N Dr. David Brownstein’s atural a y to ealth

Dr. David Brownstein's

Natural Way to Health Achieving & Maintaining Your Optimal Health Special Issue Special Report:

A Doctor's Guide to a Healthy Prostate

The prostate gland is a small gland in men near the rectum, just below the bladder. The gland is not essential for life, but it is necessary for reproduction.

The gland secretes a slightly alkaline fluid that supports the sperm. It also prevents the flow of urine during ejaculation. It requires androgen (muscle-building) hormones to function properly. Testosterone, which is the main hormone that supports normal prostate function, is produced in the testicles and the adrenal glands.

Doctors can touch the posterior side of the gland, which is about the size of a walnut, to check it during a rectal exam. The urethra, the tube that carries urine from the bladder, traverses through the middle of the prostate. For such a small gland, it sure can cause problems.

Prostate Cancer

In the United States, prostate cancer is occurring at epidemic rates and is the most common malignancy in American men. Although 1-in-3 men are estimated to have prostate cancer, most will not die of it. Most prostate cancers grow slowly, and less than 10 percent of men with prostate cancer will die from it within 10 years.

What Causes Prostate Cancer?

No one is really sure what causes prostate cancer. During the past 50 years, it was thought that testosterone caused it. However, recent research has disproved that link. In fact, if testosterone caused prostate cancer, we should see a rash of young men with prostate cancer as their testosterone levels are at their highest when they are young.

The risk factors for prostate cancer include advancing age, a genetic tendency, hormonal influences, and such environmental factors as toxins, chemicals, and industrial products.

The chances of developing prostate cancer

Continued on page 3

In This Issue . . .

4 What Causes Prostate Cancer?...............................2

4 Benign Prostatic Hypertrophy.................................3

4 Prostatis..................................................................4

4 How to Promote a Healthy Prostate Gland............5

4 Top Nutrients for the Prostate................................6

52 Million Americans Have a

Thyroid Deficiency

and Don't Know it!

And it's linked to heart disease, stroke, cancer, diabetes -- 59 diseases in all!

ALERT: 40 to 70 percent of Americans have a thyroid hormone deficiency called "hypothyroidism" and do not know it!

And, according to Newsmax medical expert Dr. David Brownstein, what's even more shocking is that their doctors don't know it either, because the standard thyroid test is wildly inaccurate.

If left untreated, this thyroid deficiency can play a major contributing role in 59 separate diseases -- some that are just troubling, others that can ruin your life, Dr. David Brownstein, M.D. and a few that can actually kill you.

Fortunately, Dr. Brownstein, editor of the popular Dr. Brownstein's Natural Way to Health, will share with you the "correct thyroid test," along with the simple, "natural" solution in his exclusive special report, 59 Diseases Linked to Thyroid Imbalance -- yours FREE (a $20 value).

Discover what you'll receive in your FREE thyroid report . . .

An accurate, easy thyroid test you can do at home

Why the conventional thyroid tests are inaccurate

The link between low thyroid and heart disease

See the diseases caused by too much thyroid

Get effective natural solutions for overcoming thyroid disorders

That's just a small sampling of

NatNuartaulrWalaWy taoy tHoeaHletahlth Dr.DavidBrownstein's

Reco5v9eDrImFisaebsaatselears,nNBceeo,twMterLiFnrkoemd tSouTrgheyrryoid Dr.

DAavcihdieBvrionwgAn&cshtMieeivnaii'nsngta&inMingaiYnotauinr iOngptYimouarl

Optimal Health

Health

VolJ.u3l,yI2ss0u1eV07oAl. p3r, iIls2su01e04

I W With Simple NilluiotrInnIinesTThnAhisitsfsIsIfssesuuceet.e...d.. cpoharn1otatDsis7tllcsiNiaeiImrstpsd.nhtyiuvttaaeceMpiedehiebrcsirttvtaahl.neseuapthheemihfralmmdIerdngdYirTraih1asnhaanejasHqiaioaud,tilhinnee7yeahmiarpyipniygmandulsmclassfngattTtgdyejmrpleapitageuysWehotmuysdnusylcraentpadtiIAwirmohotaecrdoisreeycotrlosieelcetcwookowinsWdohentureeaJagtftiemhlau.i.srhcThsroebuo,irhrshieuesntcnJgiaimayedetodiserroTererJiyicryhcsynIupetrifhecy,hnedaoereclsntsveeiouicldlohi:hngplythodyoytdwdnArmrstsliIphdnteoiyhegfngatenodleis"fne.ettaeoe.hrdneio,rnyegsaensevnwuhaonmedopriDtogr.y,tsoobfaIbItriesmdeaiac'r,lHvisesoeolyueodscirossrnloAtpidIuiouseidhyafrwnehisreeraaw,sdftnhelonbiutieltwe3mocdrlnt,eenaserltylrrlsantsinnuerisneIitotaehedelgytnoinooi"4ssaoa,nmmsitisnsspoale.lrovctaddeenltornntmetyhpmlokfsdlnycahs-YrttdiIhdwaeoel,ssiinrtienlsyo.rhrtegequtoeiiwdmncklowinshniodaoliahankiurrwohadltrsenat,tkIavadi'saumnnietneewssehshinorsitntuhmatguaersapiJaeh.onneetgaoffoa,hisukig,dnpdviycua(oesonsrinftubmtntSatngondtdutrthcnNmetnr-eeaue,mulhlyotsesaocntimefrdhsJuttamoodfao'eIegoibtwrbcrthtoadrfocdsahteosta.usesvc.iehhenniei,edounwiasko,poiaeheenyioalfnhucrtaoaesfnAhaodts,ceaotDalasdelsladdwpemsmtjrilcsnhlltooeibrdsatatutipnuiyathtiiqnylcwnrlctusttmtiercscintpncieifyriwsrtncohewhfooneosau,oasrannrtugted.o,oieaefrtsoDtgolakto,gotoaneftnoihrpdnsrpeutihyAgetgoaawsttnribiundlphewovrnnecrkelrsiwrthbeardtramfwfptsrywdm5hfdpeareh.rIsdlrorysfabeeiifriespeirraiiiiieaimpslaft2utaye.an,trAteIorrttnnnoatyooneytlirNpwtpehrhnithfi.orfpIvhortnlilsg,"wommrnluegihoemmeviolciplnlueoeciihodibtbibtoanotdsbasttienvlanmsnnttegetadhrWpaor:tkhhsyarseuly.aerrriiydfasoae"tmavonhsgesocvdoavnal"?eaetltoeeeyaeutsfbeaatnolfmsbimraepiroeetwfiendolenhriT,fdllcboIrpbmFmiyaarrmioewotanlgypsyynfrs1hpoaoeyiageetlsaipiuelsehpsnauinltouonec.ttntmhept0rjyapntoinapnaullrucepiyrohbrnu.oaalttdwhapIoutoaalitai,tyoldtpWnldieeaowsrrraoaa,aootdtorryriiinheetrlctncctoahlesanoinlduessetretnnguseddeirrthmiadgelaumperttttotyntbepdudvtrthieivmtydoorrisrynhwordrsyhaiinrnpaupmhmcmtesoleoeteae,mtroyfpit'il,mcihlnilnutmoinartalaetaadsjadcthnanecisassoeeehaoaotoedtsotttstdtrs)yen.aeiamne,riirphokftorbrmrdutct.wxynboe.eavlidipoe"-hsfryifryeoe.Irropieeneoni,uoeoipsnfenirgsnnfnrltrpugenoad.orrticahrihejchatgr.notcaurglugEuoyesitriehalednsg,iiuadtirnaaatgrcstaeeiesdnounucotcdolaasousotUdud.hthhhfsmrcrlvmafehhnewTacliereIenoadtena.potJgaaheors.ssnhbehsfernouseerrwher,tsvfoBupaeshleeeresocaaendsogeeentmuInrtgegpirtaoe4eeehasschcytlmchfrbttIasercihlt4.awlsrec4upeeotLuecen4aesiucheadeocta)nhriWeb4nH4tdronfaeapwhn.4rnuegastdt.lfiutlodAdUe4N4aodttgtiussiceuDoAtl4reasateIcddsBsaeeeyDhnetc'9epxoettndDtrsctratjtueaesdsdnHerofBoi.kbhasedooe6edmietxAdhakrnwhlie.ntvtctn.aBdnniso,iteleessuu.hrmitaeeiyimnfungasye'sstag2nDfgt,emssn'mihieiftorlgtrlhap,ktdsfottsIoegnlttidgksdi'samoinyahsvhrhmlustdtcoynnaiBscrtawtBidweiaP.strDhraIlree2soaeeokirretufftttaijrauayesSoheoeraiygthciaoooeshhrlnagotnmerrurNlpJnenrhrhsueiked..lranfBttyrseiresersduTudsvsgnywdppoygdule"apIkyBeletemrosateyuatpideseLNtiiahglldoalIpeenhhhaiaknilrrslmaalnetllnogTysitytntiiaeNoosiolnoiioalngefraaoyeaefnbhsvlidmtdnseet,t--emywpevlaewwuwdanFgviatopleroegmemyGhiseJtos?uedoiHntmmsceaamaswsDrheuenuewnl-otoutbanmriafhepeade.TnsuhharhdeIndmegtssiarneoommeaievp.nafpeneHah.ny,Dprtoeehaei.tplyttdnbfeBllreaotcseltttyttyrehttadlshaliS'slaPaporriohih;beeavnenoesmiamndoruepsinniYneunyitraf,rrrhnwrieglfFepowdhndsknantuooTa.ssdtofgoegouenW.uhtysieodbemgyiuuc.wmrtvTteatses,dhgHcoArutccd.osuelihheheuinyotvrl.ekieethymhhiyihnftraa..oftgBitbgyyccaerneedso.shpiialywtri(yhonAggth.nnrayaeisstrBroetrtcobidnoyn.heaohnro,hlhnedeokoor.frshglo.ufodespaieooidn.aytteouayme.tfytgrsicilid.teettr.htradYlrdil,de.arns.dolrmrr.otoDidxtaYdiln.iow..btmi.CeyrynIeeIoaoehid.ghsi.c.uilSosagtse.Wodcr.ooi.dmtlTgluieat.aeahpu.S.m.esa.tclmltiadhe..muvh...nu.rdaoaseenlrlhn..xukEyr.rl..edapnewWee..re.es.a,ttt.nogfeghce.e.pryK.is.vb.ruhihbsdt..yhs--.is.H.xgdeeyn1p,ani.o.ieen...iehsry.esinol.i.grao.e.e.lays9.rder.ianr.eo.c.eT.ispDe5.gr.fnusv.tlin.ym.mrs.t7sst.b.l.ia.aeem.iny.,.ry.e.uhs.ucm.t,.l..r..l.nw.te.o.a..a.lhi.o..ib8ut.di.r..e..Ise.s.l.a..rcs.h.d.yn..i.an.o.rgaai...i....en.n.se.,ng...n..u.dl....ewc.y...a....,..g..s.no....g..c..k.....w..........t..se..Tt.....i.,....o...."..,.s..s............h........................i............s.........................2........2........4.3......5......64...7...86...7.8

all the potentially life-changing information you'll receive in this FREE special report.

Plus, if you order today you'll also receive a FREE three-month trial subscription to Dr. Brownstein's Natural Way to Health (a $13.50 value -- yours FREE!).

Get Dr. Brownstein's Natural Way to Health FREE!

Dr. Brownstein's Natural Way to Health is different from any other source of health information you've seen previously -- it's filled cover-to-cover with proven health strategies that combine the most recent insights about emerging natural therapies with the best of safe and conventional medical care. These are the same strategies that Dr. Brownstein has used successfully with his patients.

So jump-start your health and healing today and receive your own FREE copy of this urgent special report 59 Diseases Linked to Thyroid Imbalance with your no-risk subscription to Dr. Brownstein's Natural Way to Health.

Order Today!

FREE OFFER: Current Newsmax magazine subscribers get this special report FREE (a $20 value) -- plus a threemonth trial subscription to Dr. Brownstein's Natural Way to Health absolutely FREE (a $13.50 value). You don't even have to pay shipping (a $4.95 value)! That's a total value of more than $38 -- yours FREE!

SPECIAL OFFER: Not a subscriber to Newsmax magazine? No problem -- you can get Dr. Brownstein's special report 59 Diseases Linked to Thyroid Imbalance for just $9.95 (a $10 savings) -- with no additional shipping charge (a $4.95 value). Plus, you'll receive a FREE three-month trial subscription to Dr. Brownstein's Natural Way to Health (a $13.50 value). This is still a $28 value -- yours FREE!

To Order Online:

brownstein

Or Call Toll-Free:

1-800-485-4350 Ext. 58

YOUR SPECIAL OFFER CODE

A5DB-1

Continued from page 1

increase with age. Most prostate cancers occur in older men.

Some lifestyle choices can influence prostate cancer. Smoking cigarettes, for example, increases the risk of getting it.

Prostate cancer can be detected during a digital rectal exam. A cancer feels like very hard, nodular tissue. It is recommended that men older than 50 have a yearly digital rectal exam to assess the gland. Prostate cancer also can be detected with a prostate specific antigen (PSA) test. The PSA test is a simple blood test.

There are conflicting recommendations on whether men older than 50 should get a yearly PSA test. Recent studies have found that large numbers of men need a PSA screening to detect and survive prostate cancer. In fact, one study found a 15 percent higher death rate, when compared with the control group, even though PSA screening detected more prostate cancers.1

The authors of this study stated, "After 2.5 decades of screening for breast and prostate cancer, conclusions are troubling: Overall cancer rates are higher, many more patients are being treated, and the absolute incidence of aggressive or latestage disease has not been significantly decreased. Additional gains [from screening] are unlikely with the current approach and may inadvertently add to the burden of treatment and diagnosis for relatively [non-lethal] disease."2

There are conflicting recommendations on what to do about prostate cancer. Some say watchful waiting, while others claim that aggressive therapy

such as surgery, chemotherapy, and radiation is the best way to go.

The age-adjusted mortality rates for prostate cancer over the past 75 years are virtually unchanged.

Benign Prostatic Hypertrophy

Benign prostatic hypertrophy (BPH) refers to a condition in which the prostate gland has enlarged. The prostate gland normally increases in size as a man ages. It begins growing at about 30 years of age. When the gland is larger than expected for the size and age of the individual, it is given the term BPH. About 50 percent of men have evidence of BPH by age 50, and 75 percent have it by 80.

BPH symptoms occur when the prostate gland enlarges to the point that a patient has difficulty urinating. Those symptoms can be urinary frequency, urgency (the compelling need to urinate), incontinence, and nocturia (nighttime urination). BPH also can manifest with symptoms such as having a weak urinary stream, hesitancy (difficulty initiating urination), intermittency (urine stream continually starts and stops), and leakage. Pain can occur if BPH becomes so severe that it blocks the outflow of urine. If BPH progresses, renal failure can ensue.

There is no known cause of BPH, although testosterone once was thought to be the culprit. However, similarly to prostate cancer, if that were the case, we could expect BPH to occur in young men.

Dihydrotestosterone (DHT) is a metabolite of testosterone. It is synthesized in the prostate from testosterone by the action of an enzyme (5-reductase). There are medications that block 5-reductase that can result in shrinkage of the

Dr. David Brownstein's Natural Way to Health is a publication of Newsmax Media, Inc., and . It is published monthly at a charge of $49.00 per year and is offered online and in print through .

Our editorial offices are located at 560 Village Boulevard, Ste. 120, West Palm Beach, Florida 33409.

The owner, publisher, and editor are not responsible for errors and omissions. Rights of reproduction and distribution of this newsletter are reserved.

Any unauthorized reproduction or distribution of information contained herein, including storage in retrieval systems or posting on the Internet, is expressly forbidden without the consent of Newsmax Media.

For permission, contact the publisher at: PO Box 20989, West Palm Beach, Florida 33416.

CEO Christopher Ruddy Health Publisher Travis Davis Author David Brownstein, M.D.

Contributing Editor Greg Brown

Production/Art Director Elizabeth Dole

To contact Dr. David Brownstein's Natural Way to Health send e-mail to: askdrdavid@.Subscription/Customer Service contact 1-800-485-4350 or naturalway@newsmax. com. Send e-mail address changes to naturalway@

? 2010 Newsmax Media, all rights reserved. Please note that this advice is generic and not specific to any individual. You should consult with your doctor before undertaking any medical or nutritional course of action.

Page 3

Special Issue

prostate gland. Finesteride (Proscar and Propecia) and dutasteride (Avodart) are 5-reductase inhibitors. These medications can provide some relief from BPH symptoms, but they must be taken for a very long time and are very expensive. Their side effects include a lowered libido.

Surgery sometimes is indicated for BPH. If symptoms become severe enough, a urologist may perform a TURP (transurethral resection of the prostate). A small catheter is placed in the urethra and the surgeon cuts away or lasers the excess tissue that is inhibiting urine outflow.

Newer therapies include microwave thermotherapy and transurethral needle ablation (TUNA). These procedures can be lifesaving for some men.

My experience and recent research have shown that estrogens probably are more responsible for BPH and prostate cancer than testosterone and DHT. I continually see that men with high estrogen levels have more prostate problems.

Estrogens can be from both endogenous (produced internally) and exogenous (exposure from the environment) sources.

Men produce estrogen from their adrenal glands and fat cells. They also can convert testosterone into estrogens via an enzyme known as aromatase. Aromatase activity is stimulated by obesity, insulin, and the aging process. Needless to say, the heavier a man is, the more aromatase enzyme can be stimulated.

Unfortunately, we are exposed to an everincreasing amount of estrogen-like chemicals (xeno-estrogens) in the environment. These xenoestrogens are everywhere. They are found in plastics, pesticides, fertilizers, computers, and birth-control pills, as well as other commonly found consumer products. Furthermore, these products can be found in our food supply if the food has been contaminated with xeno-estrogens from pesticides.

Soy, a common ingredient in many foods, has estrogenic properties. I believe all soy products (except fermented soy products such as miso or tempeh) should be avoided.

Special Issue

My experience has shown that men who consume a lot of non-fermented soy products have more prostate problems and more severe prostate problems, compared with men who avoid soy.

Prostatitis

Prostatitis, which is an inflammation of the prostate gland, gives the gland an enlarged and boggy feeling. Prostatitis can cause pain in the groin and the rectum, as well as difficulty urinating. Other symptoms include nocturia (nighttime urination), pain in the abdomen or lower back, testicular pain, and painful ejaculations. Prostatitis obviously can make a man miserable.

The cause can be a bacterial infection of the prostate gland. Fever, chills, nausea, vomiting, and malaise commonly are associated with prostatitis that results from a bacterial infection. However, bacterial infection of the prostate gland accounts for only 10 percent of the cases of prostatitis. Acute cases of bacterial prostatitis can be treated successfully with antibiotics.

Bacterial prostatitis can develop into chronic bacterial prostatitis. In these cases, patients will have frequent bacterial infections. Over time, antibiotic therapy becomes less successful in chronic bacterial prostatitis.

Most cases of prostatitis are not understood well.

David Brownstein, M.D., is a board-certified family physician and one of the foremost practitioners of holistic medicine. Dr. Brownstein has lectured internationally to physicians and others about his success with natural hormones and nutritional therapies in his practice. His books include Drugs That Don't Work and Natural Therapies That Do!; Iodine: Why You Need It, Why You

Can't Live Without It; Salt Your Way To Health; The Miracle of Natural Hormones; Overcoming Arthritis; Overcoming Thyroid Disorders; The Guide to a Gluten-Free Diet; The Guide to Healthy Eating; and The Guide to a Dairy-Free Diet. He is a medical advisor for Medix Select and the medical director of the Center for Holistic Medicine in West Bloomfield, Mich., where he lives with his wife, Allison, and their teenage daughters, Hailey and Jessica. For more information about Dr. Brownstein, please go to brownstein.

Page 4

Most patients will complain of pain in the groin area and difficulty urinating. Some medications do help prostatitis including antibiotics, but many patients suffer with long-term symptoms.

How to Promote a Healthy Prostate Gland

Prostate problems are not a normal course of the aging process. It is true that aging men have more prostate problems, compared with younger men. However, my clinical experience has shown that adopting a holistic lifestyle helps most men who suffer from prostate problems. This includes proper diet and exercise, as well as introducing the proper nutritional supplements where necessary.

Top Nutrients for the Prostate

1. Saw Palmetto The saw palmetto plant has round red berries

that contain a fat-soluble extract that inhibits 5- reductase, the enzyme that converts testosterone into DHT (previously discussed).3 Research has shown that saw palmetto extract reduces nighttime urination and improves urinary flow rates.4

2. Nettle Root Nettle root has been shown to block both 5-

reductase and aromatase (the enzyme that converts testosterone into estrogen -- discussed above).

3. Pygeum Pygeum helps to lower inflammatory mediators

in the prostate.5, 6 It is thought that inflammatory mediators in the prostate are responsible for prostatitis and BPH.

4. Selenium Selenium is a potent antioxidant and has

anticarcinogenic effects. One study found significantly lower prostate cancer among users.7 Other studies show the positive effects of selenium on the prostate. Some recent research has challenged these assertions. My experience has shown clearly that men with the lowest selenium levels have significantly more prostate problems, compared with men with higher selenium levels.

5. Vitamin D More than 20 years ago, researchers began

proposing that higher levels of vitamin D help protect against prostate cancer. Recent research has validated this viewpoint. Prostate cancer cells exposed to vitamin D3 show increases in apoptosis (killing of cancer cells) and decreases in proliferation, invasiveness, and metastasis.8 My clinical experience has shown that patients with the

Continued on page 5

BPH and Nutritional Supplements

Phil is my father-in-law. He was suffering from frequent urination and nocturia (nighttime urination). "I was exhausted. I could not sleep more than two hours at a time as I had to keep getting up to urinate," he said.

When Phil would drive any distance over 100 miles, he would have to make sure to stop at all the rest stops to urinate. I sent Phil to a urologist who diagnosed him with benign prostatic hypertrophy. The urologist claimed that Phil was urinating through a "pea-hole" because his prostate was so enlarged. Phil underwent a procedure to open up the urethra (TURP) and had immediate positive results.

"Right after the surgery, I felt better. I could sleep for three-four hours at a time," he said.

When Phil saw the urologist for a recheck, he

asked the urologist how he could prevent BPH from happening again. The urologist claimed there was nothing he could do to prevent BPH.

When Phil told me what the urologist said, I told him, "There are many things you can do to prevent and treat BPH." I placed Phil on a supplement regimen that included saw palmetto, boswellia, nettle root, pygeum, and beta-sitosterol.

After one month of taking this regimen, Phil commented, "My urination is so much better. The TURP helped to a point, but the supplements help even more. Now, I can sometimes sleep through the entire night."

It has been three years since Phil started the supplements, and he is still doing well.

Page 5

Special Issue

Continued from page 4

lowest vitamin D levels often have the worst prostate illnesses.

6. Beta Sitosterol Beta sitosterol is a plant sterol

compound similar to cholesterol. It is thought to work in the prostate by inhibiting an enzyme -- 5-alpha-reductase. This blocks

Prostate Quick Facts

? About 1 in 6 males will be diagnosed with prostate cancer during his lifetime23

? Prostate cancer is the secondleading cause of cancer death in American men, behind only lung cancer

? The likelihood of developing an enlarged prostate increases with age

? Half of all men in their 50s, and 80 percent in their 80s, have some symptoms of BPH24

? 6 0 percent of men older than 60 have BPH

the conversion of testosterone into DHT (dihydrotestosterone) (explained above). In a test, 200 men with BPH were randomized to receive either beta sitosterol or a placebo. After six months, the beta-sitosterol group had significant improvements in many symptoms of BPH.9 Beta sitosterol also has been shown to decrease prostate cancer cell growth and induce apoptosis.10

7. Pumpkin Seed Pumpkin seed has been shown

to decrease BPH symptoms when

Special Issue

used with saw palmetto.11 It is also thought to decrease the conversion of testosterone into estrogens by inhibiting the enzyme aromatase. One study showed pumpkin seed extract reduced the activity of aromatase by 50 percent.12

7 Steps for Living Statin Free

8. Hydrangea Hydrangea can help improve

urine output in patients with prostate problems.13

9. Lycopene Lycopene is a phytochemical

found in tomatoes and other red fruits and vegetables. It is a potent antioxidant that has been shown to have inhibitory effects on prostate cancer cells.14 Other studies have shown prostate cancer risk decline as lycopene intake increased.15, 16 Low concentrations of lycopene may be associated with aggressive prostate cancer.17

10. Pomegranate In a research study, 46 prostate

cancer men were given 8 ounces of pomegranate juice to drink daily. Sixteen out of 46 men had a decrease in PSA levels, and the overall PSA doubling time was four times slower after they began drinking pomegranate juice.18 The makers of pomegranate juice funded this study.

11. Zinc Zinc plays a key role in the

body, promoting DNA repair and regulating immune function. A study at Oregon State University found that low zinc levels had a

For the first time ever, world-renowned heart expert Dr. Chauncey Crandall reveals his seven simple ways to get off statins safely in a FREE special report -- 7 Steps for Living Statin Free. These are the same strategies Dr. Crandall uses with his own patients, many of whom now are thriving in a life without statins -- and even better, without the fear that comes with high cholesterol.

Claim your FREE special report, 7 Steps for Living

Statin Free, today at: msf

Or Call Toll-Free:

1-800 -485-4350 ext.50

YOUR SPECIAL OFFER CODE

A5DC-1

Page 6

Symptoms of BPH

Less than half of all men with BPH have the following symptoms:25 ? Dribbling at the end of urinating ? Inability to urinate (urinary retention) ? Incomplete emptying of the bladder ? Incontinence ? The need to urinate two or more times a night ? Pain with urination or bloody urine (may

indicate infection) ? Difficultly starting urinary stream ? Strong and sudden urge to urinate ? Weak urine stream

marked decrease in cell viability in BPH cells. Zinc was found to induce apoptosis or programmed cell death in BPH cells.19 Other studies have found that too much zinc (>100mg/day) actually can increase the risk of prostate cancer.20

12. Copper Low copper levels have been associated with

an increased rate of prostate cancer. Also, a small amount of copper should be taken when taking zinc to avoid copper depletion.

13. Vitamin E Researchers showed that vitamin E succinate has

been shown to inhibit the expression of prostate specific antigen in prostate cancer cells.21 Other studies have shown no positive effects with vitamin E. However, many of these studies use a synthetic form of vitamin E. Prostate Revive contains the same form of vitamin E (succinate) that has been shown to be effective in prostate cancer.

14. Boswellia Boswellic acids, the main active ingredients

of boswellia serrata extracts, may have potent anti-inflammatory properties, and may represent promising agents for the treatment of inflammatory diseases.22

15. Flower Pollen Numerous studies have been conducted showing

evidence that flower pollen improves symptoms associated with BPH as well as occurrences of nocturia (frequent nighttime urination).

Note: Dr. David Brownstein personally formulated the dietary supplement Prostate ReviveTM to include all the essential natural ingredients necessary to promote a healthy prostate gland as well as help one heal from a variety of prostate conditions. For more information on Prostate ReviveTM, please visit revive.

1 NEJM. 2009;360:1310-19 2 IBID. JAMA. Oct 21, 2009 3 Pharmacology 82 (4): 270?5. 2008 4 Nutr Res Pract. 2009 5 HerbalGram. 1998;43:49-53. 6 Minerva Urol Nephrol. 1987 Jan;39(1):45-50 7 J. of Urology. Dec. 2001;166:2034-38 8 Trends Endocrin. Metab. 2003. Nov;14(9):423 9 BJU Int. 2000 May;85(7):842-6 10 In Vivo. 2005 Jan-Feb;19(1):293-300. 11 Nutr Res Pract. 2009 Winter; Department of Food Service Management and Nutrition,

Sangmyung University, Hongji-dong, Jongro-gu, Seoul 110-743, Korea 12 Available at: . Accessed

6.13.10 13 Ann Intern Med 1997;127:169-70. 14 J. Nat. Cancer Inst. 87(23):1767-76. 2005 15 Current Topics in Nutraceutical Research Vol. 2, No.3 2004 pp. 127-136 16 Carcinogenesis 1997 18:1847-50. 17 Am J Epidemiol 2002 155:1023-32 18 Clinc. Cancer. Res. July 1, 2006 19 From: . Accessed 6.13.10 20 J Natl Cancer Inst. 2003 Jul 2;95(13):1004-7 21 P. Nat. Acad. Sciences. May 28, 2002. Vol. 99 N. 11 22 DMD Fast Forward. Published on March 20, 2008 as doi:10.1124/dmd.107.0184242002.

Vol. 99 N. 11 23 Available at

statistics_for_prostate_cancer_36.asp. Accessed 6.15.10 24 American Urological Association Education and Research Inc. Guideline on the

Management of Benign Prostatic Hyperplasia (BPH). 2003. 25 Available at . Access

6.15.10

Please note: All information presented in Dr. David Brownstein's Natural Way to Health is for informational purposes only. It is not specific medical advice for any individual. All answers to reader questions are provided for informational purposes only. All information presented in Dr. David Brownstein's Natural Way to Health should not be construed as medical consultation or instruction. You should take no action solely on the basis of this publication's contents. Readers are advised to consult a health professional about any issue regarding their health and well-being. While the information found in Dr. David Brownstein's Natural Way to Health is believed to be sensible and accurate based on the author's best judgment, readers who fail to seek counsel from appropriate health professionals assume risk of any potential ill effects. The opinions expressed in Dr. David Brownstein's Natural Way to Health do not necessarily reflect those of Newsmax Media.

Page 7

Special Issue

 ................
................

In order to avoid copyright disputes, this page is only a partial summary.

Google Online Preview   Download