21A.50.022Inspections.21A.50.025Hazards.21A.50.030Violations defined.21A.50.035Critical areas violations - corrective work required.21A.50.037Critical areas violations - corrective work plan and monitoring.21A.50.040Permit suspension, revocation or modification.21A.50.050Initiation of revocation or modification proceedings.21A.50.010 Purpose. The purpose of this chapter is to promote compliance with this title by establishing enforcement authority, defining violations, and setting standards for initiating the procedures set forth in K.C.C. Title 23, Enforcement, when violations of this title occur. (Ord. 10870 § 629, 1993).21A.50.020 Authority and application. The director is authorized to enforce this title, any implementing administrative rules adopted under K.C.C. chapter 2.98 administration, and approval conditions attached to any land use approval, through revocation or modification of permits or through the enforcement, penalty and abatement provisions of K.C.C. Title 23, Code Compliance. (Ord. 15051 § 225, 2004: Ord. 10870 § 630, 1993).21A.50.022 Inspections. The director is authorized to make such inspections and take such actions as may be required to enforce this title. (Ord. 15051 § 226, 2004).21A.50.025 Hazards. If the director determines that an existing site, as a result of alterations regulated under this title has become a hazard to life and limb, endangers property or the environment, or adversely affects the safety, use or stability of a public way or public drainage channel, the owner of the property upon which the alterations are located, or other person or agent in control of the property, upon receipt of notice in writing from the director, shall within the period specified in the notice restore the site affected by the alterations or remove or repair the alterations so as to eliminate the hazard and conform with this title. (Ord. 15051 § 227, 2004).21A.50.030 Violations defined. No building permit or land use approval in conflict with this title shall be issued. Structures or uses that do not conform to this title, except legal nonconformances specified in K.C.C. chapter 21A.32 and approved variances, are violations subject to the enforcement, penalty and abatement provisions of K.C.C. Title 23, including, but not limited to:A. Establishing a use not permitted in the zone in which it is located;B. Constructing, expanding or placing a structure in violation of setback, height and other dimensional standards in this title;C. Establishing a permitted use without complying with applicable development standards set forth in other titles, ordinances, rules or other laws, including but not limited to, road construction, surface water management, the Fire Code and rules of the department of public health;D. Failing to carry out or observe conditions of land use or permit approval, including contract development standards;E. Failing to secure required land use or permit approval before establishing a permitted use;F. Failing to maintain site improvements, such as landscaping, parking or drainage control facilities as required by this code or other King County ordinances;G. Undertaking any development within the shoreline jurisdiction without first obtaining a required substantial development permit or required statement of exemption; andH. Undertaking any development within the shoreline jurisdiction that is exempt from the requirement to obtain a substantial development permit that is not in compliance with the policy of RCW 90.58.020 and the requirements of chapter 173-26 WAC and the King County shoreline master program. (Ord. 16985 § 116, 2010: Ord. 10870 § 631, 1993).21A.50.035 Critical areas violations - corrective work required.A. A person who alters a critical area or buffer in violation of law shall undertake corrective work in compliance with this chapter and K.C.C. chapter 23.08. When feasible, corrective work shall include restoration of the critical area and buffer. Corrective work shall be subject to all permits or approvals required for the type of work undertaken. In addition, the violator shall be subject to all fees associated with investigation of the violation and the need for corrective work.B. When a wetland or buffer is altered in violation of this title, restoration of the wetland and buffer shall comply with the restoration standards in K.C.C. 21A.24.340.C. When an aquatic area or buffer is altered in violation of this title, restoration of the stream and buffer shall comply with the restoration standards in K.C.C. 21A.24.380.D. All corrective work shall be completed within the time specified in the corrective work plan, but in no case later than one year from the date the corrective work plan is approved by the department, unless the director authorizes a longer period. The violator shall notify the department when restoration measures are installed and monitoring is commenced.E. Any failure to satisfy corrective work requirements established by law or condition including, but not limited to, the failure to provide a monitoring report within thirty days after it is due or comply with other provisions of an approved corrective work plan shall constitute a default, and the department may demand payment of any financial guarantees or require other action authorized by K.C.C. Title 27A or other applicable law.F. Reasonable access to the corrective work site shall be provided to King County for the purpose of inspections during any monitoring period. (Ord. 15051 § 228, 2004).21A.50.037 Critical areas violations - corrective work plan and monitoring.A. Except as otherwise provided in subsection D. of this section, a person who violates this title shall submit a proposed corrective work plan to the department for approval. The department may modify the plan and shall approve it only if the department determines that the plan complies with the requirements for mitigation plans in K.C.C. 21A.24.130.B. All corrective work shall be accomplished according to the approved corrective work plan, and corrective work shall not be undertaken until after approval of the plan by the department.C. Corrective work shall be monitored in accordance with the approved corrective work plan. Monitoring may be required for up to five years. Monitoring under the corrective work plan shall comply with the monitoring requirements in K.C.C. 21A.24.130.D. The director may exempt from this section emergency response activities or other actions required to be undertaken immediately or within a time too short to allow full compliance with this title or to avoid an imminent threat to public health or safety or to property. (Ord. 15051 § 229, 2004).21A.50.040 Permit suspension, revocation or modification.A. Permit suspension, revocation, or modification shall be carried out through the procedures set forth in K.C.C. Title 23. Any permit, variance, or other land use approval issued by King County pursuant to this title may be suspended, revoked, or modified on one or more of the following grounds: 1. The approval was obtained by fraud; 2. The approval was based on inadequate or inaccurate information; 3. The approval, when given, conflicted with existing laws or regulations applicable thereto; 4. An error of procedure occurred which prevented consideration of the interests of persons directly affected by the approval; 5. The approval or permit granted is being exercised contrary to the terms or conditions of such approval or in violation of any statute, law, or regulation; 6. The use for which the approval was granted is being exercised in a manner detrimental to the public health or safety; 7. The holder of the permit or approval interferes with the director or any authorized representative in the performance of the director or any authorized representative's duties; or 8. The holder of the permit or approval fails to comply with any notice and order issued pursuant to K.C.C. Title 23.B. Authority to revoke or modify a permit or land use approval shall be exercised by the issuer. (Ord. 19648 § 50, 2023: Ord. 18683 § 58, 2018: Ord. 10870 § 632, 1993).21A.50.050 Initiation of revocation or modification proceedings.A. The director may suspend any permit, variance or land use approval issued by any King County issuing agency and processed by the department pending its revocation or modification, or pending a public hearing on its revocation or modification;B. The issuing agency may initiate proceedings to revoke or modify any permit or land use approval it has issued; andC. Persons who are aggrieved may petition the issuing agency to initiate revocation or modification proceedings, and may petition the director to suspend a permit, variance or land use approval pending a public hearing on its revocation or modification. (Ord. 10870 § 633, 1993).21A.55DEMONSTRATION PROJECTSSections:21A.55.010Purpose.21A.55.020Demonstration project - authority, application and designation.21A.55.030Demonstration project - general provisions.21A.55.050Demonstration project overlay - rural forest demonstration project.21A.55.060Demonstration project overlay - low-impact development and Built Green.21A.55.101Sustainable communities and housing projects.21A.55.105Regional motor sports facility – master planning process demonstration project.21A.55.110Remote tasting room – demonstration project A.21A.55.125Alternative housing demonstration project.21A.55.010 Purpose. The purpose of this section is to provide for "demonstration projects" as a mechanism to test and evaluate alternative development standards and processes before amending King County policies and regulations. Alternative development standards might include standards affecting building and/or site design requirements. Alternative processes might include permit review prioritization, alternative review and revision scheduling, or staff and peer review practices. All demonstration projects shall have broad public benefit through the testing of new development regulations and shall not be used solely to benefit individual property owners seeking relief from King County development standards. A demonstration project shall be classified by the metropolitan King County council. Classification of each new demonstration project shall occur through an ordinance which amends this code and shall include provisions that prescribe the purpose or purposes and location or locations of the demonstration project. Demonstration projects shall be located in urban areas, rural areas or natural resource lands, or any combination thereof, which are deemed most suitable for the testing of the proposed alternative development regulations. Within such areas development proposals may be undertaken to test the efficacy of alternative regulations that are proposed to facilitate increased quality of development and/or increased efficiency in the development review processes. (Ord. 19146 § 86, 2020: Ord. 12627 § 1, 1997).21A.55.020 Demonstration project - authority, application and designation.A. In establishing any demonstration project, the council shall specify the following: 1. The purpose of the demonstration project; 2. The location or locations of the demonstration project; 3. The scope of authority to modify standards and the lead agency, department or division with authority to administer the demonstration project; 4. The development standards established by this title or other titles of the King County Code that affect the development of property that are subject to administrative modifications or waivers; 5. The process through which requests for modifications or waivers are reviewed and any limitations on the type of permit or action; 6. The criteria for modification or waiver approval; 7. The effective period for the demonstration project and any limitations on extensions of the effective period; 8. The scope of the evaluation of the demonstration project and the date by which the executive shall submit an evaluation of the demonstration project; and 9. The date by which the executive shall submit an evaluation of specific alternative standards and, if applicable, proposed legislation.B. A demonstration project shall be classified by the metropolitan King County council through the application of a demonstration project overlay to properties in a specific area or areas. A demonstration project shall be indicated on the zoning map and as a notation in the geographic information system data layers maintained by the department of local services, permitting division, by the suffix "-DPA" (meaning demonstration project area) following the map symbol of the underlying zone or zones. Within a classified demonstration project area, approved alternative development regulations may be applied to development applications. (Ord. 19146 § 87, 2020: Ord. 18791 § 193, 2018: Ord. 17485 § 46, 2012: Ord. 17420 § 120, 2012: Ord. 12627 § 2, 1997).21A.55.030 Demonstration project - general provisions.A. The demonstration projects set forth in this chapter are the only authorized demonstration projects. New or amended demonstration projects to carry out new or different goals or policies shall be adopted as part of this chapter.B. Demonstration projects must be consistent with the King County Comprehensive Plan. Classification of a demonstration project and its provisions to waive or modify development standards must not require nor result in amendment of the Comprehensive Plan nor the Comprehensive Plan land use map.C. Unless they are specifically modified or waived pursuant to the provisions of this chapter, the standard requirements of this title and other county ordinances and regulations shall govern all development and land uses within a demonstration project area. Property-specific development standards (P-suffix conditions) as provided in K.C.C. chapter 21A.38 shall supersede any modifications or waivers allowed by the provisions of this chapter.D. Demonstration project sites should be selected so that any resulting amended development standards or processes can be applied to similar areas or developments. Similar areas could include those with similar mixes of use and zoning. Similar developments could include types of buildings such as commercial or multifamily and types of development such as subdivisions or redevelopment. (Ord. 19146 § 88, 2020: Ord. 12627 § 3, 1997).21A.55.050 Demonstration project overlay - rural forest demonstration project.A. The purpose of the rural forest demonstration project is to test techniques to maintain long-term forest uses in areas with a predominant parcel size of significantly less than eighty acres that are located in proximity to residential development. The demonstration project will also provide information and data to assist in the development of King County Comprehensive Plan policies to guide application and refinement of forest protection regulations.B. The rural forest demonstration project will be implemented on the five-hundred-ten-acre site located east of the Rattlesnake Mountain Scenic Area, as shown in Attachment A to Ordinance 13275*.C. The rural forest demonstration project shall include: 1. Preparation of a forest management plan for the entire demonstration project site. The forest management plan shall be developed jointly by the department of natural resources and parks and the property owner with input from the Washington state Department of Natural Resources, local tribes and citizens, and shall be approved by the director of the department of natural resources and parks. The forest management plan shall include: a. an inventory of existing conditions, including current tree species and respective size ranges, understory composition, critical areas, natural and human induced disturbance regimes and history of ecosystem changes; b. objectives for forest management including water quality protection, habitat enhancement, maintenance of scenic areas, surface water management and minimal impacts to neighbors. c. a reforestation element consistent with these management objectives including establishment of stream buffers of one hundred eighty-three feet for Class II streams with salmonids and one hundred feet for Class III streams; and d. an operation and maintenance element including anticipated harvest activities; 2. Creation of a dedicated fund of the Uplands Snoqualmie Valley Homeowners Association the proceeds of which may be expended solely to implement and monitor the forest management plan. The net proceeds of any harvest of forest products from the common tracts of the Uplands Snoqualmie Valley shall be deposited in such fund to the extent necessary to bring the aggregate amount of money in such fund to an amount reasonably anticipated to be needed to pay the cost of implementing and monitoring the forest management plan for the current and next two calendar years; 3. Creation of a Stewardship Committee of the Uplands Snoqualmie Valley Homeowners Association to implement the forest management plan. The stewardship committee shall, in consultation with King County and Washington state Department of Natural Resources: ensure sufficient funding is available for implementation of the forest management plan, hire a qualified forester or foresters to implement the forest management plan and hire qualified staff to monitor implementation of the forest management plan and prepare required reports. King County and the Washington state Department of Natural Resources shall annually inspect the property for compliance with the forest management plan consistent with the terms of the conservation easement and King County shall offer training to the members of the stewardship committee on forestry techniques and issues; 4. Application and review of a formal subdivision of forty-one lots, exclusive of common tracts, on the five hundred-ten-acre site. The subdivision and infrastructure shall be designed to integrate with the forest landscape, including pavement widths no wider than needed to meet safety considerations. A goal of the demonstration project is to test the marketability of these forest lots in a timely manner; to that end, it is a goal of King County to render a decision on the subdivision application within six months of submittal of the application. A priority review process shall be implemented as permitted by K.C.C. 21A.55.010. The department of local services, permitting division, shall assign a permit coordinator and a project review team to complete review of all aspects of the application, and shall negotiate appropriate fees for the review process with the applicant. Neither the designation of the site as a demonstration project nor approval of the forest management plan constitute approval of the subdivision application or in any way limit King County discretion in SEPA review or application of regulations to the subdivision application; 5. Dedication or conveyance, upon final plat approval, to King County or a qualified nonprofit conservation organization of a conservation easement in perpetuity upon the demonstration project site that: prohibits any future subdivision activity; prohibits all development of the site other than residential development of no more than forty-one lots; restricts such residential development and associated lawn, landscaped areas, driveways and fenced areas to an area not to exceed two acres within each lot; restricts the uses of the remaining nonresidential portion of the site to open space and forest practices and incidental uses necessary for the residential use on the forty-one lots such as for roads, access drives (not including on-site driveways) utilities and storm detention; provides for the dedicated fund as described in K.C.C. 21A.55.050C.2; requires the owner to exercise its reasonable best efforts to implement the forest management plan and provides for enforcement of the terms of the conservation easement first through nonbinding mediation. Adoption of this demonstration project shall be subject to council review of the conservation easement, a copy of which shall be provided to the council by August 20, 1998; and 6. An inventory of properties within King County with similar characteristics to the rural forest demonstration project site and an analysis of the potential effects of development of those properties under the same requirements as the demonstration project.D. Application to modify or waive development standards of K.C.C. Title 21A for this individual development proposal shall be administratively approved by the director and shall be consistent with an approved forest management plan developed for the entire five-hundred-ten acre site.E. The application to modify or waive development standards for this development proposal shall be evaluated on the merits of the specific proposal. Approval or denial of a proposed modification or waiver shall not be construed as precedent setting for elsewhere in the county.F. Modification or waivers approved pursuant to the rural forest demonstration project shall be in addition to those modifications or waivers that are currently allowed by K.C.C. Title 21A. The range of proposed modifications to development regulations that may be considered pursuant to the rural forest demonstration project shall only include the following zoning code regulations: 1. Development Standards - Landscaping and Water Use, K.C.C. chapter 21A.16, limited to the following sections: a. landscaping - street frontages, K.C.C. 21A.16.050; b. landscaping - interior lot lines, K.C.C. 21A.16.060; and c. landscaping - additional standards for required landscape areas, K.C.C. 21A.16.090. 2. Development Standards - Parking and Circulation, K.C.C. chapter 21A.18, limited to the following sections: a. pedestrian and bicycle circulation and access, K.C.C. 21A.18.100; and b. off-street parking plan design standards, K.C.C. 21A.18.110.G. The modification or waiver review process is as follows: 1. Requests for modifications or waivers may only be submitted in relation to a formal subdivision proposal; 2. Requests shall be: a. submitted to the department of local services, permitting division, prior to or in conjunction with the subdivision application for preliminary approval of a formal subdivision on the project site; and b. in writing, along with any supporting documentation. The supporting documentation must illustrate how the proposed modification meets the criteria of K.C.C. 21A.55.050.H; 3. Notice of application, review and approval of proposed modifications or waivers submitted in conjunction with a formal subdivision application shall be treated as a Type 2 land use decision. In approving a proposed modification or waiver, the director must conclude that the criteria for approval in K.C.C. 21A.55.050.H have been met; 4. A preapplication meeting to determine the need for, and the likely scope of, a proposed modification or modifications or waiver or waivers shall be required prior to submittal of a modification request; and 5. Administrative appeals of director approved modifications or waivers shall be combined with consideration of the underlying application for preliminary subdivision approval.H. The application for a rural forest demonstration project must, for modification or waiver approval, demonstrate how the proposed project, with modifications or waivers to the code, will be consistent with and implement the approved forest management plan. This shall be demonstrated by documenting that the development with modifications or waivers: 1. Enhances the preservation of forestry for resource value, open space, scenic views and wildlife habitat; 2. Reduces impacts on the natural environment or restores natural functions; and 3. Supports the integration of forest uses and homesites.I. The forest management plan for a rural forest demonstration project shall be developed and a decision on its approval or denial shall be reached no more than thirty days after designation of the site as a rural forest demonstration project. If the forest management plan is not approved thirty days after designation as a rural forest demonstration project, the executive shall propose restoring the site to its prior land use designations and zoning classifications as part of the 1999 amendments to the King County Comprehensive Plan. Regulatory modification or waiver applications authorized by Ordinance 13275 shall not be accepted by the department of local services, permitting division, after March 1, 1999. Modifications or waivers to the King County Code contained within an approved development proposal shall be valid as long as the underlying permit. The rural forest demonstration project shall continue for a period of five years from the final approval of the subdivision application, with reporting periods specific to measuring the goals of the forest management plan.J. The director of the department of natural resources and parks shall submit a report on the rural forest demonstration project to the council following approval of the forest management plan evaluating the process used to prepare the forest management plan, an inventory of other properties that have similar characteristics to the demonstration project site, the applicability and potential effects of allowing these other properties to develop under the same requirements as the demonstration project and recommending any changes that should be made to county policy or regulations to maintain long-term forestry in areas no longer managed for large-scale commercial forestry. In addition, a report shall be prepared annually by qualified staff retained by the Stewardship Committee of the Uplands Snoqualmie Valley Homeowners Association or subsequent management entity of the forest management plan and submitted to the Rural Forest Commission. The annual reporting shall commence six months following final approval of the subdivision. The first two annual reports shall describe the annual work program and budget for implementation of the forest management plan, progress made in implementing the work program, and success in marketing the homesites. Annual reports for the subsequent three years shall document the annual budget and continued progress in implementing the forest management plan, the level of involvement by homeowners in forest management and any problems in implementation generated by homeowners. The Rural Forest Commission shall review the annual reports and shall inform the director of the department of natural resources and parks if it has found that necessary implementation measures of the forest management plan have not been followed. If so, and if the director of the department of natural resources and parks determines it is necessary, the director shall request the Stewardship Committee of the Uplands Snoqualmie Valley Homeowners Association to take corrective action. If satisfactory action is not taken, the director may invoke the enforcement mechanism of the conservation easement. The annual reports will also provide information for further consideration of changes to county policies or regulations for maintenance of long-term forestry. (Ord. 18791 § 194, 2018: Ord. 17420 § 121, 2012: Ord. 15606 § 31, 2006: Ord. 14199 § 239, 2001: Ord. 13275 § 1, 1998).*Available in the King County Archives.21A.55.060 Demonstration project overlay – low-impact development and Built Green.A. The purpose of the low-impact development and Built Green demonstration projects is to determine whether innovative permit processing, site development and building construction techniques based on low-impact development and building construction practices result in environmental benefits, affordable housing and lead to administrative and development cost savings for project applicants and King County. The demonstration projects will provide information on application of these techniques to an urban infill mixed-use redevelopment project, an urban single family residential project, a Vashon Town housing project and an urban infill residential redevelopment project. The demonstration projects will also provide information to assist in the development of King County Comprehensive Plan policies to guide application and refinement of regulations such as zoning, subdivision, roads and stormwater regulations. Expected benefits from the demonstration projects include: improved conditions of habitat, ground and surface waters within a watershed; reduced impervious surface areas for new site infrastructure in developed and redeveloped projects; greater use of recycled-content building materials and more efficient use of energy and natural resources; and the opportunity to identify and evaluate potential substantive changes to land use development regulations that support and improve natural functions of watersheds. The demonstration projects will also evaluate whether consolidated administrative approval of modifications or waivers and any subsequent hearings, if required, effectively speeds the development review process while maintaining land use coordination and environmental protection, and whether that leads to administrative costs savings for project applicants and King County.B. The department shall implement the low-impact development and Built Green demonstration projects in all or a portion of each of the following: the White Center neighborhood of the Greenbridge Project as described in Attachment A to Ordinance 14662*; the unincorporated Urban Area north of Burien at approximately 4th Avenue Southwest and Southwest 116th Street known as Park Lake Homes II as described in Attachment A to Ordinance 16099*; the unincorporated Urban Area east of Renton at approximately 148th Avenue Southeast and Southeast 128th Street as described in Attachment B to Ordinance 14662*; and the Vashon Town as described in Attachment C to Ordinance 14662*. If the geographic boundaries of the Greenbridge Project are expanded, the provisions of Ordinance 14662 may apply provided the criteria in subsection L. of this section are met.C. A request by the applicant to modify or waive development standards for the development proposals shall be evaluated by the department based on the criteria in subsection L. of this section. A request shall first be either approved or denied administratively and may be further reviewed as described in subsection H.3. of this section. Approval or denial of the proposed modification or waiver shall not be construed as applying to any other development application either within the demonstration project area or elsewhere in the county.D. A modification or waiver approved by the department in accordance with the low-impact development and Built Green demonstration projects shall be in addition to those modifications or waivers that are currently allowed by K.C.C. Title 9 and this title. The range of proposed modifications or waivers to development regulations that may be considered pursuant to the low-impact development and Built Green demonstration projects shall include only the following King County code regulations and related public rules: 1. Drainage review requirements: K.C.C. chapter 9.04 and the Surface Water Design Manual; 2. King County road standards: K.C.C. 14.42.010 and the King County road design and construction standards; 3. Density and dimensions: K.C.C. chapter 21A.12, if the base density is that of the zone applied to the entire demonstration project and if the minimum density is not less than the minimum residential density of the zone calculated for the portion of the site to be used for residential purposes, in accordance with K.C.C. 21A.12.060. However, if a demonstration project provides fifty-one percent or more of the housing to households that, at the time of initial occupancy, have incomes of eighty percent or less of median income for King County as periodically published by the United States Department of Housing and Urban Development, or its successor, or if fifty-one percent or more of the rental housing is permanently priced to serve low-income senior citizens, then the director may approve: a. less than the minimum density; and b. for parcels within the area bounded by SW Roxbury Street, 12th Avenue SW, SW 102nd Street and 2nd Avenue SW that are developed in conjunction with the Greenbridge Project, greater than the maximum density, up to a maximum of R-48 (Residential forty-eight dwelling units per acre); 4. Design requirements: K.C.C. chapter 21A.14; 5. Landscaping and water use: K.C.C. chapter 21A.16; 6. Parking and circulation: K.C.C. chapter 21A.18; 7. Signs: K.C.C. chapter 21A.20; and 8. Environmentally sensitive areas: K.C.C. chapter 21A.24, if the modification results in a net improvement to the functions of the sensitive area.E. A demonstration project authorized by this section and located in the R-12 through R-48 zones may contain residential and limited nonresidential uses subject to the following provisions: 1. The demonstration project may request a modification or waiver of any of the development conditions contained in K.C.C. 21A.08.030, 21A.08.040, 21A.08.050, 21A.08.060, 21A.08.070, 21A.08.080 and 21A.08.100, subject to the review process described in subsection H. of this section and the criteria described in subsection L. of this section.2. The demonstration project may include single family detached residential dwelling units as a permitted use, subject to the review process described in subsection H. of this section and the criteria described in subsection L. of this section. 3. The demonstration project may include any nonresidential use allowed as a permitted use in the NB zone, subject to any development conditions contained in K.C.C. 21A.08.040, 21A.08.050, 21A.08.060, 21A.08.070, 21A.08.080 and 21A.08.100, without the need to request a modification or waiver as described in subsection H. of this section. The applicant may request a modification or waiver of the development conditions contained in K.C.C. 21A.08.030, 21A.08.040, 21A.08.050, 21A.08.060, 21A.08.070, 21A.08.080, and 21A.08.100, subject to the criteria in subsection L. of this section. If a nonresidential use is permitted in the R-12 through R-48 zones, subject to development conditions, and is permitted in the NB zone without development conditions, the use shall be permitted in the demonstration project without development conditions and without the need to request a modification or waiver. 4. If a nonresidential use is subject to a conditional use permit in the R-12 through R-48 zones and not subject to a conditional use permit in the NB zone, the use shall be permitted in the demonstration project without requiring a conditional use permit. 5. If a use is subject to a conditional use permit in both the R-12 through R-48 zones and the NB zone or only in the NB zone, the use may be permitted in the demonstration project if the demonstration project applies for and obtains a conditional use permit and satisfies the conditional use permit criteria. 6. Uses authorized by this subsection shall be allowed only as part of a demonstration project under this section. All such uses shall be subject to the development standards in KCC 21A.12.030, except as may be modified or waived under subsection D. of this section and this subsection E.F. A site in the NB and R-12 through R-48 zones located in a demonstration project authorized by this section may contain residential uses subject to the following: 1. The demonstration project may request a modification or waiver for the site of any of the development conditions contained in K.C.C. 21A.08.030, 21A.08.040, 21A.08.050, 21A.08.060, 21A.08.070, 21A.08.080 and 21A.08.100, subject to the review process described in subsection H. of this section and the criteria described in subsection M. of this section; 2. The site may include single family detached residential dwelling units as a permitted use, subject to the review process under subsection H. of this section and the criteria described in subsection M of this section; 3. The site may include any residential use allowed as a permitted use in the R-12 through R-48 zones, subject to any development conditions in K.C.C. 21A.08.030, without the need to request a modification or waiver under subsection H. of this section. The applicant may request a modification or waiver of the development conditions in K.C.C. 21A.08.030, subject to the criteria in subsection M. of this section. If a residential use is permitted, subject to development conditions, in the NB zone and is permitted without conditions in the R-12 through R-48 zones, the use shall be permitted without development conditions and without the need to request a modification or waiver; 4. If a residential use is a conditional use in the NB zone and is a permitted use in the R-12 through R-48 zones, the use shall be permitted as a permitted use under the conditions that apply in the R12 through R-48 zones; 5. If a use is subject to a conditional use permit in both the R-12 through R-48 zones and the NB zone or only in the R-12 through R-48 zones, the use shall be permitted in the demonstration project if the demonstration project applies for and obtains a conditional use permit and satisfies the conditional use permit criteria; and 6. Uses authorized by this subsection shall be allowed only as part of a demonstration project under this section. All such uses shall be subject to the development standards in K.C.C. 21A.12.040, except as may be modified or waived under subsection D. of this section and this subsection F.G. This subsection authorizes a residential basics program for townhouse and apartment building types if such housing are located in a demonstration project located in the R-12 through R-48 zones, even if not otherwise authorized by the department of local services public rules chapter 16-04: residential basics program.H.1. Requests for a modification or waiver made in accordance with this section may only be submitted in writing in relation to the following types of applications: a. a site development permit; b. a binding site plan; c. a building permit; d. a short subdivision; e. a subdivision; f. a conditional use permit; or g. a clearing and grading permit. 2. Requests shall be submitted to the department in writing before or in conjunction with an application for one or more of the permits listed in this subsection, together with any supporting documentation. The supporting documentation must illustrate how the proposed modification meets the criteria of subsection L. of this section. 3. Except for an applicant’s request for a modification or waiver submitted in conjunction with an application for a subdivision, the notice of application, review and approval of a proposed modification or waiver shall be treated as a Type 2 land use decision in accordance with K.C.C. 20.20.020. The request for a modification or waiver submitted in conjunction with an application for a subdivision shall be treated as a Type 3 land use decision in accordance with K.C.C. 20.20.020. 4. A preapplication meeting with the applicant and the department to determine the need for and the likely scope of a proposed modification or waiver is required before submittal of such a request. The department of natural resources and parks and the department of local services, road services division, shall be invited to participate in the preapplication meeting, if necessary. 5. If the applicant requests a modification or waiver of K.C.C. 9.04.050 or the Surface Water Design Manual, the director shall consult with the department of natural resources and parks before granting the modification or waiver. 6. If the applicant requests a variance from the county road standards, the director shall refer the request to the county road engineer for decision under KCC 14.42.060, with the right to appeal within the department of local services, road services division, as provided in K.C.C. 14.42.060. The purposes of this demonstration ordinance are intended as a factor to be considered relative to the public interest requirement for road variances described in K.C.C. 14.42.060. 7. Administrative appeals of modifications or waivers approved by the director shall be combined with any appeal of the underlying permit decision, if the underlying permit is subject to appeal.I. The hearing examiner may consider an environmental impact statement adequacy appeal in conjunction with a demonstration project plat appeal if the environmental impact statement is prepared by a lead agency other than the department and if its adequacy has not previously been adjudicated, even if not otherwise authorized by K.C.C. 20.44.120.J. An approved development proposal for any of the applications listed in subsection H.1. of this section, including site plan elements or conditions of approval, may be amended or modified at the request of the applicant or the applicant's successor in interest designated by the applicant in writing. The director may administratively approve minor modifications to an approved development proposal. Modifications that result in major changes as determined by the department or as defined by the approval conditions, shall be treated as a new application for purposes of vesting and shall be reviewed as applicable to the underlying application pursuant to K.C.C. 20.20.020. Any increase in the total number of dwelling units above the maximum number set forth in the development proposal permit or approval shall be deemed a major modification. The county, through the applicable development proposal permit or approval conditions, may specify additional criteria for determining whether proposed modifications are major or minor. The modifications allowed under this section supersede other modification or revision provisions of K.C.C. Title 16, Title 19A and this title.K.1. The preliminary subdivision approval of a subdivision with more than four hundred units that is part of a demonstration project under this section shall be effective for eighty-four months, even if not otherwise authorized by K.C.C. 19A.12.020. The director may administratively grant a one-time extension, extending the preliminary subdivision approval an additional five years, only if the applicant has shown substantial progress towards development of the demonstration project. Before granting the extension, the director will assess the applicant’s compliance with the demonstration project conditions and may modify or impose new standards deemed necessary for the public health or safety. 2. A code modification or waiver approved under this section is effective during the validity of the underlying development permit or for forty-eight months, whichever is longer.L.1. To be eligible to use the provisions of the demonstration project, development proposals must be located within the boundaries of the Greenbridge Project as described in Attachment A to Ordinance 15654*, or as may be modified as described in subsection B. of this section; in the unincorporated urban area north of Burien at approximately 4th Avenue Southwest and Southwest 116th Street known as Park Lake Homes II as described in Attachment A to Ordinance 16099*; in the area east of Renton at approximately 148th Avenue Southeast and Southeast 128th Street as described in Attachment B to Ordinance 14662*; and in the Vashon Town as described in Attachment C to Ordinance 14662*. 2. Proposals to modify or waive development regulations for a development application must be consistent with general health, safety and public welfare standards, and must not violate state or federal law. 3.a. Applications must demonstrate how the proposed project, when considered as a whole with the proposed modifications or waivers to the code, will meet all of the criteria listed in this subsection, as compared to development without the modification or waiver, and achieves higher quality urban development; enhances infill, redevelopment and greenfield development; optimizes site utilization; stimulates neighborhood redevelopment; and enhances pedestrian experiences and sense of place and community. b. Any individual request for a modification or waiver must meet two or more of the following criteria: (1) uses the natural site characteristics to protect the natural systems; (2) addresses stormwater and drainage safety, function, appearance, environmental protection and maintainability based upon sound engineering judgment; (3) contributes to achievement of a two-star or a three-star rating for the project site under the Built Green "Green Communities" program recognized by the Master Builders Association of King and Snohomish counties; or (4) where applicable, reduces housing costs for future project residents or tenants without decreasing environmental protection. 4. The criteria of this subsection supersede other variance, modification or waiver criteria and provisions of K.C.C. Title 9 and Title 21A.M.1. Except for Park Lake Homes II and the part of Greenbridge that was added to the demonstration project by Ordinance 15654, regulatory modification and waiver applications, or both, authorized by this section shall be filed with the department by December 31, 2007, or by such a later date as may be specified in the conditions of any development approval for any type of modification or waiver for which the opportunity for future application is expressly granted in those conditions. For Park Lake Homes II and the part of Greenbridge that was added to the demonstration project by Ordinance 15654, regulatory modification and waiver applications, or both, authorized by this section shall be filed with the department by December 31, 2010, or by such a later date as may be specified in the conditions of any development approval for any type of modification or waiver for which the opportunity for future application is expressly granted in those conditions. 2. Modifications or waivers contained within an approved development proposal shall be valid as long as the underlying permit or development application approval is valid. A permit or approval that implements an approved code modification or waiver shall be considered under the zoning and other land use control ordinances in effect on the date the applicable complete code modification or waiver application is filed. 3. Except for Park Lake Homes II and the part of Greenbridge that was added to the demonstration project by Ordinance 15654, modifications or waivers that are approved as separate applications must be incorporated into a valid permit or development application that must be filed by December 31, 2007. For Park Lake Homes II and the part of Greenbridge that was added to the demonstration project by Ordinance 15654, modifications or waivers that are approved as separate applications must be incorporated into a valid permit or development application that must be filed by December 31, 2010. 4. The director may extend the date for filing the demonstration project permit and development applications for a maximum of twelve months. 5. Except for Park Lake Homes II and the part of Greenbridge that was added to the demonstration project by Ordinance 15654, the ability to establish the location and maximum size of uses that are not otherwise permitted in the R-12 through R-48 zones as set forth in subsection E. of this section expires December 31, 2007. For Park Lake Homes II and the part of Greenbridge that was added to the demonstration project by Ordinance 15654, the ability to establish the location and the maximum size of uses that are not otherwise permitted in the R-12 through R-48 zones as set forth in subsection E. of this section expires December 31, 2010. The ability to establish the location and maximum size of uses that are not otherwise permitted in the NB zone or the R-18 zone as set forth in subsection F. of this section expires at the end of the effective period established in subsection K. of this section. 6. Any deadline set forth in this subsection shall be adjusted to include the time for appeal of all or any portion of the project approval.N.1. By December 31, 2006, the director shall prepare and submit to the council a report on the pilot programs that: a. describes and evaluates the pertinent preliminary results from the demonstration projects; and b. recommends changes, based on the evaluation, which should be made to the county processes and ordinances. 2. If only insufficient or inconclusive data are available when this report is due, the director shall provide an interim status report and indicate the date a subsequent report or reports will be transmitted to fully evaluate outcomes of the demonstration projects. (Ord. 18791 § 195, 2018: Ord. 17420 § 122, 2012: Ord. 16099 § 1, 2008: Ord. 15654 § 1, 2006: Ord. 14662 § 1, 2003).*Available in the King County Archives.21A.55.101 Sustainable communities and housing projects.A.1. The purpose of the sustainable communities and housing demonstration projects is to provide affordable housing and workforce housing integrated into developments containing market rate housing and maximize sustainable development, which includes bike, pedestrian and transit connections, a mix of housing types, and the use of recyclable materials. The demonstration projects will provide information on the application of these techniques to urban infill redevelopment and urban single family residential development, some of which may include mixed use. The demonstration projects will also assist the county in refining regulations relating to zoning, subdivision, roads and stormwater as they relate to sustainable development. 2. The demonstration projects will also enable the county to evaluate whether consolidated administrative approval of zoning and subdivision-related modifications or waivers and any subsequent hearings, if required, effectively speeds the development review process while maintaining land use coordination and environmental protection and whether that leads to administrative costs savings for project applicants and King County.B. The expected benefits from the demonstration projects include: the use of innovative design and development techniques to promote sustainable communities, reduced impervious surface areas for site infrastructure; a greater use of recycled-content building materials and more efficient use of energy and natural resources; and the opportunity to identify and evaluate potential substantive changes to land use development regulations that support the development of sustainable and affordable housing.C. A request by the applicant to modify or waive development standards for the development proposals shall be evaluated by the department of local services, permitting division, based on the criteria in subsection J. of this section. A request shall first be either approved or denied administratively and may be further reviewed as described in subsection H.3. of this section. Approval or denial of the proposed modification or waiver shall not be construed as applying to any other development application either within the demonstration project area or elsewhere in the county.D. A modification or waiver approved by the department of local services, permitting division, in accordance with this section shall be in addition to those modifications or waivers that are currently allowed by this title. The proposed modifications or waivers to development regulations that may be considered regarding sustainable communities and housing demonstration projects shall include only the following chapters and related public rules: 1. Drainage review requirements: K.C.C. chapter 9.04 and the Surface Water Design Manual; 2. King County road standards: K.C.C. chapter 14.42 and the county road standards, 2007 update; 3. Density and dimensions: K.C.C. chapter 21A.12; 4. Design requirements: K.C.C. chapter 21A.14; 5. Landscaping and water use: K.C.C. chapter 21A.16; 6. Parking and circulation: K.C.C. chapter 21A.18; 7. Signs: K.C.C. chapter 21A.20; 8. Critical areas: K.C.C. chapter 21A.24, if the modification results in a net improvement to the functions of the critical area; and 9. Landscape installation timing: K.C.C. chapters 27A.30 and 27A.40.E. A demonstration project authorized by this section may contain residential and limited nonresidential uses subject to the following: 1. The demonstration project may include any residential uses as allowed as a permitted use in the R12 - 48 zones, subject to any development conditions in K.C.C. 21A.08.030, without the need to request a modification or waiver as described in subsection H. of this section. The applicant may request a modification or waiver of any of the development conditions for residential uses contained in K.C.C. 21A.08.030, subject to the review process described in subsection H. of this section and the criteria in subsection J. of this section; 2. The demonstration project may include, as part of a residential project, any nonresidential use allowed as a permitted use in the NB zone under K.C.C. 21A.08.030, 21A.08.040, 21A.08.050, 21A.08.060 and 21A.08.070, subject to any development conditions contained in those sections without the need to request a modification or waiver as described in subsection H. of this section, except the following uses are not allowed: a. automotive parking; b. automotive repair and automotive service, K. C.C. 21A.08.050; c. commuter parking lot, K.C. C. 21A.08.060 , unless as part of a transit-oriented development. For the purposes of this subsection E.2.c., "transit-oriented development" means a development that is designated as a transit-oriented development in an agreement with the county and that includes the construction of new housing units at or within one quarter mile of a county transit center or park and ride lot; d. gasoline service stations as defined in K.C.C. 21A.08.070; e. off-street required parking lot commercial and industrial accessory uses; f. private stormwater management facility; g. self-service storage; and h. vactor waste receiving facility. 3. The nonresidential uses shall be no greater than three thousand square feet per use, with a total maximum of all nonresidential uses not to exceed ten percent of the area of the demonstration project site or twenty thousand square feet, whichever is smaller. The applicant may request a modification or waiver of the development conditions for nonresidential uses in K.C.C. 21A.08.030, 21A.08.040, 21A.08.050, 21A.08.060 and 21A.08.070, subject to the review process described in subsection H. of this section and the criteria in subsection J. of this section.F. A demonstration project authorized by this section allows a residential basics program for townhouse and apartment building types, consistent with the department of local services public rules chapter 16-04: residential basics program.G. All related review processes such as subdivision, building permit, inspection and similar processes for a demonstration project shall be expedited if: 1. Fifty percent or more of all residential units proposed for the demonstration project are affordable to households at eighty percent of area median income, as defined by Department of Housing and Urban Development income guidelines for King County and below; or 2. Seventy percent or more of all residential units for the demonstration project are affordable to households at eighty to one hundred fifteen percent of area median income, as defined by Department of Housing and Urban Development income guidelines for King County.H.1. Requests for a modification or waiver made in accordance with this section may only be submitted in writing in relation to the following types of applications: a. a site development permit; b. a binding site plan; c. a building permit; d. a short subdivision; or e. a subdivision. 2. Requests shall be submitted to the department in writing before or in conjunction with an application for one or more of the permits listed in subsection H.1. of this section, together with any supporting documentation. The supporting documentation must illustrate how the proposed modification meets the criteria in subsection J. of this section. 3. Except for an applicant's request for a modification or waiver submitted in conjunction with an application for a subdivision, the notice of application, review and approval of a proposed modification or waiver shall be treated as a Type 2 land use decision in accordance with K.C.C. 20.20.020. The request for a modification or waiver submitted in conjunction with an application for a subdivision shall be treated as a Type 3 land use decision in accordance with K.C.C. 20.20.020. 4. A preapplication meeting with the applicant and the department of local services, permitting division, to determine the need for and the likely scope of a proposed modification or waiver is required before submittal of such a request. If a modification or waiver requires approval of the department of natural resources and parks or the department of local services, road services division, that department or division shall be invited to participate in the preapplication meeting. 5. If the applicant requests an adjustment from the county drainage standards, the director shall refer the request to the department of natural resources and parks for decision under K.C.C. chapter 9.04, with the right to appeal within the department of natural resources and parks as provided in K.C.C. 9.04.050.C.6. The department of natural resources and parks shall consider the purposes of this demonstration ordinance as a factor relative to the public interest requirement for drainage adjustments described in K.C.C.9.04.050.C. 6. If the applicant requests a variance from the county road standards, the director shall refer the request to the county road engineer for decision under K.C.C. 14.42.060, with the right to appeal within the department of local services, road services division, as provided in K.C.C. 14.42.060 and the associated public rule. The department of local services, road services division, shall consider the purposes of this demonstration ordinance as a factor relative to the public interest requirement for road variances described in K.C.C. 14.42.060. 7. Administrative appeals of modifications or waivers approved by the director shall be combined with any appeal of the underlying permit decision, if the underlying permit is subject to appeal.I. An approved development proposal for any of the applications listed in subsection H.1. of this section, including site plan elements or conditions of approval may be amended or modified at the request of the applicant or the applicant's successor in interest designated by the applicant in writing. The director may administratively approve minor modifications to an approved development proposal. Modifications that result in major changes as determined by the department or as defined by the approval conditions shall be treated as a new application for purposes of vesting and shall be reviewed as applicable to the underlying application pursuant to K.C.C. 20.20.020. Any increase in the total number of dwelling units above the maximum number set forth in the development proposal permit or approval shall be deemed a major modification. The county, through the applicable development proposal permit or approval conditions, may specify additional criteria for determining whether proposed modifications are major or minor. The modifications allowed under this section supersede other modification or revision provisions of K.C.C. Title 16 and Title 19A and this title.J.1. To be eligible to use the provisions of this section, a demonstration project must be located on a demonstration project site identified in Ordinance 16650, Section 2, and the applicant has accepted the site as a King County sustainable communities and housing demonstration project. 2. Proposals to modify or waive development regulations for a development application must be consistent with general health, safety and public welfare standards, and must not violate state or federal law. 3.a. Applications must demonstrate how the proposed project, when considered as a whole with the proposed modifications or waivers to the code, will meet all of the criteria in this subsection J., as compared to development without the modification or waiver, and: (1) achieves higher quality urban development; (2) provides quality infill development; (3) optimizes site utilization; and (4) enhances pedestrian experiences and sense of place and community. b. Any individual request for a modification or waiver must meet two or more of the following criteria: (1) contributes to the creation of a sustainable community, which includes features such as a connected street network, a mix of housing types, pedestrian or bike routes throughout the development, direct bus connections, no front garages, and front porches. (2) uses the natural site characteristics to protect the natural systems; (3)(a) contributes to achievement of a three-star rating for the project site under the Built Green Communities program administered by the Master Builders Association of King and Snohomish Counties; (b) contributes to achievement of a four-star or higher rating for the single family units under the Built Green program administered by the Master Builders Association of King and Snohomish Counties or achieve a gold certification under the U.S. Green Building Council, LEED program or equivalent program; or (c) contributes to achievement of a four-star or higher rating for the multifamily units under the Built Green program administered by the Master Builders Association of King and Snohomish Counties or achieve a gold certification under the U.S. Green Building Council, LEED program or other equivalent program; and (4) provides attractive, well-designed development that will assist in improving safety and preventing crime in the development and surrounding area, including adequate outdoor lighting along walkways/trails, walkways/trails 5' or wider and low vegetation along walkways/trails. 4. The criteria in this subsection supersede other variance, modification or waiver criteria and provisions of K.C.C. Title 21A.K. Regulatory modification and waiver applications, or both, authorized by this section shall be filed with the department of local services, permitting division, within three years of the approval of the development proposal, which includes issuance of a building permit or site development permit, recording of a plat, short plat or binding site plan, or by such a later date as may be specified in the conditions of any development approval for any type of modification or waiver for which the opportunity for future application is expressly granted in those conditions. Modifications or waivers contained within an approved development proposal are valid as long as the underlying permit or development application approval is valid. If modifications or waivers are approved as separate applications, they must be incorporated into a valid permit or development application within three years of approval of the development proposal. The director may extend the date for filing the demonstration project permit and development applications for a maximum of twelve months. Any deadline in this subsection shall be adjusted to include the time for appeal of all or any portion of the project approval. (Ord. 18791 § 196, 2018: Ord. 17420 § 123, 2012: Ord. 16702 § 6, 2009: Ord. 16650 § 1, 2009).21A.55.105 Regional motor sports facility – master planning process demonstration project.A. The purpose of the master planning process demonstration project is to: 1. Create a comprehensive but streamlined process for the review of major land use proposals that will be developed over the course of several years by: a. utilizing a concise timeline for project review that incorporates a process for public outreach and input during project review and facility operation; b. executing a development and operating agreement, pursuant to RCW 36.70B.170 that establishes: (1) a clearly defined project through a master development plan, which shall include a master site plan; (2) requirements that must be met before approval of each phase of development; and (3) operating standards governing all aspects of the project's operation, including, but not limited to, noise and traffic, hours and days of operation for racing, nonracing uses and number and types of events; and c. establishing a process that ensures timely and efficient review; 2. Utilize the hearing examiner, as authorized in K.C.C. 20.22.190, to conduct fact finding and reporting on compliance by the applicant with the executed development and operating agreement, as provided in subsection S. of this section; and 3. Provide for ongoing monitoring of the executed development and operating agreement by the council to ensure continued future compliance with the executed development and operating agreement.B. The master planning process demonstration project shall be implemented only for a regional motor sports facility only on the Pacific Raceways property as described in Attachment A to Ordinance 17287*.C. The master planning demonstration project shall be initiated by the applicant making a written request to the department for a preapplication meeting to identify the requirements necessary for a complete application under this section.D. A master planning proposal application shall be considered complete when the following information and studies have been submitted and are adequate to review the proposal: 1. A proposed development plan that describes the nature, size and scope and phasing of all proposed activities; 2. A proposed site plan that identifies the location and dimensions of proposed racing surfaces, access roadways, parking areas, buildings, stormwater facilities, sewage treatment or holding facilities and any off-site traffic improvements; 3. A proposed master drainage plan under the surface water design manual; 4. A proposed grading plan that identifies or includes: a. land contours; b. soil types; and c. phasing; 5. Proposed development conditions relating to: a. on-site vehicle circulation and off-site traffic control measures; b. protection for critical areas, especially adjacent to Soosette creek; c. stormwater flow control and water quality treatment; d. visual screening from adjoining residential properties; e. ongoing monitoring and reporting to measure compliance with the development and operating agreements; f. fire protection; and g. water supply and service; 6. Proposed operating conditions that specify: a. days and hours of operation; b. frequency of events; c. types of activities, including types of motor vehicles; and d. maximum noise levels; and 7. Any necessary information identified through the preapplication process.E. The development and operating agreement shall contain development standards and operating conditions related to the development and operation of the site and shall include, but shall not be limited to: 1. A master site plan and detailed conditions establishing the: a. location and scope of proposed land uses; b. location and size of buildings and structures such as grandstands; c. layout and dimensions of racing surfaces and circulation roadways; d. site elevations and contours established by a master grading plan; e. excavation and processing of materials, including dust control, during construction of the facilities; f. location and dimensions parking areas; g. location of stormwater facilities, sewage treatment facilities, water, and related features; and h. vegetative screening required in subsection F.1. of this section; 2. A master drainage plan consistent with the surface water design manual; 3. A project phasing plan, including threshold requirements that must be met before approval of the next phase of development; 4. Specified types of racing and nonracing activities, and where on the site the activities can occur; 5. Specified days and times for all racing and nonracing uses; 6. Specified noise levels for racing and nonracing uses, including but not limited to, how noise levels will be measured and mitigated; 7. Specified on-site vehicle circulation and other traffic control measures to reduce the impact of congestion on roadways in the vicinity of Pacific Raceways; 8. Specified development conditions to ensure that permitted alterations provided for in subsection G. of this section achieve the appropriate level of protections;9. Specified development conditions to ensure that stormwater flow control and water quality treatment provided for in subsection H. of this section is achieved; 10. Specified regular ongoing monitoring and reporting to measure compliance with the development and operating agreement requirements relating to noise, traffic, air quality, groundwater quality, stormwater flow control and water quality treatment and water volume and quality in Soosette creek; 11. Specified process for the receipt and evaluation by the department of inquiries and complaints relating to the operation of the facility, in order to allow for review by the hearing examiner as provided in subsection S. of this section; and 12. Specified enforcement mechanisms to address any violations of the conditions of the development agreement, including, but not limited to, the following: a. a process for monitoring condition violations and for receipt of complaints; b. a process for expedited review and remedy of possible violations; and c. a penalty schedule that recognizes the nature and impact of the violation and is sufficient to deter violations that otherwise result in financial benefit to the facility, including, but not limited to, revocation of operating permit and loss of specific days of operation.F. All development under the master plan shall be subject to the following standards relating to screening and building setbacks: as provided in K.C.C. 21A.16.030.F., to the maximum extent practical, buildings and other structures shall be constructed on the project to be shielded from view from adjoining residential properties using methods that may include, but are not limited to: 1. Retention of existing vegetation; and 2. Placement of new vegetation to augment existing vegetation.G.1. Except as otherwise provided in this subsection G.2. of this section, all development under the master plan shall comply with K.C.C. chapter 21A.24. 2. The department may approve alterations to critical areas, critical areas buffers and critical area setbacks that are not otherwise allowed as an alteration exception under K.C.C. 21A.24.070 when the applicant demonstrates that: a. the proposal does not pose an unreasonable threat to the public health, safety or welfare on or off the site; b. the proposed impacts to critical areas, critical area buffers and critical area setbacks shall be controlled and compensated for in accordance with the requirements of K.C.C. 21A.24.125; c. for proposed alterations within steep slope or landslide areas: (1) the alterations are necessary to bring existing racing or access road surfaces into compliance with applicable racing association safety standards, or to construct noise barriers or for the placement of spectator seating on the interior portion of the road course; and (2) the alterations can be constructed to maintain the stability of the hazard area through the use of structural mitigations identified through a geotechnical analysis by a licensed and qualified geotechnical professional; and d. for proposed alterations to wetlands or aquatic areas and their buffers: (1) the alterations are necessary to comply with applicable racing association safety standards either for existing racing surfaces or for providing to emergency vehicles access roads to the existing racing surfaces; (2) there is no feasible alternative to the development proposal with less adverse impact on the critical area; (3) the alteration is the minimum necessary to accommodate the development proposal; (4) the alternation has the least possible adverse impact on the critical area and critical area buffer; (5) the critical area is not used as a salmonid spawning area; (6) the director may only approve an alteration in a category III or IV wetland; and (7) the alterations to any wetland shall be mitigated in accordance with an approved mitigation plan by relocating the wetland into a new wetland, with equivalent or greater functions, or into an existing wetland at the ratios specified in K.C.C. 21A.24.340 based on the type of mitigation measures proposed.H. Uses proposed under the master planning proposal shall comply with the King County surface water design manual and shall: 1. Use enhanced basic water quality measures to treat stormwater and use stormwater infiltration facilities to manage stormwater to protect aquatic life in Big Soos and Soosette creeks and operation of the Soos Creek Hatchery, while protecting groundwater quality. The department shall consider the proposed use in determining whether spill control or special oil control measures in excess of the King County surface water design manual requirements are necessary to achieve the required environmental protections; 2. Specify and require facilities and best management practices to ensure that auto-related fluids, brake dust, and other products are properly managed and disposed of to avoid contamination of soils, surface water and groundwater; 3. Develop and implement a water quality monitoring plan to assure that copper, other metals, hydrocarbons, and other contaminants are not elevated in ground and surface waters on- site and in Big Soos and Soosette creeks; 4. Conduct flow monitoring in Big and Soosette creeks before, during and after construction to ensure that normal or preexisting flows are being maintained. 5. Conduct biotic monitoring in Big Soos and Soosette creeks before, during and after construction; 6. If the department determines it to be environmentally beneficial and if it is in compliance with the surface water design manual requirements for discharge to the natural location and is approved through an adjustment, channel surface water from impervious surfaces, including buildings, structures, pit areas, or raceways to drain away from Soosette creek and evaluate any impacts to Big Soos and Soosette creeks and to the alternative discharge location; and 7. Develop and implement an adaptive management program to correct any flow, surface or ground water quality, or biotic problem in Big Soos or Soosette creeks caused by the development.I. Site development that entails extraction and grading of soils to achieve the final site contours for development shall be subject to the following limits: 1. The amount of materials that may be extracted during any specific phase of project construction shall be only as necessary to construct that phase of the project approved for construction; and 2. The on-site processing of the extracted materials shall be limited to the sorting of the material into separate dirt, sand, and gravel components.J. The master planning proposal shall include site designs and features to reduce the level of noise impacts upon nearby residential neighborhoods.K. The department shall: 1. Schedule and conduct a preapplication meeting with applicant within thirty days of the request for such a meeting by the applicant in order to identify the full range of potential issues related to the proposed expansion of Pacific Raceways and to specifically list information or studies needed to adequately evaluate the listed issues. 2. Provide to the applicant a detailed listing of all project issues and necessary information or studies required under subsection D. of this section within thirty days after the date of the preapplication meeting; 3. Accept for filing a master planning proposal application submitted by the applicant only if it provides the information and studies required by subsection K.2. of this section; 4. Determine whether the master planning proposal is a complete application under this section and K.C.C. 20.20.050; 5. Provide a notice of a complete application under K.C.C. 20.20.060.B. In addition to notice required under K.C.C. 20.20.060.B, the department shall provide mailed notice to: a. all parties of record, including community groups or organizations, established during the review of Conditional Use Permit File Nos. A-71-0-81 and L08CU006, Proposed Ordinance 2010-0189**, or Ordinance 17287; b. persons requesting notification of any county land use action regarding Pacific Raceways; and c. residents or property owners of parcels located within twenty-five hundred feet of the boundaries of the Pacific Raceways site; 6. Not later than seven days after the applicant has filed with the department its master planning proposal, issue a determination of significance and proceed with the environmental review of the master planning proposal under Ordinance 17287, Section 6; 7. Conduct one or more public meetings on the master planning proposal application to gather information and public input on all aspects of the master planning proposal. The first meeting shall be held within thirty days after the applicant has filed its master planning proposal application with the department and may be combined with a public meeting required under Ordinance 17287, Section 5.D.4. At that public meeting, the applicant shall present its master planning proposal. At each public meeting, the public shall be provided an opportunity to comment on the master planning proposal. The department shall record all public meetings and make a written summary of the meetings available on its website within fourteen days after the meeting. The department may hold additional public meetings as it conducts its review of the master planning proposal application and shall provide an opportunity for the applicant to respond to questions at each public meeting; 8. Issue the final environmental impact statement within eighteen months of either issuing to the applicant a notice of complete application or the master planning proposal is deemed a complete application under K.C.C. 20.20.050.B. The consultant may request additional time to prepare the final environmental impact statement; 9. Not later than thirty days after the final environmental impact state is issued, propose for public review and comment a development and operating agreement consistent with this section. The department shall provide notice of the proposed development and operating agreement in the same manner as it provided the notice of application under subsection K.5. of this section. The department shall present the proposed development and operating agreement at a public meeting within fourteen days after the notice is provided under this subsection K.9.; and 10. Within sixty days after the public meeting required by subsection K.9. of this section: a. transmit to the hearing examiner the department's recommended development and operating agreement, together with a proposed ordinance authorizing the executive to execute the development and operating agreement; b. publish its recommended development and operating agreement on the department's website; and c. provide notice of its recommended development and operating agreement in the same manner as it provided the notice of application under subsection K.5.a. through c. of this section and to those governmental agencies listed in K.C.C. 20.20.090.A. The notice shall also advise: (1) that the department's recommendation is subject to an open record public hearing before the hearing examiner; (2) the date that the department's recommendation has been transmitted to the hearing examiner; and (3) that interested persons may appear as parties at the open record public hearing by filing a notice of appearance with the hearing examiner within fourteen days of the date that the department's recommendation has been transmitted to the hearing examiner. The applicant will be presumed to be a party without having to file a notice of appearance.L.1. Before the transmittal of the department's recommended development and operating agreement to the hearing examiner, the transportation, economy and environment committee or its applicable successor may request reports or briefings from the department and applicant regarding how the demonstration project is proceeding. The department shall solicit input from those identified in subsection K.5.a. through c. of section to inform the committee in the report and briefing. 2. If the department or the applicant is unable to meet a timeline established by this section as part of the process for review of the master planning proposal, the department shall provide written notice to the council within fourteen days after the missed deadline in the form of a letter to the chair of transportation, economy and environment committee or its applicable successor describing the causes for the delay, and the steps or actions needed to be taken by the department or the applicant to continue timely processing of the proposal.M.1. No sooner than fourteen days after receiving the department’s recommended development and operating agreement, the hearing examiner shall set the date for the prehearing conference and notify the parties of interest. 2. Unless otherwise agreed to by those that appear as parties, the hearing examiner shall conduct an open record public hearing within ninety days of the prehearing conference and, if necessary, shall hold the public hearing over consecutive days. 3. When the hearing examiner sets the department's recommended development and operating agreement for an open record public hearing, the department shall coordinate and assemble the reviews of other departments and governmental agencies having an interest in the application and shall prepare a report summarizing the factors involved and the department's recommendation. At least fourteen calendar days before the scheduled hearing, the department shall file the report with the hearing examiner and mail copies to those identified in subsection K.5.a. through c. of section. 4. The hearing examiner's recommendation may be to approve or reject the department's recommended development and operating agreement, or the examiner may recommend that the council adopt the department's recommended development and operating agreement with such conditions, modifications, and restrictions as the examiner finds necessary to carry out applicable state laws and regulations and the regulations, including chapter 43.21C RCW, policies, objectives, and goals of the Comprehensive Plan, the zoning code K.C.C. Title 21A and other laws, policies, and objectives of King County. 5. Within fourteen days after the conclusion of the open record public hearing, the hearing examiner shall issue a written recommendation and shall transmit a copy thereof to all persons who appeared as parties in the open record public hearing. The recommendation shall include findings of fact and conclusions from the record that support the decision and the findings and conclusions shall set forth and demonstrate the manner in which the recommendation is consistent with, carries out, and helps implement applicable state laws and regulations, the regulations, policies, objectives, and goals of the comprehensive plan and Ordinance 17287. 6. To appeal the hearing examiner's recommendation, an aggrieved party must file a notice of appeal with the clerk of the council within fourteen days of the date of the mailing of the hearing examiner's recommendation. The clerk shall notify the hearing examiner and the parties of record to the hearing examiner's open record public hearing in writing of the council's receipt of the appeal. The clerk shall also cause to have posted on the council's web page the notice of the appeal. The appellant shall file a statement of appeal with the clerk within twenty-one days of filing its notice of appeal, together with proof of service of the statement of appeal to the other parties of record. The statement of appeal must specify the basis for the appeal and any arguments in support of the appeal. Failure to file a statement of appeal shall result in the dismissal of the appeal. The clerk shall cause to have the statement of appeal posted on the council's web page. Any written responsive statements or arguments to the appeal, together with proof of service on the other parties of record, must be filed with the clerk within fourteen days after the filing of the statement of appeal. The clerk shall cause to have these responsive statements and arguments posted on the council's webpage. 7. At least fourteen days before the closed record hearing by the council of the appeal, the clerk will provide the parties of record with written notice of the hearing time and date. The council's consideration of the appeal shall be based upon the record as presented to the hearing examiner at the open record public hearing and upon written appeal statements and arguments submitted by the parties that are based on the open record public meeting. The council may allow the parties to the appeal a period of time for oral argument based on the record. Consistent with RCW 36.70B.020(1), before or at the appeal hearing and upon the request of the council, county staff may provide a written or oral summary, or both, of the appeal record, issues, and arguments presented in an appeal and may provide answers, based on the record, to questions with respect to issues raised in an appeal asked by council members at the appeal hearing. Nothing in this subsection shall be construed as limiting the ability of the council to seek and receive legal advice regarding a pending appeal from the office of the prosecuting attorney or other county legal counsel either within or outside of the hearing. 8. If, after consideration of the record, written appeal statements and any oral argument the council determines that: a. An error in fact or procedure may exist or additional information or clarification is desired, the council shall remand the matter to the hearing examiner for further hearing to receive additional information or further consideration; or b. The recommendation of the hearing examiner is based on an error in judgment or conclusion, the council may modify or reverse the recommendation of the hearing examiner. 9. a. The council's final action on any recommendation of the hearing examiner shall be by ordinance, which shall include findings of fact and conclusions from the record of the hearing examiner's public hearings. The findings and conclusions shall set forth and demonstrate the manner in which the council's decision is consistent with, carries out, and helps implement applicable state laws, the regulations, the policies, objectives, and goals of the comprehensive plan, and Ordinance 17287. The council may adopt as its own all or portions of the hearing examiner's findings and conclusions. b. Any ordinance also may contain reasonable conditions, in accordance with state law and county ordinances, which must be satisfied before the ordinance becomes effective. The ordinance shall also designate the time period within which any such conditions must be satisfied. All authority pursuant to such ordinance shall expire if any of the conditions are not satisfied within the designated time period and the property shall continue to be subject to all laws, regulations, and zoning as if the ordinance had not been adopted. The council may extend the period for satisfaction of the conditions if, after a public hearing by the examiner, the council finds an extension will be in the public interest and the extension was requested by the applicant within the initial time period.N. If the hearing examiner's recommendation is not appealed pursuant to subsection M. of this section: 1. The clerk of the council shall place a proposed ordinance that implements the examiner's recommended action on the agenda of the next available council meeting for adoption; 2. No final action to amend or reverse the hearing examiner's recommendation shall be taken at that meeting and notice to parties shall be given before the adoption of a substitute or amended ordinance that amends or reverses the examiner's recommendation; 3. The council may either: a. Refer the matter to the transportation, economy and environment or its successor for further consideration deemed necessary before the council takes final action on the matter or remand the matter to the hearing examiner for further hearing to receive additional information or further consideration; or b. Adopt the hearing examiner's recommendation by an ordinance satisfying the requirements of subsection M.9. of this section. 4. Any final action by the county council may be reconsidered by the council pursuant to K.C.C. 20.22.280; and 5. Any appeal of the council's final action shall comply with the requirements of K.C.C 20.22.270.A.O.1. The design and operating conditions specified in any agreement adopted and executed pursuant to the process established in this section shall prospectively control the operations and design for the site and supersede the design and operating conditions established under Conditional Use Permit File Nos. A-71-0-81 and L08CU006. However, any such development and operating agreement will not have retroactive effect. Any enforcement actions relating to compliance with the design and operating conditions established under Conditional Use Permit File Nos. A-71-0-81 and L08CU006 regarding activities that occurred before the execution of a development agreement shall not be affected. 2. A master plan development and operating agreement approved by the council shall be in effect for a period of ten years from the effective date of the ordinance approving the master plan development and operating agreement and authorizing the executive to execute the development and operating agreement; 3.a. An approved master plan development and operating agreement may be renewed one time for not more than ten years. b. The applicant shall apply to the department for renewal of the development and operating agreement at least twelve months before the agreement expires. The department shall provide a notice of the renewal request under subsection K.5.a. through c. of this section and shall conduct at least one public meeting on the request as provided in subsection K.7. of this section. c. The department shall make its recommendation to the council on the proposed renewal together with any recommended changes to the agreement not later than ninety days before the development and operating agreement expires. d. If the agreement is not renewed by the council: (1) the operating conditions established in the agreement shall remain in effect; and (2) any subsequent development permit application shall be subject to laws in effect at the time the subsequent application is filed.P. During the period a development and operating agreement is in effect, any subsequent development on the site shall be consistent with the approved development and operating agreement.Q.1. Except as otherwise provided in subsection Q.2. of this section, the laws in effect on the date the council adopts the ordinance authorizing the execution of the development and operating agreement shall apply to subsequent permits necessary for the uses authorized by the development and operating agreement. 2. The following regulations in effect on the date of a complete application for any permits necessary for a use authorized by the development and operating agreement shall apply: a. surface water management standards under K.C.C. Title 9; b. public health and safety codes under K.C.C. Title 13; c. road standards under K.C.C. Title 14; c. building codes under K.C.C. Title 16; and d. fire codes under K.C.C. Title 17.R. During the effective period of the development and operating agreement, the applicant may request in writing and the department may propose a modification of the development and operating agreement. The applicant's request and the department-initiated proposal shall be made by June 1 of each year for implementation in the following year. The department shall provide notice of the request or proposed modification as provided in subsection K.5.a. through c. of this section. The department shall submit to the hearing examiner its recommendation on the request not later than August 1.S. The hearing examiner shall conduct the following annual monitoring and reporting activities for the council: 1. No later than October 15 of each year, the hearing examiner shall conduct a public meeting in the vicinity of the project site for the purpose of gathering community input on the operation of facility during the preceding year and on any modifications to the development and operating agreement. The department shall provide a notice of the meeting as provided in subsection K.5.a. through c. of this section.2. Beginning on December 31 of the year after the effective date of the ordinance authorizing the execution of the development and operating agreement, and for each subsequent year, the hearing examiner shall prepare and submit to the council a report that: a. describes the current status of the phases of the development; b. evaluates compliance with development and operation agreement conditions during the preceding year; c. identifies issues and concerns that have been brought forward by the community, Pacific Raceways, and the department; d. evaluates proposed modifications to the development and operating agreement; and e. outlines potential steps to ensure compliance with the development and operating agreement. 3. The report shall be presented in a briefing by the hearing examiner to the transportation, economy, and environment committee, or its applicable successor, at which the department and project operator shall be present.T. The director shall submit a report on the master planning demonstration project to the council within sixty days of the council's adoption of the ordinance approving the development and operating agreement. The report shall evaluate the efficacy of the master planning process and may include recommended changes to the master planning process to address problems or deficiencies in the process identified by the department. The department shall solicit comments from the applicant, the hearing examiner, and the public, identified in subsection K.5.a. through c. of this section, on the master planning process and include a synopsis of those comments in the report. The report shall be filed electronically with the clerk of the council, who shall retain an electronic copy and provide an electronic copy to each councilmember.U.1 Before the application for a master planning proposal application, the applicant shall be permitted to undertake the following activities, subject to an interim use permit: a. construct up to four hundred thousand square feet of buildings, including required excavation and processing of materials, for uses allowed for a regional motor sports facility as set forth in K.C.C. 21A.06.973.C., and associated required site improvements; b. add paved impervious surface area, including, but not limited to, parking, a new vehicular access point to SE 304th Street, and internal access roads, with total impervious surface area not to exceed thirty-three and one-third percent of the site that is subject to the property-specific development condition known as P-suffix SC-P02; and c. add grandstands to accommodate up to twenty-five thousand persons, and replace existing grandstand seating. 2. Excavation and processing of materials under an interim use permit shall be subject to the following limits: a. The amount of materials shall be only as is necessary to undertake the activities allowed by subsection U.1. of this section, subject to review by the department; b. The on-site processing of the extracted materials shall be limited to the sorting of the materials into separate dirt, sand and gravel components, and crushing and washing of those components that will be used for on-site construction and required site improvements; and c. The on-site processing shall be limited to 9:00 a.m. to 5:00 p.m. Monday through Friday.V. A preapplication meeting shall be required for the interim use permit. The applicant shall submit the following information to the department with a request to schedule a preapplication meeting: 1. Affidavit of application, on a form approved by the department; 2. Project narrative and questions for department staff; 3. Preliminary site plan, which shall include: a. location of the property, with a vicinity map showing cross street; b. address, if an address has been assigned; c. parcel number or numbers; d. zoning of parcel or parcels and adjacent parcel or parcels; e. north arrow and scaled dimensions; f. existing and proposed building footprints, with overhangs and projections; g. existing and proposed grade contours; h. site area in square feet or acres of the project site; i. area of either disturbance or development, or both, including utilities, septic and internal circulation, as needed; j. existing and proposed easements, including ingress, egress, utilities, or drainage; and k. critical areas and their buffers; and 4. Preliminary building plan.W. An interim use permit application shall be considered complete when the following information and studies have been submitted and are adequate to review the proposal: 1. A proposed site plan that identifies the location and dimensions of the proposed buildings, structures, and paving, vehicular circulation and parking areas, critical areas and buffers, landscaping, stormwater facilities, utilities, and fire protection; 2. A proposed drainage plan under the surface water design manual for the improvements proposed under the interim use permit; 3. A proposed grading plan that complies with the submittal, operating and performance requirements in K.C.C. chapter 16.82; 4. A proposed restoration plan that complies with this section; 5. A deposit as required by K.C.C. 27.02.210 for review of the interim use permit; and 6. Any necessary information identified through the preapplication process.X. The interim use permit shall contain development conditions related to the grading activities and buildings and shall include, but not be limited to: 1. An approved site plan and conditions that establish: a. location, size, and proposed uses of the buildings; b. location and dimensions of vehicular circulation and parking, including required parking for the existing uses; c. location of stormwater facilities, sewage treatment facilities, water, and related features; d. landscaping requirements, as required by K.C.C. chapter 21A.16; e. location of on-site critical areas. Development or operations are not allowed within critical areas or their buffers, and alterations of critical areas or their buffers are not permitted, as part of the activities allowed with the interim use permit or related construction permits; and f. necessary on-site and off-site traffic control for construction impacts on vehicular circulation and on roadways in the vicinity of the project site; 2. An approved grading plan in compliance with the requirements of K.C.C. chapter 16.82; 3. A preliminary drainage plan in compliance with the surface water design manual; and 4. A restoration plan in compliance with the following requirements: a. Final grades shall generally conform to standards in K.C.C. 16.82.100 and the following: (1) be such so as to encourage the uses permitted within the primarily surrounding zone or, if applicable, the underlying or potential zone classification; and (2) result in drainage patterns that reestablish natural conditions of aquifer recharge, water velocity, volume, and turbidity within six months of restoration and that precludes water from collecting or becoming stagnant. Suitable drainage systems approved by the department shall be constructed or installed where natural drainage conditions are not possible or where necessary to control erosion. All constructed drainage systems shall be designed consistent with the Surface Water Design Manual; and b. All areas subject to clearing, grading or backfilling shall: (1) be planted with a variety of trees, shrubs, legumes and grasses indigenous to the surrounding area and appropriate for the soil, moisture, and exposure conditions; and (2) except for roads and areas incorporated into drainage facilities, be surfaced with soil of a quality at least equal to the topsoil of the land areas immediately surrounding, and to a depth of the topsoil of land area immediately surrounding six inches, whichever is greater.Y. For the interim use permit, the executive shall appoint a special project manager. 1. The special project manager shall either be an employee of, or hired as a consultant by, the regional planning unit of the office of performance, strategy, and budget. 2. The Pacific Raceways property has been designated as a project of statewide significance under chapter 43.157 RCW. 3. The special project manager will coordinate the reviews with the department and other agencies, be the primary point of contact for the applicant and interested parties, and ensure that the timelines established for review of the interim use permit in this section are met. 4. The special project manager shall evaluate, and provide a recommendation to the executive, regarding the efficacy of options, such as review by another jurisdiction or using outside staff to complete the substantive review, for expediting the permit review process. As part of this review, the special project manager shall ensure that any recommended option will produce a review that complies with this chapter and other applicable laws, regulations, and adopted policies.Z.1. In reviewing the interim use permit, the department shall: a. process the interim use permit as a Type 3 land use permit, except as provided in subsection DD. of this section. K.C.C. chapter 20.20 shall apply, except as modified by this section; b. conduct a mandatory preapplication meeting within fourteen days of the applicant's request for a preapplication meeting; c. within twenty one days of the preapplication meeting, provide a detailed listing of the required information or studies required for review of the interim permit, in conformance with this section, the other building, construction and environmental permits that will be required, and an estimate of cost for review of the interim use permit; d. accept the interim use permit application if the applicant provides the information and studies required by the detailed listing provided in subsection Z.1.c. of this section; e. determine whether the interim use permit application is complete within seven days of filing by the applicant, pursuant to K.C.C. 20.20.050, and subject to the application requirements in subsection W. of this section; f. provide a notice of complete application under K.C.C. 20.20.050, within seven days of determining that the application is complete; g. provide a notice of application under K.C.C. 20.20.060 within fourteen days of providing the notice of complete application. In addition to the notice required by these two sections, the department shall provide mailed notice to: (1) all parties of record, including community groups or organizations, established during the review of Conditional Use Permit File Nos. A-71-0-81 and L08CU006, Proposed Ordinance 2010-0189**, or Ordinance 17287; (2) persons requesting notification of any county land use action regarding Pacific Raceways; and (3) residents or property owners of parcels located within twenty-five hundred feet of the boundaries of the Pacific Raceways site; h. complete environmental review on the interim use and activities authorized by the interim use permit; i. transmit to the hearing examiner the department's recommendation on the interim use permit and provide notice of the recommendation under K.C.C. 20.20.090. The recommendation shall be based on the conformance of the proposal with the requirements of this section; and: (1) for a determination of nonsignificance or mitigated determination of nonsignificance, transmit the recommendation within forty-five days of the end of the comment period on threshold determination; (2) for a determination of significance, transmit the recommendation within forty five days of the end of the appeal period for the final environmental impact statement; and j. coordinate and assemble the reviews of other departments and governmental agencies having an interest in the application and shall prepare a report summarizing the factors involved and the department's recommendation. At least seven calendar days before the scheduled hearing, the department shall file the report with the hearing examiner and mail copies to those identified in subsection Z.1.g. of this section. 2. The exceptions to permit review timelines descried in K.C.C. 20.20.100.C. shall apply to the review period deadlines outlined in subsection Z. of this section. If the department is unable to meet the time limits established by this section, it shall provide written notice of this fact to the applicant. The notice shall include a statement of reasons why the time limits have not been met and an estimated date for issuance of the notice of recommendation to the hearing examiner. In no case shall the review of the interim use permit, from the date a complete application is filed through the date the department issues the recommendation to the hearing examiner, excluding the timeframes outlined in K.C.C. 20.20.100.C., exceed one hundred twenty days, unless the parties agree to an extension.AA.1. The hearing examiner shall: a. within fourteen days of receiving the department’s recommendation on the interim use permit, set the date for the prehearing conference and notify the interested parties. b. within seven days of the prehearing conference, issue a prehearing order that includes a tentative schedule and order of proceedings for the hearing required under this subsection. c. conduct an open record public hearing within thirty days of the prehearing conference. d. within ten days of the public hearing, issue a decision on the interim use permit. The examiner's determination may be to grant or deny the application, and may include any conditions, modifications, and restrictions as the examiner finds necessary to carry out the provisions of this section. The examiner's decision may be appealed to the council according to K.C.C. 20.22.220. 2. When reasonably required to enable the attendance of all necessary parties at the hearing, or the production of evidence or to otherwise assure that due process is afforded and the objectives of this chapter are met, the periods in subsection AA.1. of this section may be extended by the examiner at the examiner’s discretion for an additional thirty days. With the consent of all parties, the periods may be extended indefinitely. The reason for the deferral shall be stated in the examiner's decision. Failure to complete the hearing process within the stated time shall not terminate the jurisdiction of the examiner.BB. Issuance of the interim use permit by the county under this section does not relieve the applicant of its obligations to obtain other approvals required under state and federal . The applicant shall pay fees to the county to cover the actual cost of providing project management, review, and inspection services for the interim use permits and including environmental review, in accordance with K.C.C. 27.02.100.DD. Upon issuance of an interim use permit, the department may review and approve, in accordance with the code compliance process in K.C.C. chapter 21A.42, an expansion of, modification to, or addition to the development authorized by the interim use permit. If the proposed development, taken together with any previously approved development under the interim use permit, is within the limitations of subsection U.1. of this section, the development proposal shall be processed as a Type 1 land use decision, subject to all other applicable state and local standards.EE. Establishment of the use or activity authorized by an interim use permit shall occur within ten years of the effective date of the decision for the interim use permit or subsequent amendment to the interim use permit under subsection DD. of this section. Upon written request to the department made by the applicant before the expiration of an interim use permit or subsequent amendment, the department shall extend the permit for one or more one-year period, up to a total of five consecutive years, if site conditions have not significantly changed in a manner that would have affected the original permit approval and the applicant pays applicable permit extension fees. (Ord. 19691 § 3, 2023: Ord. 18683 § 59, 2018: Ord. 18230 § 139, 2016: Ord. 18184 § 2, 2015: Ord. 17287 § 3, 2012).Reviser’s notes:*Available in the King County Archives.**Proposed Ordinance 2010-0189 lapsed and failed to become law.21A.55.110 Remote tasting room – demonstration project A.A. The purpose of the remote tasting room demonstration project A is to: 1. Support agriculture and synergistic development of mixed use adult beverage facilities in order to boost agritourism and the area's reputation as food and adult-beverage destination; 2. Enable the county to evaluate how expanded adult beverage-based uses can be permitted while maintaining the core functions and purposes of the Rural Area and Agricultural zones; 3. Determine the benefits and evaluate strategies to mitigate impacts of the adult beverage industry on Rural Area and Agricultural zoned areas, including the impacts and benefits of the industry on Agricultural Production Districts, and including those properties where the demonstration project sites are located and the surrounding areas; 4. Provide an opportunity for additional exposure for locally sourced and produced agricultural products; and 5. Identify and evaluate potential changes to countywide land use regulations to support the development of additional areas of unincorporated King County that may benefit from growth in agritourism.B. The demonstration project shall only be implemented on the sites identified in Attachment A to Ordinance 19030*.C. The use that the permitting division may approve under the remote tasting room demonstration project A shall include only "remote tasting room" as defined in K.C.C. 21A.06.996.D.1. An application for a remote tasting room under this section may be submitted in conjunction with an application for an adult beverage business license or a building permit. 2. Requests shall be submitted to the permitting division in writing, together with any supporting documentation and must illustrate how the proposal meets the criteria in subsection F. of this section. 3. An application for a remote tasting room under this section shall be reviewed as a Type I land use decision in accordance with K.C.C. 20.20.020.E. The department of local services, permitting division, shall administer the demonstration project, and shall approve or deny a remote tasting room application under this section based upon compliance with subsection F. of this section. Approval or denial of a remote tasting room application shall not be construed as applying to any other development application either within the demonstration project area or elsewhere in the county.F.1. A remote tasting room under this section may be approved, subject to the following: a. One or more winery, brewery, distillery facility I, II or III may operate within one remote tasting room; b. The aggregated total space devoted to remote tasting room activities shall be limited to one thousand square feet of gross floor area, not including areas devoted to storage, restrooms, and similar nonpublic areas; c. Notwithstanding subsection F.1.b. of this section, an additional five hundred square feet of immediately adjacent outdoor space may be used for tasting, subject to applicable state regulations limiting sale, service and consumption of alcoholic beverages; d. Incidental retail sales of products and merchandise related to the products being tasted is allowed; e. The hours of operation for the tasting room shall be limited as follows: Mondays, Tuesdays, Wednesdays and Thursdays, tasting room hours shall be limited to 11:00 a.m. through 7:00 p.m.; and Fridays, Saturdays and Sundays, tasting room hours shall be limited to 11:00 a.m. through 9:00 p.m.; f. The applicant and any additional business operators using the remote tasting room shall obtain an adult beverage business license in accordance with K.C.C. chapter 6.74; g. Each remote tasting room business operator using the remote tasting room shall have proof of Washington state Liquor and Cannabis Board approval; h. Special events shall not exceed two per year regardless as to the number of operators using the tasting room, and shall be limited to no more than fifty guests. As long as the special events comply with this section, a temporary use permit is not required; i. Off-street parking shall be provided in accordance with the parking ratios for remote tasting room uses in K.C.C. 21A.18.030. Off-Street parking is limited to a maximum of one space per fifty square feet of tasting and retail areas; and j. The use shall be consistent with general health, safety and public welfare standards, and shall not violate state or federal law. 2. This section supersedes other variance, modification or waiver criteria of K.C.C. Title 21A. 3. Remote tasting room uses approved in accordance with this section may continue as long as an underlying business license or renewal is maintained, and subject to the nonconformance provisions of K.C.C. chapter 21A.32.G. Demonstration project applications shall be accepted by the permitting division for three years from December 31, 2019. Complete applications submitted before the end of the three years shall be reviewed and decided on by the permitting division.H. Starting one year after December 31, 2019, and each year for four years thereafter, the executive shall prepare preliminary evaluations of remote tasting room demonstration project A. The executive shall post these preliminary evaluation reports to the department of local services, permitting division, website, and provide electronic notice of the posting to the clerk of the council, who shall retain the original email and provide an electronic copy to all councilmembers, the council chief of staff and the lead staff for the local services, regional roads and bridges committee or its successor. These preliminary evaluation reports shall include: 1. A list of remote tasting room demonstration project applications submitted, reviewed and decided, including the date of original submittal, date of complete application and date and type of final decision whether approved or denied; and 2. A list of code compliance complaints under Title 23, if any, related to the applications received and approved or the demonstration project that were opened or initiated in the prior year, and their current status.I.1. Within ninety days of five years after December 31, 2019, the permitting division shall prepare a draft final evaluation and proposed permanent code changes that includes the information compiled under subsection H. of this section, and an evaluation of whether the purposes under subsection A. of this section have been fulfilled by the demonstration project. 2. The draft final report required in subsection J. of this section and proposed permanent code changes shall be done in conjunction with the efficacy evaluation and proposed code changes required by Ordinance 19030, Section 32.J. The permitting division shall include a public comment period for the permitting division's draft final evaluation described in subsection I. of this section. The public comment period shall last at least forty-five days beginning with the date of publication in the newspapers of record for the demonstration project areas identified in Attachment A to Ordinance 19030*. As part of the public comment period, the permitting division shall: 1. Publish notice of the draft final evaluation's availability in each newspaper of record, including locations where the draft final evaluation is available; 2. Send notice and request for comment to the water districts for the demonstration project areas identified in Attachment A to Ordinance 19030*; 3. Request comments from any developer that has applied for approval under the demonstration project; 4. Provide a copy at the local libraries for the demonstration project areas identified in Attachment A to Ordinance 19030*; 5. Post an electronic copy on the permitting division's website; and 6. Send electronic notice to the clerk of the council, who shall retain the original email and provide an electronic copy to all councilmembers, the council chief of staff and the lead staff for the local services, regional roads and bridges committee, or its successor.K. After the public comment period has ended, the permitting division shall prepare a final evaluation of the remote tasting room demonstration project A, incorporating or responding to the comments received. Within sixty days of the end of the public comment period, the executive shall file a final evaluation report, a motion that should accept the report, and an ordinance that implements any proposed permanent code changes.L. The final report and proposed legislation shall be filed in the form of a paper original and an electronic copy with the clerk of the council, who shall retain the original and provide an electronic copy to all councilmembers, the council chief of staff and the lead staff for the local services, regional roads and bridges committee, or its successor. (Ord. 19030 § 29, 2019).21A.55.125 Alternative housing demonstration project.A.1. The purpose of the alternative housing demonstration project is to: a. encourage private market development of housing options that are affordable to different segments of the county's population by testing removal of certain regulatory barriers to developing such housing; b. compare at least two alternative housing options and their accessibility for populations who are otherwise unable to find suitable housing, such as lower-income one-person households, low-income seniors, people with disabilities, veterans and persons experiencing homeless; c. evaluate the public benefit of providing housing options with smaller living spaces and shared facilities; and d. implement Phase I of King County Comprehensive Plan Workplan Action 6, as adopted in Ordinance 18427, and as amended by Ordinances 18427 and 18810. 2. The expected benefits from the alternative housing demonstration project include: a. the use of innovative design and development techniques to promote alternative housing options; b. the development of new affordable housing built to modern building standards; and c. the opportunity to identify and evaluate potential substantive changes to land use and development regulations that support the development of affordable housing while maintaining community character.B. For purposes of this section: 1. "Congregate residence" means one or more buildings that contain either sleeping units or dwelling units, or both, and where residents share either sanitation facilities or kitchen facilities, or both. 2. "Sleeping unit" means a room or space in which people sleep, and can also include permanent provisions for living, eating, and either sanitation or kitchen facilities but not both. Such rooms and spaces that are also part of a dwelling unit are not sleeping units.C. The alternative housing demonstration project shall be implemented in North Highline as described in Attachment A to Ordinance 19119* and in the Vashon Rural Town as described in Attachment B to Ordinance 19119*.D. Applications shall demonstrate how the proposed project, when considered as a whole with the proposed modifications or waivers to the code, will meet the criteria in this section and, as compared to development without the modification or waiver, the degree to which the project will: a. increase the range of affordable housing options, including providing housing types that meet the needs of the local community; b. provide housing options for low- to moderate-income households; c. provide for the development of lower rent housing options through construction of buildings with shared facilities; d. seek to prevent displacement of the local community's residents; e. for projects with public funding, meet or exceed the sustainable development standards adopted by Washington state Department of Commerce under RCW 39.35D.080; f. for projects without public funding, meet or exceed Master Builders Association of King and Snohomish Counties 4-star Built Green standard; and g. provide attractive and well-designed development.E. The following apply to a demonstration project development proposal under this section and supersede development regulations under this title that are in conflict: 1. A demonstration project development proposal for a congregate residence in North Highline identified in Attachment A to Ordinance 19119*, is a permitted use under K.C.C. 21A.08.030 and the maximum residential density provisions and the base height provisions of K.C.C. 21A.12.030 and 21A.12.040 do not apply if: a. the proposal is for no more than a combined total of sixty dwelling units and sleeping units; b. each sleeping unit or dwelling unit contains no more than two hundred twenty square feet of floor area; and c. the proposed development does not exceed sixty feet in height. 2. A demonstration project development proposal for a congregate residence, in Vashon Rural Town as identified in Attachment B to Ordinance 19119* is a permitted use under K.C.C. 21A.08.030 and the maximum residential density provisions of K.C.C. 21A.12.030 do not apply if: a. the development proposal is for no more than five buildings with each building containing no more than a combined total of eight dwelling units and sleeping units; and b. except for accessibility units designed to house persons with physical disabilities, sleeping units and dwelling units shall not contain more than three hundred fifty square feet of floor area. Sleeping units and dwelling units designed as accessible for persons with physical disabilities shall contain no more than three hundred eight five feet of net floor area.F. A congregate residence under this section shall meet the following standards: 1. A congregate residence shall include at least one common kitchen facility. In a congregate residence with more than two floors, at least one common kitchen facility is required on each floor with sleeping units. In a congregate residence consisting of more than one building, at least one common kitchen facility is required in each building. 2. A sleeping unit that does not include sanitation facilities in the sleeping unit shall have access to shared sanitation facilities on the same floor as the sleeping unit. 3. Communal areas, such as common kitchen facilities, lounges, recreation rooms, dining rooms, living rooms, laundry rooms, foyers and lobbies, shall be open to all residents of the congregate residence and shall meet the following standards: a. The total floor area of communal areas shall be at least twelve percent of the total floor area of all sleeping and dwelling units; and b. Service areas, including, but not limited to hallways and corridors, supply or janitorial storage areas, operations and maintenance areas, staff areas and offices may not be counted toward the communal area total floor area requirement.G.1. An application for a development permit or building permit under this section shall include a proposed agreement with the department of local services, permitting division, that addresses at least the following to be undertaken by the applicant: a. measures to ensure that rents remain affordable, such as rent and income restrictions or the inherent affordability of smaller units; b. measures to reduce displacement of the local community's residents, such as affirmative marketing or maintaining wait lists; c. measures to ensure that residents have available transportation choices to enable them reasonable access to retail and services, such as the Metro transit department Access paratransit services, community service vans, bike storage rooms or carshare services; d. for projects in the Vashon Rural Town, services that will be available to residents of the project, such as case management for vulnerable populations or social connectivity programming; e. measures to incorporate housing needs of the local community into the proposed development; f. measures to involve the local community in the proposed development; and g. what information the applicant will collect and when and how it will be reported to the department of local services, permitting division, and the department of community and human services to assist in evaluation of the demonstration project. 2. The department shall not approve a development permit or building permit application under this section until the proposed agreement under this subsection has been approved by the department of local services, permitting division.H.1. A modification or waiver approved by the department of local services, permitting division, in accordance with this section shall be in addition to those modifications or waivers that are currently allowed by this title, K.C.C. Title 9, K.C.C. Title 14 and K.C.C. Title 16. 2. An applicant under this section, in conjunction with an application for a site development permit or a building permit, may request in writing a modification or waiver of the development regulations under the following chapters and titles. Proposals to modify or waive development regulations for a development application must be consistent with general health, safety and public welfare standards and must not violate state or federal law: a. drainage review requirements: K.C.C. chapter 9.04 and the Surface Water Design Manual; b. King County road standards: K.C.C. chapter 14.42 and the county road standards, 2016 update; c. King County building code: K.C.C. Title 16; d. permitted uses: K.C.C. chapter 21A.08; e. density and dimensions: K.C.C. chapter 21A.12; f. design requirements: K.C.C. chapter 21A.14; g. landscaping and water use: K.C.C. chapter 21A.16; h. parking and circulation: K.C.C. chapter 21A.18; and i. school impact fees: K.C.C. chapter 21A.43. 3. Requests for a waiver or modification made in accordance with this section shall be submitted to the department of local services, permitting division, in writing before or in conjunction with a development permit or building permit application together with any supporting documentation. The supporting documentation must illustrate how the proposed modification meets the criteria in this section. 4. The notice of application, review and approval of a proposed modification or waiver under this section shall be treated as a Type 2 land use decision in accordance with K.C.C. 20.20.020. Approval or denial of the proposed modification or waiver shall not be construed as applying to any other development application either within a demonstration project area or elsewhere in the county. 5. A preapplication conference with the applicant and the department of local services, permitting division, to determine the need for and the likely scope of a proposed modification or waiver is required before submittal of such a request. If a modification or waiver requires approval of the department of natural resources and parks or the department of local services, roads services division, that department or division shall be invited to participate in the preapplication conference. 6. If the applicant requests an adjustment from the county drainage standards, the director shall refer the request to the department of natural resources and parks for decision under K.C.C. chapter 9.04, with the right to appeal within the department of natural resources and parks as provided in K.C.C. 9.04.050.C.6. The department of natural resources and parks shall consider the purposes of this demonstration project as a factor relative to the public interest requirement for drainage adjustments described in K.C.C. 9.04.050.C. 7. If the applicant requests a variance from the county road standards, the director shall refer the request to the county road engineer for decision under K.C.C. 14.42.060, with the right to appeal to the department of local services, road services division, as provided in K.C.C. 14.42.060 and the associated public rules. The department of local services, road services division, shall consider the purposes of this demonstration project as a factor relative to the public interest requirement for road variances described in K.C.C. 14.42.060. 8. Administrative appeals of modifications or waivers approved by the director shall be combined with any appeal of the underlying permit decision.I. An approved development permit or a building permit under this section, including site plan elements or conditions of approval, may be amended or modified at the request of the applicant or the applicant's successor in interest designated by the applicant in writing. The director may administratively approve minor modifications to an approved permit. Modifications that result in major changes as determined by the department of local services, permitting division, or as defined by the approval conditions shall be treated as a new application for purposes of vesting and shall be reviewed as applicable to the underlying application in accordance with K.C.C. 20.20.020. Any increase in the total number of sleeping units and dwelling units above the maximum number set forth in the development permit or building permit approval shall be deemed a major modification. The county, through the applicable development permit or building permit approval conditions, may specify additional criteria for determining whether proposed modifications are major or minor. The modifications allowed under this section supersede other modification or revision provisions of K.C.C. Title 16 and this title.J. Demonstration project applications shall be accepted by the department of local services, permitting division, for four years from July 19, 2020. Complete applications submitted before the end of the four years, shall be reviewed and decided on by the department of local services, permitting division.K.1. The executive shall file the following reports in the form of a paper original and an electronic copy with the clerk of the council, who shall retain the original and provide an electronic copy to all councilmembers, the council chief of staff, the lead staff to the local services, committee or its successor and the lead staff to the community health and housing services committee or its successor: a. A preliminary report within two years of the final certificate of occupancy for the first project completed under the demonstration project that describes and evaluates the pertinent preliminary results; and b. A final report within two years of the final certificate of occupancy for the second project completed under the demonstration project that describes and evaluates the pertinent results and recommends changes, if appropriate based on evaluation, that should be made to the county processes and development regulations. 2. If only insufficient or inconclusive data are available when the report required under subsection K.1. of this section is due, the executive must file in the form of a paper original and an electronic copy with the clerk of the council, who shall retain the original and provide an electronic copy to all councilmembers, the council chief of staff, the lead staff to the local services committee or its successor and the lead staff to the community health and housing services committee or its successor a report on the demonstration projects that indicates the date a subsequent report or reports will be transmitted to fully evaluate outcomes of the demonstration project sites and recommend changes, if appropriate, based on the evaluation, that should be made to the county processes and development regulations. (Ord. 19119 § 2, 2020).*Available in the King County Archives.21A.60URBAN DESIGN STANDARDS - NORTH HIGHLINESections:21A.60.010North Highline urban design standards - established - intent.21A.60.020Application of chapter - exemption - conflict with other provisions of title.21A.60.030Preapplication conference - community meeting - preapplication review timing - additional requirements for complete permit application - department review and decision.21A.60.040Classification of street type for street frontage - multiple street frontages - allowed frontage types.21A.60.050Parking access - midblock connection - developments on corner lots - service areas.21A.60.060GreenCenter requirements.21A.60.070Lighting.21A.60.080Modulation of facades - accompanying architectural measures - approval of changes - balconies that are part of modulation - designs that are easily identified with particular chain or corporation prohibited - chain or corporation signs.21A.60.090Scale- comparison with existing historic building stock of White center unincorporated activity center required - breaking up scale in larger buildings - new signs.21A.60.100Waiver or modification of application of standards - standards, procedure.21A.60.110Waiver or modification of application of standards - standards, procedure.21A.60.010 North Highline urban design standards - established - intent.A. The North Highline urban design standards are hereby established. The purpose of the North Highline urban design standards is to implement the vision of North Highline for its future as described in the North Highline community service area subarea plan and the intent in subsection B. of this section.B. The intent of the North Highline urban design standards relating to site design, building design, urban form, and neighborhood character include: 1. Development is based on an understanding of the physical and cultural context of the neighborhood and the North Highline community service area subarea; 2. Development prioritizes compatibility with the existing scale of the neighborhood, walkability, and generous landscaping; 3. Development results in a streetscape that is attractive and comfortable for moving through the neighborhood and spending time in it, reflects the character of the neighborhood, and supports neighborhood activities and businesses; 4. Development keeps the neighborhood’s diversity visible and promotes distinctive, unique designs through architectural features, signage, art, landscape, and amenities such as seating, lighting, and ornament; and 5. Stormwater and landscape design connect the urban environment to the natural systems with designs that are both functional and beautiful. (Ord. 19687 § 9, 2023).21A.60.020 Application of chapter - exemption - conflict with other provisions of title.A. This chapter only applies to the North Highline community service area subarea as follows: 1. All new or substantially improved development in the CB, NB, RB, O, R-12, R-18, R-24, and R-48 zones; and 2. Modification to any structure that affects its exterior appearance in the White Center unincorporated activity center land use designation, except for single detached dwelling units.B. New or substantially improved development with less than six dwelling units is exempt from this chapter. C. Where a conflict exists between this chapter and other provisions in this title, this chapter applies. (Ord. 19687 § 10, 2023).21A.60.030 Preapplication conference - community meeting - preapplication review timing - additional requirements for complete permit application - department review and decision.A. A preapplication conference, in accordance with K.C.C. 20.20.030, is required for all projects subject to the North Highline urban design standards. The applicant shall submit the following information to the department with a request to schedule a preapplication conference: 1. Questions for department staff; 2. A project narrative explaining how the preliminary design addresses the intent of the North Highline urban design standards in K.C.C. 21A.60.010, responds to the context analysis required in subsection A.3. of this section, and meets the design standard requirements in this chapter. The department shall provide a template for the project narrative; 3. A context analysis that documents an understanding of the urban form and neighborhood character of the project site. The context analysis shall include: a. discussion of neighborhood demographics; b. inventory of historic structures, local businesses, artwork, landmarks, and culturally significant elements, including a map of those features within five hundred feet of the site; c. analysis of the current uses within five hundred feet of the site, including building footprints, existing businesses, private and public lands, and any public facilities; d. location and dimensions of existing public rights-of-way, including streets, sidewalks, and parking areas; landscape features; and drainage elements; and e. identification of street type and frontage type as required by K.C.C. 21A.60.040. 4. A site plan, which shall include: a. location of the property, with a vicinity map showing cross street; b. address, if an address has been assigned; c. parcel number or numbers; d. zoning of parcel or parcels and adjacent parcel or parcels; e. north arrow and scaled dimensions; f. existing and proposed building footprints, with overhangs and projections; g. existing and proposed grade contours; h. site area in square feet or acres of the project site; i. area of either disturbance or development, or both, including utilities, septic, and internal circulation, as needed; j. existing and proposed easements, including ingress, egress, utilities, or drainage; and k. critical areas and their buffers; l. proposed locations for artwork and neighborhood expression; m. proposed pedestrian amenities and bicycle facilities; n. proposed barrier-free access; o. proposed parking quantity, location, and access point or points; p. proposed landscape concept; q. proposed stormwater design; r. proposed approach to managing waste and recycling; s. quantity, location, and quality of an on-site recreation area, or areas, if proposed; t. phasing, if proposed; and 5. A building plan, which shall include: a. architectural intent and proposed building design including elevations, fa?ade details, colors, and materials; and b. proposed building uses.B. After at least one preapplication conference, and before filing an application with the department, the applicant shall hold at least one community meeting in accordance with K.C.C. 20.20.035. In addition to the requirements of K.C.C. 20.20.035, the applicant shall: 1. Create a web-based community input survey to solicit feedback on the proposed development from the North Highline community for twenty-one days. The applicant shall notify via email a list of parties of interest and notify by mail residents within five hundred feet of the site at least one week before the beginning of the feedback period. The department shall establish a template for the web-based community input survey. The web-based community input survey shall: a. present the context analysis, preliminary site plan, and preliminary building plan required in subsection A. of this section for solicitation of community feedback; b. be capable of accepting community feedback within the webpage; and c. be accessible for those who are visually impaired and include translations to the top three non-English languages within North Highline as determined by the department; and 2. Provide a list of community meeting attendees and commenters on the community input survey and proof of those who received emailed and mailed notice to the department.C. Preapplication review shall remain open until the applicant has held the required community meeting and the twenty-one-day community input survey window is closed.D. As part of a complete permit application, the applicant shall provide, in addition to that which is required under K.C.C. 20.20.040, the following: 1. A memorandum of how the proposal incorporates community feedback. For feedback that was not incorporated into the project, the memorandum shall state why the input was not addressed. The memorandum shall include an appendix that contains all the community input received by the application; and 2. An updated project narrative demonstrating how the proposal addresses the intent of the North Highline urban design standards inK.C.C. 21A.60.010 and meets the design standards in this chapter.E. The department shall review the community feedback on the project's design, the project's alignment with the intent of the North Highline urban design standards in K.C.C. 21A.60.010, and the project's consistency with the design standards in this chapter. The department's design review decision shall be made as part of the final decision on the underlying development proposal. Where a modification to a structure requires design review under K.C.C. 21A.60.020.A.2. but no other permit is required, the department's design decision shall be a Type 1 land use decision. (Ord. 19687 § 11, 2023).21A.60.040 Classification of street type for street frontage - multiple street frontages - allowed frontage types.A. For each street frontage, the street type shall be classified based on the following order: 1. Arterial: streets with a classification of principal, minor, or collector arterial, excluding core street as described in subsection A.4. of this section; 2. Local mixed use: two-lane, nonarterial streets adjacent to CB, NB, RB, and O zones; 3. Local residential: nonarterial streets adjacent to R-12, R-18, R-24, and R-48 zones; and 4. Core street: both sides of 16th Avenue Southwest in the White Center unincorporated activity center from Southwest Roxbury Street at the north to Southwest 100th Street at the south.B. Where a building or site is located on multiple street frontages: 1. The portion of the building facing the higher-order street shall be designated the primary street frontage; and 2. The portion of the building facing the lower-order street or streets shall be designated the secondary street frontage.C. Based on the street type identified in subsection A. of this section, the following frontage types are allowed: 1.a. Main street building frontage: a main street building frontage, an example of which is shown in the figure in subsection C.1.b. of this section, is characterized by a well-articulated, pedestrian-oriented facade that abuts the sidewalk, multiple at-grade building entrances for businesses, and public features that support sidewalk activation. Main street building frontages have substantial glazing on the ground floor and provide weather protection for pedestrians on the sidewalk. b. Main street building frontage figure: c. Buildings with a main street building frontage are subject to the following:Allowed street typesCore street, local mixed use.Setback from property line0 feet, except as needed to accommodate required amenities.Weather protectionWeather protection at least 6 feet in depth shall be provided along 75% of the building facade facing a street or pedestrian pathway including building entrances.Weather protection may be in the form of awnings, marquees, canopies, or building overhangs.Building entrancesEntrances shall be at sidewalk grade, face the street, be provided every 75 feet, or less, and have a transparency of 40%.Windows70% minimum or 60% if ground floor windows are operable. Required window areas shall be transparent and allow views from the building to the street. Reflective, dark, tinted, or textured glass is not permitted.Surface parkingNot permitted adjacent to a primary or secondary street. d. New and substantially improved buildings that are the main street building frontage type shall provide at least one of the following amenities near the sidewalk for every fifty linear feet of street frontage: (1) seating space; (2) supplemental area lighting; (3) drinking fountain; (4) waste receptacle; (5) artwork or decorative landmark; (6) kiosk suitable for temporary community-oriented notices; (7) raised planter; (8) bike rack; or (9) other amenities appropriate to the space acceptable to the director; 2.a. Forecourt building frontage: a forecourt building frontage, an example of which is shown in the figure in subsection C.2.b. of this section, is characterized by a well-articulated, pedestrian-oriented fa?ade centered around a plaza or gathering space that includes a garden, outdoor seating, or other pedestrian amenities. A forecourt is created by recessing a portion of the facade for a portion of the building frontage. A forecourt building frontage is suitable for commercial or residential uses. b. Forecourt building frontage figure: c. Buildings with a forecourt building frontage are subject to the following:Allowed street typesArterial, local mixed use, local residential.Setback from property line0 feet.Weather ProtectionWeather protection at least 6 feet in depth shall be provided along 75% of the building facade facing a street or pedestrian pathway including building entrances. Weather protection over the forecourt area is encouraged, but not required.Weather protection may be in the form of awnings, marquees, canopies, or building overhangs.Building entrancesEntrances shall be provided every 75 feet, or less, and have a transparency of 40%. Entrances abutting a sidewalk must face the street and be at sidewalk grade.Windows60% minimum or 55% if ground floor windows are operable. Required window areas shall allow views from the building to the street. Reflective, dark, tinted, or textured glass is not permitted.Forecourt depth from property line10 feet minimum; 30 feet maximum.Forecourt width20 feet minimum; 50 feet maximum.FenceNo greater than 3 feet in height; minimum 20% transparent. d. New and substantially improved buildings that are the forecourt building frontage type shall provide at least two of the following amenities in the forecourt area: (1) seating space; (2) supplemental area lighting; (3) water feature or decorative drinking fountain; (4) waste receptacle; (5) artwork or decorative landmark; (6) kiosk suitable for temporary community-oriented notices; (7) raised planter; (8) bike rack; or (9) other item appropriate to the space acceptable to the director; 3.a. Plaza building frontage: The plaza building frontage, an example of which is shown in the figure in subsection C.3.b. of this section, is characterized by public space in the setback area between the building and the property line. The plaza area should support human activity with amenities such as seating, art, and wayfinding. A plaza building frontage is suitable for active ground floor uses such as retail, dining, or civic and cultural uses. b. Plaza building frontage figure: c. Buildings with a plaza building frontage are subject to the following:Allowed street typesArterial, core street, local mixed use, local residential.Setback from property line5 feet minimum; 25 feet maximum.Weather protectionWeather protection at least 6 feet in depth shall be provided along 75% of the building facade facing a street or pedestrian pathway including building entrances.Weather protection may be in the form of awnings, marquees, canopies, or building overhangs.Building entrances Entrances shall be at sidewalk grade, face the street, be provided every 75 feet, or less, and have a transparency of 40%.Windows70% minimum or 60% if ground floor windows are operable. Required window areas shall be transparent and allow views from the building to the street. Reflective, dark, tinted, or textured glass is not permitted. d. New and substantially improved buildings that are the plaza building frontage type shall provide at least two of the following amenities between the property line and the building for every fifty linear feet of street frontage: (1) seating space; (2) supplemental area lighting; (3) water feature or decorative drinking fountain; (4) waste receptacle; (5) artwork or decorative landmark; (6) kiosk suitable for temporary community-oriented notices; (7) raised planter; (8) bike rack; or (9) other item appropriate to the space acceptable to the director; 4.a. Porch-stoop-terrace building frontage: the porch-stoop-terrace building frontage, an example of which is shown in the figure in subsection C.4.b. of this section, is characterized by buildings that are set back from the street with a series of highly articulated individual entrances and semi-private landings such as porches, stoops, or terraces. Entrances may be elevated above grade. Landscaping is provided in the setback area between the building and the sidewalk. A porch-stoop-terrace building frontage is suitable for residential uses, service, or office uses. b. Porch-stoop-terrace building frontage figure: c. Buildings with a porch-stoop-terrace building frontage are subject to the following:Allowed street typesLocal mixed use, local residential.Setback from property line5 feet minimum; 15 feet maximum.Weather protectionBuilding entrances shall be either be covered by an awning or canopy or be covered by being recessed behind the front building facade.Building entrances Entrances abutting a sidewalk must face the street and be at sidewalk grade or no more than 5 feet above sidewalk grade; and have a transparency of 20%.Between 25 and 150 square feet of porch area shall be provided per building entrance.Windows30% minimum on ground floor. Required window areas shall allow views from the building to the street. Reflective, dark, tinted, or textured glass is not permitted.FenceNo greater than 3 feet in height; minimum 20% transparent. c. New and substantially improved buildings that are the porch-stoop-terrace building frontage type shall provide at least two of the following amenities between the property line and the building for every fifty linear feet of street frontage: (1) seating space; (2) supplemental area lighting; (3) water feature or decorative drinking fountain; (4) waste receptacle; (5) artwork or decorative landmark; (6) bike rack; or (7) type II or type III landscaping consistent with K.C.C. chapter 21A.16; or (8) other item appropriate to the space acceptable to the director; and 5.a. Landscape building frontage: a landscape building frontage, an example of which is shown in the figure in subsection C.5.b. of this section, is set back from the property line by a wide landscaped strip between the building and the sidewalk. This frontage type is appropriate along streets where the existing streetscape may not be conducive to pedestrian-oriented ground-floor retail or residential uses, such as where there is no on-street parking or where streets are very wide. Ground floor entries shall still be provided along and connected to the sidewalk. b. Landscape building frontage figure: c. Buildings with a landscape building frontage are subject to the following:Allowed street typesArterial, local mixed use, local residential.Setback from property line10 feet minimum; 20 feet maximum landscaped setback.Weather protectionBuilding entrances shall be either be covered by an awning or canopy or be covered by being recessed behind the front building facade.Building entrancesAt least one building entrance shall be directly connected to a public street with a walkway measuring a minimum of 5 feet wide. A minimum transparency of 40% is required for each primary entry.WindowsTransparent ground floor windows shall be provided along a minimum of 60% of the ground floor and facades facing public streets. Required window areas shall allow views from the building to the street. Reflective, dark, tinted, or textured glass is not permitted.Landscaping10 feet minimum; 20 feet maximum Type II or Type III landscaping consistent with K.C.C. chapter 21A.16. d. New and substantially improved buildings that are the landscape building frontage type shall provide at least two of the following amenities between the property line and the building for every fifty linear feet of street frontage: (1) seating space; (2) supplemental area lighting; (3) artwork or decorative landmark; (4) water feature or rain garden; or (5) other item appropriate to the space acceptable to the director. (Ord. 19687 § 12, 2023).21A.60.050 Parking access - midblock connection - developments on corner lots - service areas.A. Parking shall be accessed from alleys, where an alley exists. If there is no alley, parking entries shall prioritize pedestrians by limiting the maximum width to twenty feet for two-way driveways.B. Developments with over two hundred linear feet on a single street frontage or two hundred linear feet of total street frontage on properties that abut two parallel streets shall provide a midblock connection. The route may be through the building interior if the building is open to the public during business hours.C. Developments on corner lots shall either orient a building fa?ade toward the street corner within fifteen feet of the property line or provide pedestrian-oriented space at the corner leading directly to a building entrance or entrances.D. Service areas including loading docks, refuse containers, compactors, and mechanical equipment shall be located and screened to avoid negative visual, auditory, olfactory, or physical impacts on the property and adjacent street frontages. Service areas shall be located within buildings or screened with acceptable materials including brick, concrete block, stone, or wood. Chain-link fencing is not permitted as a screening material. (Ord. 19687 § 13, 2023).21A.60.060 GreenCenter requirements.A. Developments subject to the standards of this chapter are required to meet a minimum GreenCenter score of 0.3. If an applicant demonstrates to the director that the existing conditions of the site do not allow for a GreenCenter score of 0.3, the director may modify the requirement.B. The GreenCenter score shall be calculated as follows: 1. For each landscape element, multiply the square feet, or equivalent square footage where applicable, by the multiplier provided for that element in subsection C. of this section, according to the following provisions: a. If multiple elements listed in subsection C. of this section occupy the same area, such as groundcover under a tree, count the full square footage or equivalent square footage of each element; b. Landscaping elements in the right-of-way between the property line and the roadway may be counted, but only if they are approved by the manager of the road services division of the department of local services; c. Elements listed in subsection C. of this section that are provided to satisfy any other requirements of K.C.C. Title 21A may be counted; d. For vegetated walls, use the square footage of the portion of the wall covered by vegetation. All vegetated wall structures shall be constructed of durable materials, provide adequate planting areas for plant health, provide irrigation for the planting areas, and provide appropriate surfaces or structures that enable plant coverage; and e. For small shrubs, small plantings, and grass, square footage is determined by the area of the portion of a horizontal plane that lies under the element. 2. Add together all the products calculated under subsection B.1. of this section to determine the GreenCenter numerator; and 3. Divide the GreenCenter numerator by the parcel size to determine the GreenCenter score.C. GreenCenter landscape elements and categories:GreenCenter landscape elementsMultiplier1. Planted areasa. Planted areas with a soil depth of 24 inches or more0.6b. Bioretention facilities consistent with the bioretention design standards of the Surface Water Design Manual1.02. Small plantings and shrubsa. Groundcovers, grasses, or other plants less than 2 feet tall at maturity0.1b. Medium shrubs or other perennials at least 2 feet tall, but less than 4 feet tall, at maturity (area = number of plants x 9 square feet)0.3c. Large shrubs or other perennials at least 4 feet tall at maturity (area = number of plants x 36 square feet)0.33. Treesa. Trees with tree canopy spread of at least 10 feet, but less than 20 feet (area = number of trees x 75 square feet)0.3b. Trees with tree canopy spread of at least 20 feet, but less than 30 feet (area = number of trees x 250 square feet)0.5c. Trees with tree canopy spread of at least 30 feet (area = number of trees x 350 square feet)0.7d. Preservation of existing trees at least 6 inches in diameter measured 4.5 feet above the ground (area = 20 square feet x inch of tree diameter)1.04. Green roofsa. Planted over 2 inches to 4 inches of growth medium0.2b. Planted over 4 inches to 8 inches of growth medium0.3c. Planted over at least 8 inches of growth medium0.45. Vegetated walls (maximum 500 square feet)0.26. Bonusesa. Landscaping that consists entirely of drought-tolerant or native plant species0.1b. Landscaping visible from adjacent rights-of-way or public open space0.1c. Landscaping for food cultivation0.2d. Landscaping that receives at least 50 percent of annual irrigation needs through the use of harvested rainwater or collected greywater0.2e. Spaces that support sitting or small gatherings0.2f. Landscape requested by the community through the public outreach process0.2g. Landscape that incorporates an educational component, such as signage, displays, or interactive exhibits0.2(Ord. 19687 § 14, 2023).21A.60.070 Lighting.A. Lighting design shall promote public safety, encourage visibility throughout the entire site, consider a mature landscape, and minimize light spillover to adjacent properties and illumination of the night sky.B. All public areas shall be illuminated at the following levels: 1. Building entries shall have up to three foot-candles; 2. Sidewalks and walkways shall have between one-half foot-candle and one-and-one-half foot-candles; and 3. Parking areas shall have between one-quarter and three-quarters foot-candles.C. Lighting shall be provided at consistent levels. The lighting uniformity ratio shall not exceed ten-to-one as determined by the minimum lighting level in relation to the average lighting level in a specified area.D. All building lights shall be directed onto the building itself or the ground immediately adjoining the building. Illumination at the property line shall be a maximum of one foot-candle.E. Parking lot lighting fixtures shall be nonglare and mounted no more than fifteen feet above the ground.F. All lighting fixtures shall be fully shielded, where a solid barrier at the top of the fixture in which the bulb is located blocks all direct uplight. (Ord. 19687 § 15, 2023).21A.60.080 Modulation of facades - accompanying architectural measures - approval of changes - balconies that are part of modulation - designs that are easily identified with particular chain or corporation prohibited - chain or corporation signs.A. Fa?ades with street frontage on new and substantially improved buildings shall be modulated approximately every forty feet. Modulation shall have a depth between three and ten feet and shall be accompanied by at least three of the following architectural measures: 1. Change in window patterns at each modulation, such as window size, color, and shape; 2. Use of vertical piers or columns; 3. Change in roofline or roof style, such as stepped roofs, dormers, gables, or shed roofs, with a vertical modulation of at least twelve inches; 4. Change in color and building material or siding style at each modulation; 5. Vertical elements such as a vegetated wall or art. Vegetated walls shall count toward the GreenCenter score in K.C.C. 21A.60.060; and 6. Change in lighting fixtures at each modulation.B. The director may approve changes to the modulation intervals or other methods that provide architecturally scaled elements not specifically listed in subsection A. of this section. The proposed methods must satisfy the intent of the design standards in K.C.C. 21A.60.010.C. When balconies are part of the modulation and have a minimum depth of six feet and a minimum area of sixty feet, the minimum depth of modulation shall be two feet.D. The use of stock building plans, typical corporate or franchise designs, regional prototype alternatives, or other designs that are easily identified with a particular chain or corporation, are prohibited. Signs allowed in accordance with K.C.C. chapter 21A.20 may be permitted to use stock plans, except on core street types subject to K.C.,C. 21A.60.090. (Ord. 19687 § 16, 2023).21A.60.090 Scale- comparison with existing historic building stock of White center unincorporated activity center required - breaking up scale in larger buildings - new signs.A. New and substantially improved buildings along the core street type as defined in K.C.C. 21A.60.040 shall be in scale with the existing historic building stock of the White Center unincorporated activity center. Where the scale of the new or substantially improved building is larger, techniques such as variations in roof height, vertical columns to break up facades, changes in roof or parapet detail, use of smaller repeating window patterns, use of fascia on the facade, facade articulation, and stepping back or modulating of upper stories shall be used to break up the scale of the building to complement existing patterns.B. New signs for local businesses along the core street type are subject to the following: 1. The principal sign of any building or establishment shall be unique and custom-designed. Such signs may include logos, colors, or other brand-identifying elements, but the overall sign shall not be generic or identical to an existing sign within five hundred feet of the business; 2. Multi-lingual signage is encouraged; and 3. Flashing or moving images are prohibited. (Ord. 19687 § 17, 2023).21A.60.100 Waiver or modification of application of standards - standards, procedure.A. The director may waive or modify the application of the standards of this chapter, if, as determined by a notarized letter from a landlord, leasing agreement, affidavit of residency, real estate deed, tax return, or record of filing with the Washington Office of the Secretary of State, the business: 1. Has been located in North Highline for at least five years, excluding a franchise with headquarters outside of North Highline; 2. Is owned by a person who has lived in North Highline for at least five years, excluding a franchise with headquarters outside of North Highline; 3. Is a nonprofit organization that provides community and human services to residents of North Highline; or 4. Is located in a structure listed on the National Register of Historic Places as a historic site or designated as a state or King County landmark subject to K.C.C. chapter 21A.32.B. The director may waive or modify the application of the standards of this chapter if the development provides affordable dwelling units in accordance with K.C.C. chapter 21A.48 and the director determines that the waiver or modification would result in a development that better meets the intent of the design standards in K.C.C. 21A.60.010.C. The director may waive or modify the application of a design standard in this chapter to a development proposal if the director determines that waiver or modification would result in a development that better meets the intent of the design standards in K.C.C. 21A.60.010.D. A waiver or modification request shall be submitted in writing by the developer to the director. The request shall identify the proposed design standard requested to be waived or modified, the rationale for why the waiver or modification should be granted, and how the waiver or modification would result in a development that better meets the intent of the design standards in K.C.C. 21A.60.010. (Ord. 19687 § 18, 2023).21A.60.110 Rules. The director is authorized to promulgate and adopt administrative rules in accordance with K.C.C. chapter 2.98, to implement and enforce this chapter. (Ord. 19687 § 19, 2023). ................
................

In order to avoid copyright disputes, this page is only a partial summary.

Google Online Preview   Download